Web Develpoment System

8/2/2019 Web Develpoment System

1/51


2/51

&&((5577,,)),,&&$$77((

77KKLLVVLLVVWWRRFFHHUUWWLLII\\WWKKDDWWWWKKHHWWKKHHVVLLVVHHQQWWLLWWOOHHGG::((%%''((99((//332200((117766


3/51

''((&&//$$55$$77,,2211

,, KKHHUUHHEE\\ GGHHFFOODDUUHH WWKKDDWW WWKKHH ZZRRUUNN EEHHLLQQJJ VVXXEEPPLLWWWWHHGG WWRR WWKKHH 33RRVVWW **UUDDGGXXDDWWHH ''HHSSDDUUWWPPHHQQWW RRII

00DDQQDDJJHHPPHHQQWW 6666&&0077 &&RROOOOHHJJHH $$PPUULLWWVVDDUU EE\\ PPHH LLQQ WWKKHH SSUURRMMHHFFWW XXQQGGHHUU WWLLWWOOHH ::((%%''((99((//332200((117766


4/51

$$&&..1122:://((''**((00((1177

77ZZRRRRUUPPRRUUHHFFDDQQGGRRDDZZRRUUNNRRIIWWKKLLVVQQDDWWXXUUHH,,KKDDYYHHEEHHHHQQDDEEOOHHWWRREEUULLQQJJSSUURRMMHHFFWWLLQQWWKKLLVVSSUUHHVVHHQQFFHH

VVKKDDSSHHRRQQOO\\EEHHFFDDXXVVHHRRIIKKHHDDUUWWLLOO\\FFRRRRSSHHUUDDWWLLRRQQRRIIDDKKHHDDGGVV KKDDQQGGVV77KKHHUUHHDDUUHH VVRRPPHHZZKKRRKKDDYYHH

EEOOHHVVVVHHGG VVRRPPHH ZZKKRR KKDDYYHH DDGGYYLLVVHHGG VVRRPPHH ZZKKRR KKDDYYHH ZZLLVVKKHHGG DDQQGG VVRRPPHH ZZKKRR KKDDYYHH DDVVVVLLVVWWHHGG

77KKXXVVHHDDFFKKKKDDVVFFRRQQWWUULLEEXXWWHHGGRRQQHHVVPPLLJJKKWWLLQQVVRRPPHHIIRRUUPPRRUUWWKKHHRRWWKKHHUU

77KKDDQQNNVVEEHHLLQQJJDDVVPPDDOOOOZZRRUUGGFFDDQQQQRRWWEEHHHH[[SSUUHHVVVVHHGGWWKKHHLLPPPPHHQQVVHHVVHHQQVVHHRRIIJJUUDDWWLLWWXXGGHHRRQQHHGGZZHHOOOOVV

LLQQ WWKKHHKKHHDDUUWW WWRRZZDDUUGGVVDDQQ\\RRQQHH66RR LLVV WWKKHH WWUUXXHHZZLLWWKK WWKKLLVVKKXXPPEEOOHHVVHHOOIIZZKKLLOOHHVVWWDDUUWWLLQQJJVVRR LLQQ WWKKLLVV

OOLLQQHH

,,ZZRRXXOOGGOOLLNNHHWWRRWWKKDDQQNNPPHHSSUURRMMHHFFWW**XXLLGGHHOOHHFFWW$$PPDDQQGGHHHHSSNNDDXXUUIIRRUUVVSSHHQQGGLLQQJJKKLLVVSSUUHHFFLLRRXXVVWWLLPPHH

LLQQJJDDWWKKHHUULLQQJJNNQQRRZZOOHHGGJJHHSSUURRSSHHUUJJXXLLGGDDQQFFHHHHQQFFRRXXUUDDJJHHPPHHQQWWDDQQGGYYDDOOXXDDEEOOHHVVXXJJJJHHVVWWLLRRQQVV

