8/2/2019 Web Develpoment System
1/51
8/2/2019 Web Develpoment System
2/51
&&((5577,,)),,&&$$77((
77KKLLVVLLVVWWRRFFHHUUWWLLII\\WWKKDDWWWWKKHHWWKKHHVVLLVVHHQQWWLLWWOOHHGG::((%%''((99((//332200((117766
8/2/2019 Web Develpoment System
3/51
''((&&//$$55$$77,,2211
,, KKHHUUHHEE\\ GGHHFFOODDUUHH WWKKDDWW WWKKHH ZZRRUUNN EEHHLLQQJJ VVXXEEPPLLWWWWHHGG WWRR WWKKHH 33RRVVWW **UUDDGGXXDDWWHH ''HHSSDDUUWWPPHHQQWW RRII
00DDQQDDJJHHPPHHQQWW 6666&&0077 &&RROOOOHHJJHH $$PPUULLWWVVDDUU EE\\ PPHH LLQQ WWKKHH SSUURRMMHHFFWW XXQQGGHHUU WWLLWWOOHH ::((%%''((99((//332200((117766
8/2/2019 Web Develpoment System
4/51
$$&&..1122:://((''**((00((1177
77ZZRRRRUUPPRRUUHHFFDDQQGGRRDDZZRRUUNNRRIIWWKKLLVVQQDDWWXXUUHH,,KKDDYYHHEEHHHHQQDDEEOOHHWWRREEUULLQQJJSSUURRMMHHFFWWLLQQWWKKLLVVSSUUHHVVHHQQFFHH
VVKKDDSSHHRRQQOO\\EEHHFFDDXXVVHHRRIIKKHHDDUUWWLLOO\\FFRRRRSSHHUUDDWWLLRRQQRRIIDDKKHHDDGGVV KKDDQQGGVV77KKHHUUHHDDUUHH VVRRPPHHZZKKRRKKDDYYHH
EEOOHHVVVVHHGG VVRRPPHH ZZKKRR KKDDYYHH DDGGYYLLVVHHGG VVRRPPHH ZZKKRR KKDDYYHH ZZLLVVKKHHGG DDQQGG VVRRPPHH ZZKKRR KKDDYYHH DDVVVVLLVVWWHHGG
77KKXXVVHHDDFFKKKKDDVVFFRRQQWWUULLEEXXWWHHGGRRQQHHVVPPLLJJKKWWLLQQVVRRPPHHIIRRUUPPRRUUWWKKHHRRWWKKHHUU
77KKDDQQNNVVEEHHLLQQJJDDVVPPDDOOOOZZRRUUGGFFDDQQQQRRWWEEHHHH[[SSUUHHVVVVHHGGWWKKHHLLPPPPHHQQVVHHVVHHQQVVHHRRIIJJUUDDWWLLWWXXGGHHRRQQHHGGZZHHOOOOVV
LLQQ WWKKHHKKHHDDUUWW WWRRZZDDUUGGVVDDQQ\\RRQQHH66RR LLVV WWKKHH WWUUXXHHZZLLWWKK WWKKLLVVKKXXPPEEOOHHVVHHOOIIZZKKLLOOHHVVWWDDUUWWLLQQJJVVRR LLQQ WWKKLLVV
OOLLQQHH
,,ZZRRXXOOGGOOLLNNHHWWRRWWKKDDQQNNPPHHSSUURRMMHHFFWW**XXLLGGHHOOHHFFWW$$PPDDQQGGHHHHSSNNDDXXUUIIRRUUVVSSHHQQGGLLQQJJKKLLVVSSUUHHFFLLRRXXVVWWLLPPHH
LLQQJJDDWWKKHHUULLQQJJNNQQRRZZOOHHGGJJHHSSUURRSSHHUUJJXXLLGGDDQQFFHHHHQQFFRRXXUUDDJJHHPPHHQQWWDDQQGGYYDDOOXXDDEEOOHHVVXXJJJJHHVVWWLLRRQQVV
,, WWDDNNHH WWKKHHSSUULLYYLLOOHHJJHHRRII FFRRQQYYHH\\LLQQJJRRXXUU KKHHDDUUWWLLHHVVWWJJUUDDWWLLWWXXGGHH WWRRDDOOOORRII WWKKHHVVHHZZKKRRGGLLUUHHFFWWOO\\RRUU LLQQ
GGLLUUHHFFWWOO\\HHQQDDEEOOHHGGXXVVWWRRFFRRPPSSOOHHWWHHWWKKHHGGLLVVVVHHUUWWDDWWLLRRQQ
//DDVVWWEEXXWWQQRRWWWWKKHHOOHHDDVVWWZZHHDDUUHHKKLLJJKKOO\\WWKKDDQQNNIIXXOOWWRRRRXXUUSSDDUUHHQQWWVVDDQQGGPP\\IIUULLHHQQGGVVIIRRUUWWKKHHUUHHHHYYHHUU
ZZLLOOOOLLQQJJFFRRRRSSHHUUDDWWLLRRQQDDQQGGPPRRUUDDOOVVXXSSSSRRUUWW
$$..66++,,$$552255$$
&217(176
y ,QWURGXFWLRQ$ERXW&RPSDQ\o 2EMHFWLYHVRIWKH&RPSDQ\
y 3URGXFWDQG6HUYLFHV
8/2/2019 Web Develpoment System
5/51
y &XVWRPL]HG6RIWZDUH'HYHORSPHQW
y :HEVLWH'HVLJQ6ROXWLRQV
o (&RPPHUFH6ROXWLRQV
y 6HDUFK(QJLQH2SWLPL]DWLRQ
y 'DWDEDVH'HVLJQDQG'HYHORSPHQW
y &RQWHQW0DQDJHPHQW6ROXWLRQy 0LVVLRQ6WDWHPHQWV
y SHUVRQQHORIWKH&RPSDQ\
y :RUN([SHULHQFH
