26
Harman® Absolute63 Owner’s Manual_R7 2016 -___ 01/18 1 3-90-999000c INSTALLER: Leave this manual with party responsible for use and operation. OWNER: Retain this manual for future reference. Contact your local dealer with questions on installation, operation or service. Owner’s Manual Care and Operation Model(s): Absolute63 Freestanding Pellet Stove Tested and approved for wood pellet fuel only. Burning of any other type of fuel voids your warranty. CAUTION ! Check building codes prior to installation. Installation MUST comply with local, regional, state and national codes and regulations. Contact local building or fire officials about restrictions and installation inspection requirements in your area. CAUTION ! Absolute63 Use & Care Video Hot glass will cause burns. Do not touch glass until it is cooled. NEVER allow children to touch glass. Keep children away. CAREFULLY SUPERVISE children in same room as stove. Alert children and adults to hazards of high temperatures. High temperatures may ignite clothing or other flammable materials. Keep clothing, furniture, draperies and other flammable materials away. HOT SURFACES! Glass and other surfaces are hot during operation AND cool down. WARNING Please read this entire manual before installation and use of this pellet fuel- burning room heater. Failure to follow these instructions could result in property damage, bodily injury or even death. Do not store or use gasoline or other flammable vapors and liquids in the vicinity of this or any other appliance. Do not overfire - If any external part starts to glow, you are overfiring. Reduce feed rate. Overfiring will void your warranty. • Comply with all minimum clearances to combustibles as specified. Failure to comply may cause house fire. WARNING To obtain a French translation of this manual, please contact your dealer or visit www.harmanstoves.com. Pour obtenir une traduction française de ce manuel, s’il vous plaît contacter votre revendeur ou visitez www. harmanstoves.com NOTE NOTICE: SAVE THESE INSTRUCTIONS

Owner’s Manual - Hearth N Homedownloads.hearthnhome.com/installManuals/Absolute63_3-90-999000c… · Use a 3” or 4” diameter type “L” or “PL” venting ... £ 7,3 combustible

  • Upload
    domien

  • View
    214

  • Download
    0

Embed Size (px)

Citation preview

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/181 3-90-999000c

INSTALLER: Leave this manual with party responsible for use and operation.OWNER: Retain this manual for future reference.Contact your local dealer with questions on installation, operation or service.

Owner’s ManualCare and Operation

Model(s):Absolute63 Freestanding Pellet Stove

Tested and approved for wood pellet fuel only. Burning of any other type of fuel voids your warranty.

CAUTION!

Check building codes prior to installation.• Installation MUST comply with local, regional, state and

national codes and regulations.• Contactlocalbuildingorfireofficialsaboutrestrictions

and installation inspection requirements in your area.

CAUTION!

Absolute63Use & Care Video

Hot glass will cause burns.• Do not touch glass until it is cooled.• NEVER allow children to touch glass.• Keep children away.• CAREFULLY SUPERVISE children in same room as

stove.• Alert children and adults to hazards of high temperatures. High temperatures may ignite clothing or other

flammable materials.• Keepclothing,furniture,draperiesandotherflammable

materials away.

HOT SURFACES!

Glass and other surfaces are hot during operation AND cool down.

WARNING

Please read this entire manual before installation and use of this pellet fuel-burning room heater. Failure to follow these instructions could result in property damage, bodily injury or even death.

• Donotstoreorusegasolineorotherflammablevaporsand liquids in the vicinity of this or any other appliance.

• Donotoverfire-Ifanyexternalpartstartstoglow,youareoverfiring.Reduce feedrate.Overfiringwillvoidyour warranty.

• Comply with all minimum clearances to combustibles asspecified.Failuretocomplymaycausehousefire.

WARNING

To obtain a French translation of this manual, please contact your dealer or visit www.harmanstoves.com.Pour obtenir une traduction française de ce manuel, s’il vous plaît contacter votre revendeur ou visitez www.harmanstoves.com

NOTE

NOTICE: SAVE THESE INSTRUCTIONS

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/182 3-90-999000c

BARCODE LABEL

HFSerial No.No de série:

Model: ABSOLUTE63Room Heater Pellet Fuel-Burning Type

SUITABLE FOR MOBILE-HOME INSTALLATIONThis pellet burning appliance has been tested and listed for use In

Manufactured Homes In accordance with OAR 814-23-900 through 814-23-909

352 Mountain House Road, Halifax, PA 17032 (É.-U.) US ENVIRONMENTAL PROTECTION AGENCYCertified to comply with 2020 particulate emission standards.

Certifié conforme aux normes 2020 d’émission de particules.

Date of Manufacture / Date de fabrication2017 2018 2019 JAN FEB MAR APR MAY JUN JUL AUG SEP OCT NOV DEC