,, WWDDNNHH WWKKHHSSUULLYYLLOOHHJJHHRRII FFRRQQYYHH\\LLQQJJRRXXUU KKHHDDUUWWLLHHVVWWJJUUDDWWLLWWXXGGHH WWRRDDOOOORRII WWKKHHVVHHZZKKRRGGLLUUHHFFWWOO\\RRUU LLQQ

GGLLUUHHFFWWOO\\HHQQDDEEOOHHGGXXVVWWRRFFRRPPSSOOHHWWHHWWKKHHGGLLVVVVHHUUWWDDWWLLRRQQ

//DDVVWWEEXXWWQQRRWWWWKKHHOOHHDDVVWWZZHHDDUUHHKKLLJJKKOO\\WWKKDDQQNNIIXXOOWWRRRRXXUUSSDDUUHHQQWWVVDDQQGGPP\\IIUULLHHQQGGVVIIRRUUWWKKHHUUHHHHYYHHUU

ZZLLOOOOLLQQJJFFRRRRSSHHUUDDWWLLRRQQDDQQGGPPRRUUDDOOVVXXSSSSRRUUWW

$$..66++,,$$552255$$

&217(176

y ,QWURGXFWLRQ$ERXW&RPSDQ\o 2EMHFWLYHVRIWKH&RPSDQ\

y 3URGXFWDQG6HUYLFHV


5/51

y &XVWRPL]HG6RIWZDUH'HYHORSPHQW

y :HEVLWH'HVLJQ6ROXWLRQV

o (&RPPHUFH6ROXWLRQV

y 6HDUFK(QJLQH2SWLPL]DWLRQ

y 'DWDEDVH'HVLJQDQG'HYHORSPHQW

y &RQWHQW0DQDJHPHQW6ROXWLRQy 0LVVLRQ6WDWHPHQWV

y SHUVRQQHORIWKH&RPSDQ\

y :RUN([SHULHQFH

o +70/

o &66

o 3+3

o $'2%(3+2726+23

o '%0V

o 64/

y ,QWURGXFWLRQ2EMHFWLYHVRI:HE'HYHORSPHQWy :HEGHYHORSPHQWDVDQLQGXVWU\

y 7\SLFDO$UHDV

y &OLHQW6LGH&RGLQJ

o 6HUYHU6LGH&RGLQJ

o &OLHQW6LGH6HUYHU6LGH

o 'DWDEDVH7HFKQRORJ\

y 3UDFWLFDO:HE'HYHORSPHQW

o %DVLF

o $GYDQFHGy 6HFXULW\&RQVLGHUDWLRQV

y 15 Web Site Development Process

y 16 Web Components

o 16.1Client and Server Side Coding

o 16.2 Domains Names, URLs and IP Addresso 16.3 Registrars

y 17 Coding

y 18Conclusion


6/51


7/51

MANSA INFOTECH: M

ansa Infotech is an offshore WebDevelopment and Web Solutions Company in India with client base all

over the world. They provide versatile, high quality and cost effective

services which include web hosting, Internet marketing, SEO Services,

Search Engine Marketing, Software Development, E-Commerce


8/51


9/51


10/51


11/51

Public sector organizations that monitor or control private sectoractivities have objectives that are to ensure that the business they are

monitoring comply with the laws laid down.

Health care and education establishments their objectives areto provide a service most private schools for instance have charitable

status. Their aim is the enhancement of their pupils through education.

Charities and voluntary organizations their aims and objectivesare led by the beliefs they stand for.

Changing Objectives

A business may change its objectives over time due to the following

reasons:

A business may achieve an objective and will need to move onto another

one (e.g. survival in the first year may lead to an objective of increasing

profit in the second year).

The competitive environment might change, with the launch of new

products from competitors.

Technology might change product designs, so sales and productiontargets might need to change.