o +70/
o &66
o 3+3
o $'2%(3+2726+23
o '%0V
o 64/
y ,QWURGXFWLRQ2EMHFWLYHVRI:HE'HYHORSPHQWy :HEGHYHORSPHQWDVDQLQGXVWU\
y 7\SLFDO$UHDV
y &OLHQW6LGH&RGLQJ
o 6HUYHU6LGH&RGLQJ
o &OLHQW6LGH6HUYHU6LGH
o 'DWDEDVH7HFKQRORJ\
y 3UDFWLFDO:HE'HYHORSPHQW
o %DVLF
o $GYDQFHGy 6HFXULW\&RQVLGHUDWLRQV
y 15 Web Site Development Process
y 16 Web Components
o 16.1Client and Server Side Coding
o 16.2 Domains Names, URLs and IP Addresso 16.3 Registrars
y 17 Coding
y 18Conclusion
8/2/2019 Web Develpoment System
6/51
8/2/2019 Web Develpoment System
7/51
MANSA INFOTECH: M
ansa Infotech is an offshore WebDevelopment and Web Solutions Company in India with client base all
over the world. They provide versatile, high quality and cost effective
services which include web hosting, Internet marketing, SEO Services,
Search Engine Marketing, Software Development, E-Commerce
8/2/2019 Web Develpoment System
8/51
8/2/2019 Web Develpoment System
9/51
8/2/2019 Web Develpoment System
10/51
8/2/2019 Web Develpoment System
11/51
Public sector organizations that monitor or control private sectoractivities have objectives that are to ensure that the business they are
monitoring comply with the laws laid down.
Health care and education establishments their objectives areto provide a service most private schools for instance have charitable
status. Their aim is the enhancement of their pupils through education.
Charities and voluntary organizations their aims and objectivesare led by the beliefs they stand for.
Changing Objectives
A business may change its objectives over time due to the following
reasons:
A business may achieve an objective and will need to move onto another
one (e.g. survival in the first year may lead to an objective of increasing
profit in the second year).
The competitive environment might change, with the launch of new
products from competitors.
Technology might change product designs, so sales and productiontargets might need to change.
Products and Services
Mansa Infotech provides the following solutions:
y Customized Software Development
8/2/2019 Web Develpoment System
12/51
8/2/2019 Web Develpoment System
13/51
8/2/2019 Web Develpoment System
14/51
y ASP.NET:ASP.NET is a Web application framework developedand marketed by Microsoft to allow programmers to build dynamic
Web sites, Web applications and Web services.
y JAVA:Javais a general-purpose, concurrent, class-based, object-oriented language that is specifically designed to have as few
implementation dependencies as possible. It is intended to let
application developers "write once, run anywhere.