Manufactured by/Fabriqué par: Hearth and Home Technologies

Test to/testé à: ASTM E 2779-10, ASTM E 2515-11, ASTM E 1509-12, ULC-S627-00, EPA Method 28RTest date: March 2016Room Heater, Pellet Fuel-Burning Type, Also For Use In Mobile Homes. (UM) 84-HUD“PREVENT HOUSE FIRES” Install and use only in accordance with manufactures installation and operation instructions.Contact local building or fire officials about restrictions and installation inspection in your area.WARNING: FOR MANUFACTURED HOMES: Do not install appliance in a sleeping room. An outside combustion air inlet must be provided. The structural integrity of the manufactured home floor, ceiling and walls must be maintained.Refer to manufacturer’s instructions and local codes for precautions required for passing chimney through a combustible wall or ceiling. Inspect and clean exhaust venting system frequently in accordance with manufacturer’s instructions.Use a 3” or 4” diameter type “L” or “PL” venting system.Do not connect this unit to a chimney flue servicing another appliance.Do not obstruct the space beneath the heater.FOR USE WITH PELLETIZED WOOD FUEL ONLY.EPA Certified Emissions: 1.4 g/hrInput Rating Max: 7.6 lb. fuel/hrElectrical Rating: 240 VAC, 50 Hz, Start 1.75 AMPS, Run 1.25 AMPSU.S. Electrical Rating: 115 VAC, 60 Hz, Start 3.5 AMPS, Run 2.5 AMPSFuel Type: Wood Pellet Only

Route power cord away from unit.OPERATE ONLY WITH DOORS CLOSED

THIS AREA MUSTBE BLACK

6"

2"

6.25"

6.25"

A C

B

MINIMUM CLEARANCES TOCOMBUSTIBLESBack Wall to Appliance 2”Side Wall to Appliance 6"Corner InstallationWalls to Appliance 6.25”Use a non-combustible floor protector extending under and to the sides, front and back of the unit as shown in floor protection diagram. Measure front distance from the surface of the glass door.Recommended: Non-combustible floor protection extended beneath the flue pipe when installed with horizontal venting.Floor Protection* USA CANADASides (A) 6” 152 mmBack (B) 1” 25 mmFront (C) 6” 152 mmAlcove InstallationMin. Alcove Height 48” (1219mm) Max. Alcove Depth 36” (914mm)

Report #/Rapport # 0135PS036S & 0135PS036E

Modèle: ABSOLUTE63Appareil de chauffage à granulés de bois

CONÇU POUR MAISONS MOBILES

DANGER: Risque d’électrocution. Coupez l’alimentation électrique avant l’entretien. Remplacer le verre avec 5 mm miroir verre céramique de la même qualité disponible auprès de votre revendeur. En tenant la porte d’entrée et le couvercle de la trémie hermétiquement fermé pendant le fonctionnement de l’appareilDISTANCES DE SECURITE PAR RAPPORT AUX MATERIAUX COMBUSTIBLESParoi arrière à l’appareil 51 mmparoi latérale de l’appareil 152 mmInstallation en angleEntre murs et apparell 159 mmInstallation en alcôveHauter minimale de l’alcôve 1219 mmProfondeur maximale de l’alcôve 914 mmPROTECTION DU SOL*Côtés (A) 152 mmArrière (B) 25 mmAvant (C) 152 mmUtiliser une protection de sol non combustible sous l’appereil qui s’étend sur les côtes, l’avant et l’arrière du poêle (voir schéma). Pour la distance à l’avant, mesurer à partir de la surface de la porte en verre.ll est recommendé que la protection s’étende jusque sous le conduit en cas d’installation d’un conduit horizontal ou sous le té en cas conduit vertical.Do not remove this label/Ne pas enlever cette étiquette.Made in the USA/Fabriqué aux É.-U.

3-90-063_R4

DANGER: Risk of electrical shock. Disconnect power supply before servicing.Replace glass only with 5mm ceramic available from your dealer.For further instruction refer to owner’s manual.Keep viewing and ash removal doors tightly closed during operation.

Test pour / tested à la norme ASTM E 2779-10, ASTM E 2515-11, ASTM E 1509-12, ULC-S627-00, EPA Method 28RDate du test: juillet 2015Appareil de chauffage à granulés de type combustion de carburant (UM ) 84 - HUD"PRÉVENIR LES FEUX DE MAISON" Installer et utiliser uniquement en conformité avec installation et d'utilisation les instructions du fabricant.Contactez les responsables de feu ou de construction locales sur les restrictions et l'inspection dans votre région.AVERTISSEMENT: POUR maisons préfabriquées: Ne pas installer l'appareil dans une salle de repos. Une entrée d'air de combustion à l'extérieur doit être fournie. L' intégrité de la structure du plancher de la maison, le plafond et les murs fabriqué doit être maintenue.Reportez-vous aux instructions du fabricant et les codes locaux pour connaître les précautions nécessaires pour faire passer la cheminée à travers un mur ou un plafond combustible. Inspectez et nettoyez système d'évacuation des gaz d'échappement souvent en conformité avec les instructions du fabricant.Utilisez un type de diamètre "L" 3 "ou 4" ou "PL" du système de ventilation.Ne pas connecter cet appareil à un conduit de cheminée servant un autre appareil.Ne pas obstruer l’espace sous le chauffe-eau. POUR UTILISATION AVEC GRANULE DE BOIS.Entrée Puissance Max: £ 7,3 combustible / hPuissance électrique: 240 V, 50 Hz, Lancer 1.75 AMPS, Exécuter 1.25 AMPSÉtats-Unis électrique Note: 115 VAC, 60 Hz, Lancer 3.5 AMPS, Run 2.5 AMPSType de carburant: granulés de bois, 5 mm de diamètre.Route cordon électrique de l'appareil.FAIRE FUNCTIONNER UNIQUEMENT LORSQUE LES PORTES SONT FERMÉES

LABEL TICKETECO: 83933 LABEL SIZE: 13” X 5.75”

PART # / REV: 3-90-063_R4 ADHESIVE:ORIGINATOR: Spidlet MATERIAL: 24 Gauge Aluminum

DATE: 05/10/17 INK: Black Background(3) Slotted Holes = .156 x .25(1) Hole = Ø.156(2) Holes = Ø.375(4) Corners = R.062This unit will need the addendum label that refers to the “Wood heater needs periodic inspection” Information

352 Mountain House RoadHalifax, PA 17032

Congratulations, The Harman® Absolute63 pellet stove you have selected is designed to provide the utmost in safety, reliability,andefficiency.As the owner of a new pellet stove, you’ll want to read and carefully follow all of the instructions contained in this owner’s manual. Pay special attention to all cautions and warnings.