Products and Services

Mansa Infotech provides the following solutions:

y Customized Software Development


12/51


13/51


14/51

y ASP.NET:ASP.NET is a Web application framework developedand marketed by Microsoft to allow programmers to build dynamic

Web sites, Web applications and Web services.

y JAVA:Javais a general-purpose, concurrent, class-based, object-oriented language that is specifically designed to have as few

implementation dependencies as possible. It is intended to let

application developers "write once, run anywhere.

E-Commerce Solutions

This is our specialty. They are ecommerce experts. They

understand how to build a website that sells. They can help designan end-to-end ecommerce solution from start to finish. They will

help you:

y Set up a merchant account and negotiate the best rate

y Pick a domain name that sells

y Design an ecommerce friendly website

y Implement payment methods such as Visa/MC and PayPal

y Integrate shopping cart functionality

y Create a trusted web presence with a valid SSL certificateand risk prevention tools

y Manage risk from fraud with industry leading fraudmanagement tools.

Search Engine OptimizationHaving a great website is only half the battle; we still need

qualified traffic to present our ideas to. MansaInfotech can deliver

a traffic driving strategy for your business. They can:

y Optimize your website for organic search


15/51


16/51


17/51

most advanced information technologies, including computer systems,

software, storage systems and microelectronics. We translate theseadvanced technologies into value for our customers through our

professional solutions, services and consulting businesses worldwide.

PERSONNEL OF COMPANY:

Number of emplyees 70

Education Level BCA,MCA,B-TECH,M-

TECH,MBA-IT

Dress FormalAge GROUP 21-45

Behaviour Respectable,Moral,Ethical,Discourge

Discrimination related to

race,gender,color,religion,marital

status etc.

Groming Web/online e-learning


18/51

During training, I learn following language:

HTML: Hypertext Markup Language (HTML) is the predominantmarkup language for web pages. HTML elements are the basic building-

blocks of webpages.


19/51

HTML is written in the form of HTML elements consisting of tags,

enclosed in angle brackets (like ), within the web page content.HTML tags most commonly come in pairs like and ,

although some tags, known as empty elements, are unpaired, for

example . The first tag in a pair is the starttag, the second tag isthe end tag (they are also called opening tags and closing tags). In

between these tags web designers can add text, tags, comments, and

other types of text-based content.

The purpose of a web browser is to read HTML documents and compose

them into visible or audible web pages. The browser does not display the

HTML tags, but uses the tags to interpret the content of the page.

HTML elements form the building blocks of all websites. HTML allows

images and objects to be embedded and can be used to create interactiveforms. It provides a means to create structured documents by denoting

structural semantics for text such as headings, paragraphs, lists, links,

quotes and other items. It can embed scripts in languages such as

JavaScript which affect the behavior of HTML webpages.

Web browsers can also refer to Cascading Style Sheets (CSS) to define

the appearance and layout of text and other material.

CSS:Cascading Style Sheets (CSS) is a style sheet language used todescribe the presentation semantics (the look and formatting) of a

document written in a markup language. Its most common application isto style web pages written in HTML and XHTML, but the language can

also be applied to any kind of XML document, including plain XML,

SVG and XUL.

CSS is designed primarily to enable the separation of document content(written in HTML or a similar markup language) from document

presentation, including elements such as the layout, colors, and fonts.

This separation can improve content accessibility, provide more

flexibility and control in the specification of presentation characteristics,

enable multiple pages to share formatting, and reduce complexity and


20/51


21/51


22/51

servers, many operating systems and platforms, and can be used with

many relational database management systems (RDBMS). It isavailablefree of charge, and the PHP Group provides the complete source code

for users to build, customize and extend for their own use.

SYNTAX

The PHP interpreter only executes PHP code within its delimiters.

Anything outside its delimiters is not processed by PHP (although non-

PHP text is still subject to control structures described within PHP

code). The most common delimiters are to close

PHP sections.

ADOBE PHOTOSHOP: Adobe Photoshop is a graphics editingprogram developed and published by Adobe Systems Incorporated.