E-Commerce Solutions
This is our specialty. They are ecommerce experts. They
understand how to build a website that sells. They can help designan end-to-end ecommerce solution from start to finish. They will
help you:
y Set up a merchant account and negotiate the best rate
y Pick a domain name that sells
y Design an ecommerce friendly website
y Implement payment methods such as Visa/MC and PayPal
y Integrate shopping cart functionality
y Create a trusted web presence with a valid SSL certificateand risk prevention tools
y Manage risk from fraud with industry leading fraudmanagement tools.
Search Engine OptimizationHaving a great website is only half the battle; we still need
qualified traffic to present our ideas to. MansaInfotech can deliver
a traffic driving strategy for your business. They can:
y Optimize your website for organic search
8/2/2019 Web Develpoment System
15/51
8/2/2019 Web Develpoment System
16/51
8/2/2019 Web Develpoment System
17/51
most advanced information technologies, including computer systems,
software, storage systems and microelectronics. We translate theseadvanced technologies into value for our customers through our
professional solutions, services and consulting businesses worldwide.
PERSONNEL OF COMPANY:
Number of emplyees 70
Education Level BCA,MCA,B-TECH,M-
TECH,MBA-IT
Dress FormalAge GROUP 21-45
Behaviour Respectable,Moral,Ethical,Discourge
Discrimination related to
race,gender,color,religion,marital
status etc.
Groming Web/online e-learning
8/2/2019 Web Develpoment System
18/51
During training, I learn following language:
HTML: Hypertext Markup Language (HTML) is the predominantmarkup language for web pages. HTML elements are the basic building-
blocks of webpages.
8/2/2019 Web Develpoment System
19/51
HTML is written in the form of HTML elements consisting of tags,
enclosed in angle brackets (like ), within the web page content.HTML tags most commonly come in pairs like and ,
although some tags, known as empty elements, are unpaired, for
example . The first tag in a pair is the starttag, the second tag isthe end tag (they are also called opening tags and closing tags). In
between these tags web designers can add text, tags, comments, and
other types of text-based content.
The purpose of a web browser is to read HTML documents and compose
them into visible or audible web pages. The browser does not display the
HTML tags, but uses the tags to interpret the content of the page.
HTML elements form the building blocks of all websites. HTML allows
images and objects to be embedded and can be used to create interactiveforms. It provides a means to create structured documents by denoting
structural semantics for text such as headings, paragraphs, lists, links,
quotes and other items. It can embed scripts in languages such as
JavaScript which affect the behavior of HTML webpages.
Web browsers can also refer to Cascading Style Sheets (CSS) to define
the appearance and layout of text and other material.
CSS:Cascading Style Sheets (CSS) is a style sheet language used todescribe the presentation semantics (the look and formatting) of a
document written in a markup language. Its most common application isto style web pages written in HTML and XHTML, but the language can
also be applied to any kind of XML document, including plain XML,
SVG and XUL.
CSS is designed primarily to enable the separation of document content(written in HTML or a similar markup language) from document
presentation, including elements such as the layout, colors, and fonts.
This separation can improve content accessibility, provide more
flexibility and control in the specification of presentation characteristics,
enable multiple pages to share formatting, and reduce complexity and
8/2/2019 Web Develpoment System
20/51
8/2/2019 Web Develpoment System
21/51
8/2/2019 Web Develpoment System
22/51
servers, many operating systems and platforms, and can be used with
many relational database management systems (RDBMS). It isavailablefree of charge, and the PHP Group provides the complete source code
for users to build, customize and extend for their own use.
SYNTAX
The PHP interpreter only executes PHP code within its delimiters.
Anything outside its delimiters is not processed by PHP (although non-
PHP text is still subject to control structures described within PHP
code). The most common delimiters are to close
PHP sections.
ADOBE PHOTOSHOP: Adobe Photoshop is a graphics editingprogram developed and published by Adobe Systems Incorporated.