This owner’s manual should be retained for future reference. We suggest that you keep it with your other important documents and product manuals.Your new Harman® Absolute63 Freestanding Pellet Stove will giveyouyearsofdurableuseandtrouble-freeenjoyment.Welcome to the Harman® family!

Read this manual before operating this appliance. Please retain this Owner’s Manual for future reference.

Read the Installation Manual before making any installation or finishing changes.

Listing Label Information/Location Themodelinformationregardingyourspecificstovecanbefoundontherating plate usually located in the control area of the stove.

Model Name Serial Number

EXAMPLE

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/183 3-90-999000c

Table of Contents

Safety Alert Key:• DANGER! Indicates a hazardous situation which, if not avoided will result in death or serious injury.• WARNING! Indicates a hazardous situation which, if not avoided could result in death or serious injury.• CAUTION! Indicates a hazardous situation which, if not avoided, could result in minor or moderate injury.• NOTICE: Used to address practices not related to personal injury.

!

3 Reference Materials A. Service Parts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16B. Limited Lifetime Warranty . . . . . . . . . . . . . . . . . . . . . . . . . 21C. Loss of Power Addendum . . . . . . . . . . . . . . . . . . . . . . . . 24D. Emergency Manual Ignition . . . . . . . . . . . . . . . . . . . . . . . 24E. Troubleshooting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25F. Contact Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26

1 Product Specifications and Important Safety Information A. ApplianceCertification/Specifications . . . . . . . . . . . . . . . 4B. Mobile Home Approval . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4C. BTU&EfficiencySpecifications . . . . . . . . . . . . . . . . . . . . . 4D. Appliance Safety . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5E. Clear Space . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5F. Helpful Hints . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6G.FuelSpecifications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6H. Quick Start Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8I. Frequently Asked Questions . . . . . . . . . . . . . . . . . . . . . . . 9J. Cleaning Prompts, Messages and Errors. . . . . . . . . . . . . 10

2 Maintenance and Service A. Proper Shutdown Procedure . . . . . . . . . . . . . . . . . . . . . . 11B. Quick Reference Maintenance Chart . . . . . . . . . . . . . . . . 12C. Unit Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 • Daily/WeeklyMaintenance . . . . . . . . . . . . . . . . . . . . . . 13 • Monthly Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . 13 • Yearly Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . 14

= Contains updated information

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/184 3-90-999000c

1 Product Specific and Important Safety Information

A. Appliance Certification / Specifications C. BTU & Efficiency Specifications

B. Mobile Home ApprovalThis appliance is approved for mobile and manufactured home installations when not installed in a sleeping room and when an outside combustion air inlet is provided. Thestructuralintegrityofthemobilehomefloor,ceiling,andwalls must be maintained. The appliance must be properly grounded to the frame of the mobile home and use only listed pellet vent, Class “PL” or “L” connector pipe. A Harman®OutsideAirKitmustbeinstalledinamobilehomeinstallation.

NOTE: This installation must conform with local codes. In the absence of local codes you must comply with the ASTM E 1509-12, ULC-S627-00, (UM) 84-HUD

MODEL: Absolute63 Pellet StoveLABORATORY: OMNITestLaboratories,IncREPORT NO. 0135PS036S & 0135PS036ETYPE: PelletFueled/SupplementaryFor

Residential UseSTANDARD(s): ASTM E 2779-10,ASTEM E 2515-

11,ASTME1509-12,ULC-S627-00,EPA Method 28R

ELECTRICAL RATING:

115 VAC, 60 Hz, Start 3.5 AMPS, Run 2.5 AMPS

GLASS SPECIFICATION: 5mm mirrored ceramic glass

NOTE: Hearth & Home Technologies, manufacturer of this appliance, reserves the right to alter its products, their specificationsand/orpricewithoutnotice.

* Weighted average LHV efficiency using data collectedduring EPA emissions test.**Weighted average HHV efficiency using data collectedduring EPA emissions test.***ArangeofBTUoutputsbasedonEPADefaultEfficiencyand the burn rates from the low and high EPA tests.****Basedonthemaximumfeedrateperhourmultipliedbyapproximately8600BTU’swhichistheaverageBTU’sfroma pound of pellets.Thiswoodheaterhasamanufacturer-setminimumlowburnrate that must not be altered. It is against federal regulations to alter this setting or otherwise operate this wood heater in a manner inconsistent with operating instructions in this manual.This wood heater needs periodic inspection and repair for proper operation. It is against federal regulations to operate this wood heater in a manner inconsistent with operating instructions in this manual.Risk of Fire! Hearth & Home Technologies disclaims any responsibility for, and the warranty and agency listing will be voided by the below actions.DO NOT: • Install or operate damaged appliance. • Modify appliance. • Install other than as instructed by Hearth & Home

Technologies. • Operate the appliance without fully assembling all

components. • Overfire. • Install any component not approved by Hearth &

Home Technologies. • Install parts or components not Listed or approved. • Disable safety switches.Improper installation, adjustment, alteration, service or maintenance can cause injury or property damage. Forassistanceoradditionalinformation,consultaqualifiedinstaller, service agency or your dealer.