Adobe's 2003 "Creative Suite" rebranding led to Adobe Photoshop 8'srenaming to Adobe Photoshop CS. Thus, Adobe Photoshop CS5 is the

12th major release of Adobe Photoshop. The CS rebranding also resulted

in Adobe offering numerous software packages containing multiple

Adobe programs for a reduced price. Adobe Photoshop is released in

two editions: AdobePhotoshop, and Adobe PhotoshopExtended, withthe Extended having extra 3D image creation, motion graphics editing,

and advanced image analysis features Adobe Photoshop Extended is

included in all of Adobe's Creative Suite offerings except Design

Standard, which includes the Adobe Photoshop edition.

Alongside Photoshop and Photoshop Extended, Adobe also publishesPhotoshop Elements and Photoshop Lightroom, collectively called "The

Adobe Photoshop Family". In 2008, Adobe released Adobe Photoshop

Express, a free web-based image editing tool to edit photos directly onblogs and social networking sites; in 2011 a version was released for the

Android operating system and the iPhone.

DBMS: A database management system (DBMS) is a softwarepackage with computer programs that control the creation, maintenance,


23/51


24/51


25/51


26/51


27/51


28/51

INTRODUCTION:Web developmentis a broad term for the work involved in developing a

web site for the Internet (World Wide Web) or an intranet (a private

network). This can include web design, web content development, client

liaison, client-side/server-side scripting, web server and network security

configuration, and e-commerce development. However, among web

professionals, "web development" usually refers to the main non-design

aspects of building web sites: writing markup and coding. Web

development can range from developing the simplest static single page

of plain text to the most complex web-based internet applications,

electronic businesses, or social network services.

For larger organizations and businesses, web development teams can

consist of hundreds of people (web developers). Smaller organizations

may only require a single permanent or contracting webmaster, or

secondary assignment to related job positions such as a graphic designer

and/or information systems technician. Web development may be a

collaborative effort between departments rather than the domain of a

designated department.

Objective and Scope

Web developmentis the process of designing websites a collection of

online content including documents and applications that reside on a

web server/servers.

As a whole, the process of web development includes planning, post-production, research, advertising, as well as media control that is applied

to the pages within the site by the designer or group of designers with a

specific purpose. The site itself can be divided into its main page, also


29/51

known as the home page, which cites the main objective as well as

highlights of the site's daily updates; which also contains hyperlinks thatfunctions to direct viewers to a designated page within the site's domain.

Web development as an industry

Since the mid-1990s, web development has been one of the fastest

growing industries in the world. In 1995 there were fewer than 1,000web development companies in the United States, but by 2005 there

were over 30,000 such companies in the U.S. alone. The growth of this

industry is being pushed by large businesses wishing to sell products and

services to their customers and to automate business workflow.

In addition, cost of Web site development and hosting has droppeddramatically during this time. Instead of costing ten thousands of dollars,

as was the case for early websites, one can now develop a simple website for free using one of the many free website builders such as Google

Sites etc., depending on the complexity and amount of content. SmallerWeb site development companies are now able to make web design

accessible to both smaller companies and individuals further fueling the

growth of the web development industry. As far as web development

tools and platforms are concerned, there are many systems available tothe public free of charge to aid in development. A popular example is

the LAMP (LINUX,MYSQ,PHP) stack, which is usually distributed free

of charge. This fact alone has manifested into many people around the

globe setting up new Web sites daily and thus contributing to increase in

web development popularity. Another contributing factor has been therise of easy to use WYSIWYG web development software, most

prominently Adobe Dreamweaver, Netbeans, WebDev, orMicrosoft

Expression Studio, Adobe Flex. Using such software, virtually anyonecan develop a Web page in a matter of minutes. Knowledge of Hyper

Text Markup Language (HTML), or other programming languages is not

required, but recommended for professional results.

The next generation of web development tools uses the strong growth in

LAMP, Java Platform Enterprise Edition technologies and Microsoft


30/51

.NET technologies to provide the Web as a way to run applications

online. Web developers now help to deliver applications as Web serviceswhich were traditionally only available as applications on a desk based

computer.