Adobe's 2003 "Creative Suite" rebranding led to Adobe Photoshop 8'srenaming to Adobe Photoshop CS. Thus, Adobe Photoshop CS5 is the
12th major release of Adobe Photoshop. The CS rebranding also resulted
in Adobe offering numerous software packages containing multiple
Adobe programs for a reduced price. Adobe Photoshop is released in
two editions: AdobePhotoshop, and Adobe PhotoshopExtended, withthe Extended having extra 3D image creation, motion graphics editing,
and advanced image analysis features Adobe Photoshop Extended is
included in all of Adobe's Creative Suite offerings except Design
Standard, which includes the Adobe Photoshop edition.
Alongside Photoshop and Photoshop Extended, Adobe also publishesPhotoshop Elements and Photoshop Lightroom, collectively called "The
Adobe Photoshop Family". In 2008, Adobe released Adobe Photoshop
Express, a free web-based image editing tool to edit photos directly onblogs and social networking sites; in 2011 a version was released for the
Android operating system and the iPhone.
DBMS: A database management system (DBMS) is a softwarepackage with computer programs that control the creation, maintenance,
8/2/2019 Web Develpoment System
23/51
8/2/2019 Web Develpoment System
24/51
8/2/2019 Web Develpoment System
25/51
8/2/2019 Web Develpoment System
26/51
8/2/2019 Web Develpoment System
27/51
8/2/2019 Web Develpoment System
28/51
INTRODUCTION:Web developmentis a broad term for the work involved in developing a
web site for the Internet (World Wide Web) or an intranet (a private
network). This can include web design, web content development, client
liaison, client-side/server-side scripting, web server and network security
configuration, and e-commerce development. However, among web
professionals, "web development" usually refers to the main non-design
aspects of building web sites: writing markup and coding. Web
development can range from developing the simplest static single page
of plain text to the most complex web-based internet applications,
electronic businesses, or social network services.
For larger organizations and businesses, web development teams can
consist of hundreds of people (web developers). Smaller organizations
may only require a single permanent or contracting webmaster, or
secondary assignment to related job positions such as a graphic designer
and/or information systems technician. Web development may be a
collaborative effort between departments rather than the domain of a
designated department.
Objective and Scope
Web developmentis the process of designing websites a collection of
online content including documents and applications that reside on a
web server/servers.
As a whole, the process of web development includes planning, post-production, research, advertising, as well as media control that is applied
to the pages within the site by the designer or group of designers with a
specific purpose. The site itself can be divided into its main page, also
8/2/2019 Web Develpoment System
29/51
known as the home page, which cites the main objective as well as
highlights of the site's daily updates; which also contains hyperlinks thatfunctions to direct viewers to a designated page within the site's domain.
Web development as an industry
Since the mid-1990s, web development has been one of the fastest
growing industries in the world. In 1995 there were fewer than 1,000web development companies in the United States, but by 2005 there
were over 30,000 such companies in the U.S. alone. The growth of this
industry is being pushed by large businesses wishing to sell products and
services to their customers and to automate business workflow.
In addition, cost of Web site development and hosting has droppeddramatically during this time. Instead of costing ten thousands of dollars,
as was the case for early websites, one can now develop a simple website for free using one of the many free website builders such as Google
Sites etc., depending on the complexity and amount of content. SmallerWeb site development companies are now able to make web design
accessible to both smaller companies and individuals further fueling the
growth of the web development industry. As far as web development
tools and platforms are concerned, there are many systems available tothe public free of charge to aid in development. A popular example is
the LAMP (LINUX,MYSQ,PHP) stack, which is usually distributed free
of charge. This fact alone has manifested into many people around the
globe setting up new Web sites daily and thus contributing to increase in
web development popularity. Another contributing factor has been therise of easy to use WYSIWYG web development software, most
prominently Adobe Dreamweaver, Netbeans, WebDev, orMicrosoft
Expression Studio, Adobe Flex. Using such software, virtually anyonecan develop a Web page in a matter of minutes. Knowledge of Hyper
Text Markup Language (HTML), or other programming languages is not
required, but recommended for professional results.
The next generation of web development tools uses the strong growth in
LAMP, Java Platform Enterprise Edition technologies and Microsoft
8/2/2019 Web Develpoment System
30/51
.NET technologies to provide the Web as a way to run applications
online. Web developers now help to deliver applications as Web serviceswhich were traditionally only available as applications on a desk based
computer.