Harman® is a registered trademark of Hearth & Home Technologies.

T H E S T R U C T U R A L I N T E G R I T Y O F T H E MANUFACTURED HOME FLOOR, WALL, AND CEILING/ROOF MUST BE MAINTAINED.

DO NOT INSTALL IN SLEEPING ROOM.

WARNING!

The Absolute63 is Certified to comply with2020 particulate emission standards.

EPA Certification Number: 54-16EPA Certified Emissions: 1.4g/hr*LHV Tested Efficiency: 83.2%**HHV Tested Efficiency: 77.7%***EPA BTU Output: 10,200-46,400****BTU Input 14,100-61,800Vent Size: 3 InchHopper Capacity: 72 lbsFuel: Wood Pellets

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/185 3-90-999000c

NOTICE: Clearances may only be reduced by means approved by the regulatory authority having jurisdiction.

WARNING!RISK OF FIRE! Do NOT place combustible objects in front or to the sides of the appliance. High temperatures may ignite clothing, furniture or draperies.

E. Clear Space

WARNING!RISK OF FIRE! Keep combustible materials, gasoline and other flammable vapors and liquids clear ofappliance.• Do NOTstoreflammablematerialsintheappliance’s

vicinity.• Do NOT use gasoline, lantern fuel, kerosene, charcoal

lighterfluidorsimilarliquidstostartor“freshenup”afireinthisheater.

Keep all such liquids well away from the heater while it is in use as combustible materials may ignite.

CAUTION!THE STOVE IS HOT WHILE IN OPERATION.KEEP CHILDREN, CLOTHING AND FURNITURE AWAY. CONTACT MAY CAUSE SKIN BURNS.

WARNING!USE OF IMPROPER FUELS, FIRESTARTERS OR ALTERING THE STOVE FOR HIGHER HEAT OUTPUT MAY CAUSE DAMAGE TO THE STOVE AND COULD RESULT IN A HOUSE FIRE. USE ONLY APPROVED FUELS AND OPERATION GUIDELINES.

WARNING!MOBILE/MANUFACTURED HOME GUIDELINES: DO NOT ALLOW INSTALLATION IN A SLEEPING ROOM.

WARNING!If you expect that small children or vulnerable adultsmay come into contact with this appliance, the following precautions are recommended:• Install a physical barrier such as: - Adecorativefirescreen. - Adjustablesafetygate.• Never leave children alone near a hot stove, whether

operating or cooling down.• Teach children to NEVER touch the stove.• Consider not using the stove when children will be

present.• Useonlyspecifiedcomponentsasreplacementparts.Othercomponentsmaynotallowyourstovetooperateas it was intended.

Contact your dealer for more information, or visit: www.hpba.org/safety-information.To prevent unintended operation when not using your stove foranextendedperiodof time(summermonths,vacations, trips, etc):• Unplug stove from receptacle.Due to high temperatures, this stove should be placed awayfromtraffic,furnitureanddraperies.Children and adults should be alerted to the hazards of high surface temperatures and should stay away to avoid burnstotheskinand/orclothing.Young children should be carefully supervised when they are in the same room as the stove.Clothingandother flammablematerials should not beplaced on or near this stove.Installation and repair of this stove should be done by a qualified service person. The appliance should be inspectedbeforeuseandatleastannuallybyaqualifiedservice person. More frequent cleaning will be required. It is imperative that control compartments and circulating air passageways of this stove be kept clean.

D. Appliance SafetyWARNING!

THIS WOOD HEATER HAS A MANUFACTURER-SET MINIMUM LOW BURN RATE THAT MUST NOT BE ALTERED. IT IS AGAINST FEDERAL REGULATIONS TO ALTER THIS SETTING OR OTHERWISE OPERATE THIS WOOD HEATER IN A MANNER INCONSISTENT WITH OPERATING INSTRUCTIONS IN THIS MANUAL.

CAUTION!Odorsandvaporsreleasedduringinitialoperation• Curing of high temperature paint• OpenwindowsforaircirculationOdorsmaybeirritatingtosensitiveindividuals.

Connect the power cord into a 120 VAC, 60 Hz grounded receptacle. (Asurgeprotector is recommended toprotectthe circuit board.) Be sure the polarity of the outlet the stove is plugged into is correct.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/186 3-90-999000c