Instead of running executable code on a local computer, users are

interacting with online applications to create new content. This has

created new methods in communication and allowed for many

opportunities to decentralize information and media distribution. Users

are now able to interact with applications from many locations, instead

of being tied to a specific workstation for their application environment.

Examples of dramatic transformation in communication and commerce

led by web development include e-commerce. Online auction sites such

as eBay have changed the way consumers consume and purchase goodsand services. Online resellers such as Amazon.com and Buy.com

(among many, many others) have transformed the shopping and bargain

hunting experience for many consumers. Another good example of

transformative communication led by web development is the blogWeb

applications such as WordPress and Movable Type have created easily

implemented blog environments for individual Web sites. Open source

content management systems such as Joomla!, Drupal, XOOPS, andTYPO3 and enterprise content management systems such as Alfresco

have extended web development into new modes of interaction andcommunication.

In addition, web development has moved to a new phase of Internet

communication. Computer web sites are no longer simply tools for work

or commerce but used most for communication. Websites such asFacebook and Twitter provide users a platform to freely communicate.

This new form of web communication is also changing e-commerce

through the number of hits and online advertisement.


31/51

Typical Areas

Web Development can be split into many areas and a typical and basic

web development hierarchy might consist of:

Client Side Coding

y Ajax Asynchronous JavaScript provides new methods of using

JavaScript, and other languages to improve the user experience.

y Flash Adobe Flash Player is an ubiquitous browser plugin ready for

RIAs. Flex 2 is also deployed to the Flash Player (version 9+).

y JavaScript Formally called ECMAScript, JavaScript is a ubiquitous

client side platform for creating and delivering rich Web applicationsthat can also run across a wide variety of devices.

y JQuery Cross-browser JavaScript library designed to simplify and

speed up the client-side scripting of HTML.

y Microsoft Silverligt Microsoft's browser plugin that enables

animation, vector graphics and high-definition video playback,

programmed using XAML and .NET programming languages.

y Real Studio Web Edition is a rapid application development

environment for the web. The language is object oriented and issimilar to both VB and Java. Applications are uniquely compiled to

binary code.

y HTML5 and CSS3 Latest HTML proposed standard combined withthe latest proposed standard for CSS natively supports much of the

client-side functionality provided by other frameworks such as Flash

and Silverlight

Looking at these items from an "umbrella approach", client side coding

such as XHTML is executed and stored on a local client (in a web browser) whereas server side code is not available to a client and is

executed on a web server which generates the appropriate XHTML

which is then sent to the client. The nature of client side coding allows

you to alter the HTML on a local client and refresh the pages with

updated content (locally), web designers must bear in mind the


32/51


33/51

characteristics that demand special considerations. In recent years of

web development there have been some developments towardsaddressing these problems and requirements. As an emerging discipline,

web engineering actively promotes systematic, disciplined and

quantifiable approaches towards successful development of high-quality,ubiquitously usable web-based systems and applications.(3)(4) In

particular, web engineering focuses on the methodologies, techniques

and tools that are the foundation of web application development and

which support their design, development, evolution, and evaluation.

Web application development has certain characteristics that make it

different from traditional software, information system, or computer

application development.

Web engineering is multidisciplinary and encompasses contributions

from diverse areas: systems analysis and design, software engineering,

hypermedia/hypertext engineering, requirements engineering, human-computer interaction, user interface, information engineering,

information indexing and retrieval, testing, modeling and simulation,

project management, and graphic design and presentation. Webengineering is neither a clone, nor a subset of software engineering,

although both involve programming and software development. While

web engineering uses software engineering principles, web developmentencompasses new approaches, methodologies, tools, techniques, and

guidelines to meet the unique requirements for web-based applications.