Instead of running executable code on a local computer, users are
interacting with online applications to create new content. This has
created new methods in communication and allowed for many
opportunities to decentralize information and media distribution. Users
are now able to interact with applications from many locations, instead
of being tied to a specific workstation for their application environment.
Examples of dramatic transformation in communication and commerce
led by web development include e-commerce. Online auction sites such
as eBay have changed the way consumers consume and purchase goodsand services. Online resellers such as Amazon.com and Buy.com
(among many, many others) have transformed the shopping and bargain
hunting experience for many consumers. Another good example of
transformative communication led by web development is the blogWeb
applications such as WordPress and Movable Type have created easily
implemented blog environments for individual Web sites. Open source
content management systems such as Joomla!, Drupal, XOOPS, andTYPO3 and enterprise content management systems such as Alfresco
have extended web development into new modes of interaction andcommunication.
In addition, web development has moved to a new phase of Internet
communication. Computer web sites are no longer simply tools for work
or commerce but used most for communication. Websites such asFacebook and Twitter provide users a platform to freely communicate.
This new form of web communication is also changing e-commerce
through the number of hits and online advertisement.
8/2/2019 Web Develpoment System
31/51
Typical Areas
Web Development can be split into many areas and a typical and basic
web development hierarchy might consist of:
Client Side Coding
y Ajax Asynchronous JavaScript provides new methods of using
JavaScript, and other languages to improve the user experience.
y Flash Adobe Flash Player is an ubiquitous browser plugin ready for
RIAs. Flex 2 is also deployed to the Flash Player (version 9+).
y JavaScript Formally called ECMAScript, JavaScript is a ubiquitous
client side platform for creating and delivering rich Web applicationsthat can also run across a wide variety of devices.
y JQuery Cross-browser JavaScript library designed to simplify and
speed up the client-side scripting of HTML.
y Microsoft Silverligt Microsoft's browser plugin that enables
animation, vector graphics and high-definition video playback,
programmed using XAML and .NET programming languages.
y Real Studio Web Edition is a rapid application development
environment for the web. The language is object oriented and issimilar to both VB and Java. Applications are uniquely compiled to
binary code.
y HTML5 and CSS3 Latest HTML proposed standard combined withthe latest proposed standard for CSS natively supports much of the
client-side functionality provided by other frameworks such as Flash
and Silverlight
Looking at these items from an "umbrella approach", client side coding
such as XHTML is executed and stored on a local client (in a web browser) whereas server side code is not available to a client and is
executed on a web server which generates the appropriate XHTML
which is then sent to the client. The nature of client side coding allows
you to alter the HTML on a local client and refresh the pages with
updated content (locally), web designers must bear in mind the
8/2/2019 Web Develpoment System
32/51
8/2/2019 Web Develpoment System
33/51
characteristics that demand special considerations. In recent years of
web development there have been some developments towardsaddressing these problems and requirements. As an emerging discipline,
web engineering actively promotes systematic, disciplined and
quantifiable approaches towards successful development of high-quality,ubiquitously usable web-based systems and applications.(3)(4) In
particular, web engineering focuses on the methodologies, techniques
and tools that are the foundation of web application development and
which support their design, development, evolution, and evaluation.
Web application development has certain characteristics that make it
different from traditional software, information system, or computer
application development.
Web engineering is multidisciplinary and encompasses contributions
from diverse areas: systems analysis and design, software engineering,
hypermedia/hypertext engineering, requirements engineering, human-computer interaction, user interface, information engineering,
information indexing and retrieval, testing, modeling and simulation,
project management, and graphic design and presentation. Webengineering is neither a clone, nor a subset of software engineering,
although both involve programming and software development. While
web engineering uses software engineering principles, web developmentencompasses new approaches, methodologies, tools, techniques, and
guidelines to meet the unique requirements for web-based applications.