F. Helpful HintsWhen operating your Harman® Absolute63 Pellet Stove, follow basic safety standards. Read these instructions carefully before you attempt to operate the Absolute63 Pellet Stove. Failure to do so may result in damage to property or personalinjuryandmayvoidtheproductwarranty.Cleaning Burn Pot: Whenever your stove is not burning, take the opportunity to scrape the burn pot to remove carbon buildup. A vacuum cleaner is handy to remove the residue. Be sure the stove is cold if you use a vacuum.Carbonbuildupcanbescrapedloosewiththefireburningusing the special tool provided with your stove. Scrape the floorandsidesoftheburnpot.Thecarbonwillbepushedout by the incoming fuel. Always wear gloves when scraping the burnpot.Disposal of Ashes: Ashes should be placed in a steel containerwith a tight fitting lid.The closed container ofashesshouldbeplacedonanon-combustiblefloororontheground, well away from all combustible materials, pending finaldisposal.Iftheashesaredisposedofbyburialinsoilorotherwise locally dispersed, they should be retained in the closed container until all cinders have thoroughly cooled. Otherwasteshallnotbeplacedinthiscontainer.Soot and Flyash Formation and Need for Removal: The productsofcombustionwillcontainsmallparticlesofflyash.The flyashwill collect in theexhaust venting systemandrestricttheflowofthefluegases.Incompletecombustion,such as occurs during startup, shutdown, or incorrect operation of the room heater will lead to some soot formation whichwillcollectintheexhaustventingsystem.Theexhaustventing system should be inspected at least once every year to determine if cleaning is necessary.Whenburningwoodpelletsonlow,thepotentialexistsforcreosote to form. The venting system should be inspected periodically throughout the heating season to determine if creosote buildup has occurred. If a significant layer ofcreosote has accumulated (1/8” ormore), it should beremovedtoreducetheriskofachimneyfire.Ifafireoccurs,callthefiredepartment,shutdownthestove,andevacuatethe residence. Before using the appliance, have the venting system thoroughly inspected and replace any damaged components.With any hearth appliance, installation of smoke detectors is recommended on every level of the home. Possible causes of smoke detector activation:Paintcuringprocess-Openawindowneartheapplianceforthefirstfewhoursofburning.Exhaustbeingdrawnbackinsidethedwelling-Outsideairconnection to the appliance is necessary.Ventleakage-Allinteriorseamsandjointsshouldbesealedwith silicone where applicable. Follow vent manufacturers instructions for proper sealing.

CAUTION!This appliance must be vented to the outside

G. Fuel SpecificationsThe Absolute63 Pellet Stove is approved for burning any gradeofpelletizedbio-massfuel.It should be noted, that higher ash content fuel will require more frequent cleaning. Themoisturecontentofpelletsmustnotexceed8%.Highermoisture will rob BTU’s and may not burn properly.Fuel should not be stored within the stove installation clearances or within the space required for cleaning and ash removal.Fuel and Fuel StoragePellet fuel quality can fluctuate from manufacturer tomanufacturer, and even from bag to bag. Hearth & Home Technologies recommends using only fuel thatiscertifiedbythePelletFuelsInstitute(PFI).Fuel Material• Madefromsawdustand/orotherwoodby-products.• Source material typically determines ash content.Higher Ash Content Material• Hardwoods with high mineral content.• Bark and leaves as source material.• “Standard” grade pellets and other biomass.Lower Ash Content Material• Softwood;pine,fir,etc.• Materials with lower mineral content.• “Premium” grade pellets.Performance• Higher ash content requires more frequent maintenance.• “Premium” grade pellets will produce the highest heat

output.• Burning pellets longer than 1-1/2 inches (38mm) can

causeinconsistentfeedingand/orignition.Clinkers• Mineralsandothernon-combustiblematerials,likesand,

willturnintoahardglass-likesubstancewhenheated.• Trees from different areas will vary in mineral content.

For this reason, some fuels will produce more clinkers than others.

Moisture• Always burn dry fuel. Burning fuel with high moisture

content takes energy to dry and tends to cool the appliance thus, robbing heat from your home.

• Damp pellet fuel could turn back into sawdust which doesnotflowproperlythroughthefeedsystem.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/187 3-90-999000c

NOTICEHearth & Home Technologies is not responsible for stove performanceorextramaintenancerequiredasaresultofusing fuel with higher ash or mineral content.

CAUTION!Tested and approved for usewithwood pelletsONLY.Burning of any other fuel will void your warranty.

CAUTION!Do not burn fuel that contains an additive.• Maycausehopperfire• Damage to product may resultRead the list of ingredients on the packaging.

WARNING!Tested and approved for use with wood pellets ONLY. Burning of any other fuel will void your warranty.

G. Fuel Specifications (Cont.)Storage• Wood pellets should be left in their original sealed bag

until ready to use, to prevent moisture.• Donotstorefuelwithinthespecifiedclearanceareas,or

in a location that will interfere with routine cleaning and maintenance procedures.

BURNING COLORED PAPER, CARDBOARD, SOLVENTS, TRASH AND GARBAGE OR ALTERING THE STOVE FOR HIGHER HEAT OUTPUT MAY CAUSE DAMAGE TO THE STOVE AND COULD RESULT IN A HOUSE FIRE. USE ONLY APPROVED FUELS AND FOLLOW ONLY THESE OPERATION GUIDELINES.

WARNING!

NEVER USE GASOLINE, GASOLINE-TYPE LANTERN FUEL, KEROSENE, CHARCOAL LIGHTER FLUID, OR SIMILAR LIQUIDS TO START OR 'FRESHEN UP' A FIRE IN THIS HEATER. KEEP ALL SUCH LIQUIDS WELL AWAY FROM THE HEATER, WHILE IN USE.

WARNING!

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/188 3-90-999000c

H. Quick Start Guide

2. Fill hopper with pellets

Initial start-up Only1. Select Language

3.Adjustarrowstosetroomdesiredtemperature.

4.TouchtheOn/OffPowerIcon.Refer to Touch Manual for all other operations.

Please Note: The USB port on the EASY Touch Control is not a charging port for smartphones, tablets etc.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/189 3-90-999000c

ISSUES SOLUTIONSMetallic noise. Noise is caused bymetal expanding and contracting as it

heats up and cools down, similar to the sound produced by a furnace or heating duct. This noise does not affect the operation or longevity of your appliance.