Client Side + Server Side

y Google Web Toolkit provides tools to create and maintain complex

JavaScript front-end applications in Java.

y Opa is a high-level language in which both the client and the server

parts are implemented. The compiler then decides which parts run on

the client (and are translated automatically to JavaScript) and which

parts run on the server. The developer can tune those decisions with

simple directives. (open source)


34/51

Pyjamas is a tool and framework for developing Ajax applications

and Rich Internet Applications in python.

y Tersus is a platform for the development of rich web applications by

visually defining user interface, client side behavior and server sideprocessing. (open source)

However languages like Ruby and Python are often paired with database

servers other than MySQL (the M in LAMP). Below are example of

other databases currently in wide use on the web. For instance some

developers prefer a LAPR(Linux/Apache/PostgreSQL/Ruby on Rails)

setup for development.

Database Technology

y Apache Derby

y DB2 (IBM proprietary)

y Firebird

y Microsoft SQL Server

y MySQL

y Oracle

y PostgreSQLy SQLite

y Sybase

Practical Web Development

Basic

In practice, many web developers will have basic interdisciplinary skills/ roles, including:

y Graphic design / web design

y Information architecture and copywriting/copyediting with web

usability, accessibility and search engine optimization in mind


35/51

The above list is a simple website development hierarchy and can be

extended to include all client side and server side aspects. It is stillimportant to remember that web development is generally split up into

client side coding, covering aspects such as the layout and design, and

server side coding, which covers the website's functionality and backend systems.

Advanced

Some more advanced web developers will also have these

interdisciplinary skills / roles:

y GUI (Graphic User Interface) design

y Audio, Video and Animation processing & encoding (for web usage)y Flash Capabilities (animation, audio, video, scripting)

y Web content management system Deployment and/or Content

management infrastructure design, development and integration

y Web applications development, integration and deployment

y Web server stress testing (how much traffic can a web server running

a specific application endure before collapsing)

y Web site security analysis & testing

y Web site code optimization (which is an important aspect of searchengine optimization)

y Project management, QA and other aspects common to IT

development

Security Considerations

Web development takes into account many security considerations, such

as data entry error checking through forms, filtering output, andencryption.[2]

Malicious practices such as SQL injection can be executed

by users with ill intent yet with only primitive knowledge of web

development as a whole. Scripts can be exploited to grant unauthorized

access to malicious users trying to collect information such as emailaddresses, passwords and protected content like credit card numbers.


36/51


37/51

Web Site Development Process-The life-cycle

steps

Like the traditional software development, the process of web site

development can also be divided into different life cycle steps. This can

help to format the team effectively, and the standards and procedures

can be adopted to achieve maximum quality. This article explains the

steps of development which can be possibly arranged as a process of

web engineering. This is just a guideline to help you, to know, how a

process can be done. The steps may vary from application to application.

A system development process can follow a number of standard or

company specific frameworks, methodologies, modeling tools and

languages. Software development life cycle normally comes with some

standards which can fulfill the needs of any development team. Likesoftware, web sites can also be developed with certain methods with


38/51

some changes and additions with the existing software development

process. Let us see the steps involve in any web site development.

1. Analysis:

Once a customer is started discussing his requirements, the team gets

into it, towards the preliminary requirement analysis. As the web site is

going to be a part of a system, It needs a complete analysis as, how theweb site or the web based application is going to help the present system

and how the site is going to help the business. Moreover the analysis

should cover all the aspects especially on how the web site is going tojoin the existing system. The first important thing is finding the targeted

audience. Then, All the present hardware, software, people and data

should be considered during the time of analysis. For example, if acompany XYZ corp is in need of a web site to have its human resource

details online, the analysis team may try to utilize the existing data about

the employees from the present database. The analysis should be done in

the way, that it may not be too time consuming or with very less

informative. The team should be able to come up with the complete cost-

benefit analysis and as the plan for the project will be an output ofanalysis, it should be realistic. To achieve this the analyst should consult

the designers, developers and testers to come up with a realistic plan.