Client Side + Server Side
y Google Web Toolkit provides tools to create and maintain complex
JavaScript front-end applications in Java.
y Opa is a high-level language in which both the client and the server
parts are implemented. The compiler then decides which parts run on
the client (and are translated automatically to JavaScript) and which
parts run on the server. The developer can tune those decisions with
simple directives. (open source)
8/2/2019 Web Develpoment System
34/51
Pyjamas is a tool and framework for developing Ajax applications
and Rich Internet Applications in python.
y Tersus is a platform for the development of rich web applications by
visually defining user interface, client side behavior and server sideprocessing. (open source)
However languages like Ruby and Python are often paired with database
servers other than MySQL (the M in LAMP). Below are example of
other databases currently in wide use on the web. For instance some
developers prefer a LAPR(Linux/Apache/PostgreSQL/Ruby on Rails)
setup for development.
Database Technology
y Apache Derby
y DB2 (IBM proprietary)
y Firebird
y Microsoft SQL Server
y MySQL
y Oracle
y PostgreSQLy SQLite
y Sybase
Practical Web Development
Basic
In practice, many web developers will have basic interdisciplinary skills/ roles, including:
y Graphic design / web design
y Information architecture and copywriting/copyediting with web
usability, accessibility and search engine optimization in mind
8/2/2019 Web Develpoment System
35/51
The above list is a simple website development hierarchy and can be
extended to include all client side and server side aspects. It is stillimportant to remember that web development is generally split up into
client side coding, covering aspects such as the layout and design, and
server side coding, which covers the website's functionality and backend systems.
Advanced
Some more advanced web developers will also have these
interdisciplinary skills / roles:
y GUI (Graphic User Interface) design
y Audio, Video and Animation processing & encoding (for web usage)y Flash Capabilities (animation, audio, video, scripting)
y Web content management system Deployment and/or Content
management infrastructure design, development and integration
y Web applications development, integration and deployment
y Web server stress testing (how much traffic can a web server running
a specific application endure before collapsing)
y Web site security analysis & testing
y Web site code optimization (which is an important aspect of searchengine optimization)
y Project management, QA and other aspects common to IT
development
Security Considerations
Web development takes into account many security considerations, such
as data entry error checking through forms, filtering output, andencryption.[2]
Malicious practices such as SQL injection can be executed
by users with ill intent yet with only primitive knowledge of web
development as a whole. Scripts can be exploited to grant unauthorized
access to malicious users trying to collect information such as emailaddresses, passwords and protected content like credit card numbers.
8/2/2019 Web Develpoment System
36/51
8/2/2019 Web Develpoment System
37/51
Web Site Development Process-The life-cycle
steps
Like the traditional software development, the process of web site
development can also be divided into different life cycle steps. This can
help to format the team effectively, and the standards and procedures
can be adopted to achieve maximum quality. This article explains the
steps of development which can be possibly arranged as a process of
web engineering. This is just a guideline to help you, to know, how a
process can be done. The steps may vary from application to application.
A system development process can follow a number of standard or
company specific frameworks, methodologies, modeling tools and
languages. Software development life cycle normally comes with some
standards which can fulfill the needs of any development team. Likesoftware, web sites can also be developed with certain methods with
8/2/2019 Web Develpoment System
38/51
some changes and additions with the existing software development
process. Let us see the steps involve in any web site development.
1. Analysis:
Once a customer is started discussing his requirements, the team gets
into it, towards the preliminary requirement analysis. As the web site is
going to be a part of a system, It needs a complete analysis as, how theweb site or the web based application is going to help the present system
and how the site is going to help the business. Moreover the analysis
should cover all the aspects especially on how the web site is going tojoin the existing system. The first important thing is finding the targeted
audience. Then, All the present hardware, software, people and data
should be considered during the time of analysis. For example, if acompany XYZ corp is in need of a web site to have its human resource
details online, the analysis team may try to utilize the existing data about
the employees from the present database. The analysis should be done in
the way, that it may not be too time consuming or with very less
informative. The team should be able to come up with the complete cost-
benefit analysis and as the plan for the project will be an output ofanalysis, it should be realistic. To achieve this the analyst should consult
the designers, developers and testers to come up with a realistic plan.
2.Specification Building:
Preliminary specifications are drawn up by covering up each and everyelement of the requirement. For example if the product is a web site then
the modules of the site including general layout, site navigation and
dynamic parts of the site should be included in the spec. Larger projectswill require further levels of consultation to assess additional business
and technical requirements. After reviewing and approving the preliminary document, a written proposal is prepared, outlining thescope of the project including responsibilities, timelines and costs.