White ash buildup on glass. Thisisnormal.Cleantheglassusinganynon-abrasiveglasscleaner.

Glass has buildup of black soot. Excessive build-up of ash. The lower burn settings willproduce more ash, the higher burn settings produce less. The more it burns on low the more frequent cleaning of the glass is required.

Glass has turned dirty. Excessive build up of ash. The lower burn settings willproduce more ash, the higher burn settings produce less. The more it burns on low the more frequent cleaning of the glass is required.

Firehastallflameswithblacktailsandislazy. The feed rate needs to be reduced or the burnpot needs cleaning.Heatexchangerorexhaustblowerneedscleaning.

Smokystart-uporpuffsofsmokefromtheairwash. Burnpot may be dirty, clean the burnpot.

Largeflameatstart-up. This is normal. Flame will settle down once the fire isestablished.

Missed Ignition. Ensure there are pellets in burnpot.Ensure holes in burnpot are clear of obstructions above the igniter. See Burnpot Maintenance.Check to see if the ignitor is getting hot, if not replace ignitor. *See manual ignition instructions for emergency heating needs.

I. Frequently Asked QuestionsWithproper installation,operation,andmaintenanceyourappliancewillprovideyearsof trouble-freeservice. Ifyoudoexperienceaproblem,thistroubleshootingguidewillassistinthediagnosisofaproblemandthecorrectiveactiontobetaken.Contact your dealer for additional information regarding operation and troubleshooting. Visit www.harmanstoves.com to find a dealer.

Touch Up PaintThetouchuppaintprovidedwithyourunitisforfixingminorchipsorblemishesthatmayoccurafterstoveinstallation.Unfortunately,becausethefinishofyourstoveisbakedon,thistouchuppaintmaynotbeaperfectmatchtothecoloroftheoriginalfinish.To use this touch up paint: Ensure the stove is cool and that the surface to be painted is clean. Apply in several light coats andtakecaretoonlycoatthechippedarea.Allowthepainttodryfor24hoursbeforetouchingorfiringthestove.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1810 3-90-999000c

J. Cleaning Prompts, Messages and ErrorsYour EASY Touch Control communicates with you by showing messages on the top center of the EASY Touch Control home screen. If you have more than one message, the messages will show consecutively until you acknowledge the message by performing the task. These communications include:

PRO

MPT

SM

ESSA

GES

ERR

OR

S

Clean your stove. Call your Harman Dealer if problem persists.

When prompted, scrape burnpot. Press check-mark toreset.

When prompted, inspect and empty ash pan as needed. Presscheck-marktoreset.

When prompted, inspect and perform total clean. Press check-marktoreset.

Presscheck-markifyoufilledthehopper.Ifyoudidnotfillhopper, The message will disappear in 30 seconds.

Replace the 2 “AA” batteries in the Wireless Remote Sensor.

If Wireless Remote Sensor batteries die, the Back Up Sensor will continue to heat your home.

Check and close the front and ash doors for the stove to continue to heat.

Close the hopper lid for the stove to continue to heat.

Fill thehopperwith pellets.Press check-mark to reset. Ifyoudidnotfill thehopper, themessagewillstopafter30seconds. This error only appears if “Show Fuel Gauges” is turned on.

BatteriesinWirelessRemoteSensorhaveexpired.Replacethe 2 “AA” batteries.

Return Air Sensor has failed. Call your Harman Dealer.

Unit has failed to ignite. Scrape the burnpot. Call your Harman Dealer if problem persists.

Touch Control has lost communication to the stove. Turn Stove off, allow stove to cool. Unplug stove and plug back in. If issue persist call your Harman Dealer.

ExhaustSensingProbe(ESP)asfailed.CleantheESP.Ifissue persists, call your Harman Dealer.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1811 3-90-999000c

2 Maintenance & Service

When properly maintained, your stove will give you many yearsoftrouble-freeservice.Contact your dealer to answer questionsregardingproperoperation,trouble-shootingandservice for your appliance. Visit www.harmanstoves.com to findadealer.Werecommendannualservicebyaqualifiedservice technician.Note: Do not use a household vacuum to clean the stove. We recommend that you use a shop vacuum that is equipped withafinedustfiltercalledaHEPAfilteroravacuumspeciallymadeforflyashandsoot.USINGAVACUUMWHICHISNOTEQUIPPEDWITHAFINEDUSTFILTERWILLBLOWFLYASHANDSOOTOUTINTOTHEROOM.NOTE:THESTOVEMUSTBECOMPLETELYOUTBEFOREYOUVACUUMTHESTOVE.LIVEPELLETEMBERS, IFSUCKEDINTOTHEVACUUM,WILLLIGHTTHEVACUUMONFIREANDMAYULTIMATELYCAUSEAHOUSEFIRE.

Follow the detailed instructions found in this section for each step listed in the chart below.

Shock and Smoke Hazard• Turn unit to the off position, let appliance

completely cool and combustion fan must be off. Now you can unplug appliance before servicing.

• Smoke spillage into room can occur if appliance is not cool before unplugging.

• Risk of shock if appliance not unplugged before servicing appliance.

CAUTION!

NOTICEThe type of fuel you are burning will dictate how often you have to clean your burnpot. Clean more frequently if you encounter heavy build-up of ash at the recommendedinterval or you see soot coming from the vent. Not properly cleaning your appliance on a regular basis will void your warranty.