2.Specification Building:

Preliminary specifications are drawn up by covering up each and everyelement of the requirement. For example if the product is a web site then

the modules of the site including general layout, site navigation and

dynamic parts of the site should be included in the spec. Larger projectswill require further levels of consultation to assess additional business

and technical requirements. After reviewing and approving the preliminary document, a written proposal is prepared, outlining thescope of the project including responsibilities, timelines and costs.


39/51


40/51


41/51

7.Promotion:

This phase is applicable only for web sites. Promotion needs preparation

of meta tags, constant analysis and submitting the URL to the search

engines and directories. There is a details article in this site on site

promotion. The site promotion is normally an ongoing process as the

strategies of search engine may change quite often. Submitting a siteURLs once in 2 months can be an ideal submission policy. If the

customer is willing, then paid click and paid submissions can also be

done with additional cost.

8. Maintenance and Updating:

Web sites will need quite frequent updations to keep them very fresh. In

that case we need to do analysis again, and all the other life cycle steps

will repeat. Bug fixes can be done during the time of maintenance. Once

your web site is operational, ongoing promotion, technical maintenance,

content management & updating, site visit activity reports, staff training

and mentoring is needed on a regular basis depend on the complexity of

your web site and the needs within your organization.

Mentoring is needed on a regular basis depend on the complexity ofyour web site and the needs within your organization.


42/51

y Clients and Servers Side Coding

y Domains Names ,URLs and IP Address

y Registrars

Client & Server Side Coding

y Web Development comprises of server-side coding & client-

coding

Client-Side Coding

Server-Side Coding

CSS PHP

HTML

Domains URLS and IPs

y Domain name: The specific address of a computer on the internet.

y Uniform Resource Locator (URL):

http://www.microsoft.com

y Internet Protocol (IP) Address:

192.168.1.1


43/51

Domain Register

y A company that provides domain name registration services for a

free.y Maintain database which maps domain names to IPs.

y Propagate new domain name/IP address information across the

internet.

Creating A Web Site

y Choose a domain name

y Register with a registrar

y Choose a hosting service

y Tell Registrar the IP address

y Create Web Content

y Submit new site to search engine

Creating your Web SiteTechnologies & Tools

Markup Languages

o HTML, DHTML etc

Cascading Style Sheets(CSS)

Scripting Language

o PHP, JAVASCRIPT etc..

Web Creation And Editing Software

oNotepad, Adobe Dreamweaver etc.


44/51


45/51

HTML-Fundamental

Basic Structure

The title of your html page

HTML FundamentalsHeadings.

Heading 1 level text




Heading 5 level textHeading 6 level text


46/51

HTML FundamentalLists

Unordered List

apples

bananas

grapes

Ordered List

apples

bananas

grapes

HTML FundamentalLists

Unordered List

apples

bananas

grapes

Ordered List

i. apples

ii. bananas

iii. grapes


47/51

HTML FundamentalTables

Student

Grade

Tom

B+

Sue

A-

HTML FundamentalTables

Student Grade

Tom B+

Sue A-


48/51


49/51

HTML FundamentalCASCADING STYLE SHEETS (CSS)

Styles enable you to define a consistent 'look' for

your documents by describing once how

headings, paragraphs, quotes, etc. should be

displayed.

Style sheet syntax is made up of three parts:

selector {property: value}

selector = element.class


50/51

A Small Sample Code Of PHP

PHP test

OUTPUT

Here the Output is:

Hello World


51/51

ConclusionThe process described on these pages is a basic way of determining what

is called the "Information Architecture" of your web site. Information

Architecture is a standard practice across almost any technology

development effort, particularly web development. A good Information

Architecture is what separates a well designed site from one that is

thrown together without much thought about how the site will be used.

Once this process has been completed, you should have a good idea

about your site's content and functional requirements. If you are going to

build your own site, this will help you break down what you will need to

learn. If you are going to hire a developer, this will help them determineexactly what you want and how to build it. This process should also give

you an idea of the technical requirements of your site, and help you

determine which hosting plans are available that will meet your needs.

Any good developer will go through a similar process when they start a

web development project.

Documents

Web Develpoment System