8/2/2019 Web Develpoment System
39/51
8/2/2019 Web Develpoment System
40/51
8/2/2019 Web Develpoment System
41/51
7.Promotion:
This phase is applicable only for web sites. Promotion needs preparation
of meta tags, constant analysis and submitting the URL to the search
engines and directories. There is a details article in this site on site
promotion. The site promotion is normally an ongoing process as the
strategies of search engine may change quite often. Submitting a siteURLs once in 2 months can be an ideal submission policy. If the
customer is willing, then paid click and paid submissions can also be
done with additional cost.
8. Maintenance and Updating:
Web sites will need quite frequent updations to keep them very fresh. In
that case we need to do analysis again, and all the other life cycle steps
will repeat. Bug fixes can be done during the time of maintenance. Once
your web site is operational, ongoing promotion, technical maintenance,
content management & updating, site visit activity reports, staff training
and mentoring is needed on a regular basis depend on the complexity of
your web site and the needs within your organization.
Mentoring is needed on a regular basis depend on the complexity ofyour web site and the needs within your organization.
8/2/2019 Web Develpoment System
42/51
y Clients and Servers Side Coding
y Domains Names ,URLs and IP Address
y Registrars
Client & Server Side Coding
y Web Development comprises of server-side coding & client-
coding
Client-Side Coding
Server-Side Coding
CSS PHP
HTML
Domains URLS and IPs
y Domain name: The specific address of a computer on the internet.
y Uniform Resource Locator (URL):
http://www.microsoft.com
y Internet Protocol (IP) Address:
192.168.1.1
8/2/2019 Web Develpoment System
43/51
Domain Register
y A company that provides domain name registration services for a
free.y Maintain database which maps domain names to IPs.
y Propagate new domain name/IP address information across the
internet.
Creating A Web Site
y Choose a domain name
y Register with a registrar
y Choose a hosting service
y Tell Registrar the IP address
y Create Web Content
y Submit new site to search engine
Creating your Web SiteTechnologies & Tools
Markup Languages
o HTML, DHTML etc
Cascading Style Sheets(CSS)
Scripting Language
o PHP, JAVASCRIPT etc..
Web Creation And Editing Software
oNotepad, Adobe Dreamweaver etc.
8/2/2019 Web Develpoment System
44/51
8/2/2019 Web Develpoment System
45/51
HTML-Fundamental
Basic Structure
The title of your html page
HTML FundamentalsHeadings.
Heading 1 level text
Heading 2 level text
Heading 3 level text
Heading 4 level text
Heading 5 level textHeading 6 level text
8/2/2019 Web Develpoment System
46/51
HTML FundamentalLists
Unordered List
apples
bananas
grapes
Ordered List
apples
bananas
grapes
HTML FundamentalLists
Unordered List
apples
bananas
grapes
Ordered List
i. apples
ii. bananas
iii. grapes
8/2/2019 Web Develpoment System
47/51
HTML FundamentalTables
Student
Grade
Tom
B+
Sue
A-
HTML FundamentalTables
Student Grade
Tom B+
Sue A-
8/2/2019 Web Develpoment System
48/51
8/2/2019 Web Develpoment System
49/51
HTML FundamentalCASCADING STYLE SHEETS (CSS)
Styles enable you to define a consistent 'look' for
your documents by describing once how
headings, paragraphs, quotes, etc. should be
displayed.
Style sheet syntax is made up of three parts:
selector {property: value}
selector = element.class
8/2/2019 Web Develpoment System
50/51
A Small Sample Code Of PHP
PHP test
OUTPUT
Here the Output is:
Hello World
8/2/2019 Web Develpoment System
51/51
ConclusionThe process described on these pages is a basic way of determining what
is called the "Information Architecture" of your web site. Information
Architecture is a standard practice across almost any technology
development effort, particularly web development. A good Information
Architecture is what separates a well designed site from one that is
thrown together without much thought about how the site will be used.
Once this process has been completed, you should have a good idea
about your site's content and functional requirements. If you are going to
build your own site, this will help you break down what you will need to
learn. If you are going to hire a developer, this will help them determineexactly what you want and how to build it. This process should also give
you an idea of the technical requirements of your site, and help you
determine which hosting plans are available that will meet your needs.
Any good developer will go through a similar process when they start a
web development project.