A. Proper Shutdown Procedure

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1812 3-90-999000c

B. Quick Reference Maintenance Chart

Frequency Cleaning Procedure Safety Measures Tips

Daily Scrape Burn pot Wearflameresistantgloves3

Vigorous,strongscrapingspecificallynear neck of burn pot. Scrape every time you add pellets or at least every 3 bags of fuel.2

WeeklyEmpty Ash Pan

Wear protective gloves.1

Putashesintoasteelnon-combustible container with tight fittinglidoutside.

Unit does not need to be turned off. Reduce to low burn during removal.

Clean the Glass Stove must be turned off and cold.

Monthly

Scrape&VacuumHeatExchanger Stove must be turned off and cold. Use provided scraper. Scrape back andsidesoffirebox.

Brush & vacuum the distribution fan Stove must be turned off, cold and unplugged from power supply.

Use provided paint brush. This shouldbedoneapproximatelyevery25 bags.2

Inspect Hopper lid gasket for damage

Replace gasketing if frays, tears or other visible damage to gasket. This shouldbedoneapproximatelyevery50 bags.2

Clean Igniter

Stove must be turned off, cold and unplugged from power supply.Wear protective gloves.1

Putashesintoasteelnon-combustible container with tight fittinglidoutside.

Use provided paint brush. Vacuum loose ash from around igniter and inside burn pot.

Stove MUST be turned off, cold and unplugged from power supply for Yearly Cleaning.

Yearly4

Brush & vacuum the combustion fan andventing/exhaustpath

Wear protective gloves.1

Putashesintoasteelnon-combustible container with tight fittinglidoutside.

Use provided paint brush to brush fanblades.*Usefluebrushtocleanventing being careful not to damage the ESP.2

Inspect door gasket Replace gasketing if frays, tears or other visible damage to gasket.

Brush & vacuum venting system

Wear protective gloves.1

Putashesintoasteelnon-combustible container with tight fittinglidoutside.

*Afluebrushofappropriatesizeandlengthmayneedtobepurchasedforpropermaintenance.1. Protective gloves will help prevent skin abrasion while working on steel surfaces.2. Frequency of cleaning depends largely on fuel type. Lower quality pellets require most frequent cleaning.3.Flameresistantgloveswillhelpprotectyourskinfrompotentialcontactwithheatorflames.4. Yearly cleaning is also known as a Total Clean. This requires completing all the Daily, Weekly, Monthly and Yearly

maintenance mentioned. This should be done before you begin burning the unit each heating season.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1813 3-90-999000c

Figure 2.2

C. Unit MaintenanceDaily/Weekly Maintenance: It is recommend that the burn pot be scraped whenever adding fuel; taking the opportunity to clean the burn pot will insure proper daily operation.Scraping the Burn Pot-• Usingflameresistantgloves,vigorouslyscrapethetop

holed surface and sides of the burn pot down to auger tube, be sure to concentrate in the neck of the burnpot. Figure 2.1.

• Scrape loosened material over edge of burnpot grate into the ashpan.

• If needed, empty the ash pan while adding fuel and after scraping the burn pot.

Figure 2.1

Monthly Maintenance: It is recommend that the unit be shut down and unplugged from any power source for a monthly cleaning. Monthly cleanings will insure proper operation of your unit throughout the heating season.• CleaningGlass-Onceunitiscold,useanon-abrasive

glass cleaner on glass and wipe clean.• ScrapeandVacuumHeatExchanger.Cleaning the Heat Exchanger-CleantheheatexchangerwithscraperasshowninFigure2.2.Brushorscrapetheinsideofthestovetoremoveflyash.Remove the ash pan and dispose of ashes in an approved manner, according to local codes.

Cleaning the Burn Pot-• Vigorously scrape the top holed surface and sides of the

burnpotdowntoaugertube,assuggestedintheDaily/Weekly Maintenance Section.

• Usethesuppliedallenwrenchtoremoveanybuild-upthatmay have accumulated in the holes of the burn pot grate. Simply push the allen wrench down through each hole ensuringitisclearofanybuild-uppayingattentionnottodamage the igniter element in the process. Figure 2.3.

Figure 2.3

Disconnect the power to the unit before removing cover.

! DANGER

Figure 2.4

Wing Thumb Screws

• Loosenthe(2)wingthumbscrewsonthelowerfrontangleof the burn pot. Figure 2.4

Scrape these areas free of flyash or carbon buildup.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1814 3-90-999000c

Figure 2.6

• Liftofftheclean-outcovertoopenthebottomclean-outchamber. Figure 2.5

• Clean ash buildup from inside the chamber while cover is off. Use the scraper to tap on the top front edge of the burn pot. This will help knock pieces of ash, loosened by the scraping process, down through the holes. It also helps knock ash buildup from the igniter element and bracket.

Clean Ash Accumulation

Figure 2.5

Cleaning Igniter Bracket-Check cleanliness of the igniter and inner burnpot. If the igniter has ash buildup it must be removed to insure proper ignition. Use the provided brush to remove ash buildup from inandaroundtheigniter.Onceashisloosevacuumaroundigniter and at the base of burn pot. Figure 2.6.

Note: The hot lead/cold lead connection must always be pulled to the rear of the feeder body before operation.

Use caution when cleaning burn pot clean-out chamber. Do not damage the high temperature igniter wires.

WARNING!

Clean Ash Accumulation

Figure 2.6

Yearly Maintenance: Cleaning the Combustion Fan Chamber-The combustion inlet cover is located behind the ash pan that must be removed to properly clean the combustion fan blade. Figure 2.7.• Remove combustion inlet cover by pulling up on cover.

This allows access to the combustion fan blade and exhaustpath.Figure2.7.

• Removeanyflyashordebristhathascollectedaroundcombustion fan blade with the provided paint brush.

• Cleanexhaustpassage.Figure2.7.NOTE: The ESP Sensor is located just inside the exhaust passage. Be sure not to damage the ESP Sensor while cleaning the exhaust passage.• Oncecleanedreplacecombustioninletcoverandashpan.

Exhaust PassageCombustion Fan Blade

Combustion Inlet Cover

Figure 2.7

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1815 3-90-999000c

Caring for your Glass-The glass used in your stove ismanufactured to exactstandardstowithstandthehighheatofthefire,butlikeallglass, it must be treated with common sense and care. Never abuse the glass by slamming the door shut or striking the glasswithaheavyobject.Iftheglassisbrokenordamaged,do not operate the stove until it has been replaced.Glass - Replacement:If the stove’s glass is cracked or broken, you must replace it before operating your stove. Remove pieces carefully. Replace glass only with Harman® replacement glass; do not use substitutes.Carefully remove damaged glass, gasket material, and glass clips(setaside).Figure2.9.Installtheselfadhesive1/4”gasketmaterialaroundthefrontface of the glass. Set the glass panel and gasket gently onto thedoor. Install theglassclipsand1/4-20X1/4”screws.Note:1/4-20X1/4”screwsonlyneedtobesnugfit.Donotovertighten. Glass - Cleaning:Sometimes it will be necessary to clean accumulated ash from the glass surface; allowing this ash to remain on the glass for long periods can result in “etching” due to the acidity of the ash. Never clean the glass while it is hot, and do not use abrasive substances. Wash the surface with cool water andrinsethoroughly.Youmaywishtouseanon-abrasivecleanerspecificallydesignedforuseonstoveglass.Inanycase, dry thoroughly before relighting your stove.Inspect all Gaskets-While the unit is cool, inspect all door gaskets to insure proper seal. The gasket should be continuous without frays or tears; having plyable gasket means having a correct seal for proper operation. Figure 2.9.

Glass Gasket

Replace glass only with high temperature ceramic glass.

Inspect door gasket during cleaning and inspection

(4)GlassClips

(4)1/4-20X1/4”Button Head Screw

Figure 2.9

Distribution Blower-Checking the distribution blowers yearly is a good habit to get into. Dust, animal hair or anything else that can make its way into that area can drastically cut down on the air movement throughout the unit ultimately causing less of a heatingefficiency.Oncetheunitisshutdownandcooled,unplugtheunitfromitspowersupply.Removetheleftandrightrearpanels.Onceremoved, you will have access to the distribution blowers. Figure 2.10.Onceaccess isgained to the rearof theunit, thoroughlyvacuum around the Distribution Blowers. Figure 2.10.

Remove Left & Right Rear Access Panels

Figure 2.10

Distribution Blowers

Cleaning Venting System-Its is recommend thatacertifiedchimneysweepperformservice and inspection to your chimney system to insure your unit is vented safely and in accordance to local code.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1816 3-90-999000c

A. Service Parts

3 Reference Material

Service Parts Absolute63Beginning Manufacturing Date: Dec 2016

Ending Manufacturing Date: Active

Part number list on following page.

Pellet Stove

11/17

1-90-999000-1 (Matte Black)1-90-999000-14 (Majolica Brown)

1

34

2

5

6

789

11

12 13 14

15161718

19

20

21 22

2324

25

26

2728

10

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1817 3-90-999000c

Service Parts Absolute63Beginning Manufacturing Date: Dec 2016

Ending Manufacturing Date: Active

IMPORTANT: THIS IS DATED INFORMATION. Parts must be ordered from a dealer or distributor. Hearth and Home Technologies does not sell directly to consum-ers. Provide model number and serial number when requesting service parts from your dealer or distributor.

Stocked at Depot

ITEM DESCRIPTION COMMENTS PART NUMBER1 Touch Control 1-00-777552 Y

Cable Cover Gasket Post 0081530362 3-44-777549

2 16 X 8 Hopper Lid Glass 3-40-777770 YScrewposts/Washers Pkg of 20 Sets 1-00-129004 YGasket 3/8 X 1/2 20 Feet 1-00-375501 Y

3 Black Plated Knob w/Screw 1-00-02000-1

Complete Latch 1-00-0669697

5/16 X 1/2 Ball Plunger Pkg of 3 3-31-5500-3

Bulk 5/16 Push Retainer Pkg of 100 3-31-94807-100

Hopper Lid Hinge w/Hardware 1-00-777771 YHopper Lid Hinge Pin Plates w/Hardware 1 Set 1-00-777560

4 Cast TopBlack 4-00-999132S

Majolica Brown 1-00-999132-14

5 Hopper Assembly 1-10-999157A YGasket Hopper Throat 3-44-677185 Y

Gasket 3/8 X 1/2 20 Feet 1-00-375501 Y

6 Left Side CastBlack 4-00-999130P

Majolica Brown 1-00-999130-147 Brick Support 1-10-999779W Y8 Brick 9 X 4.5 X 1.25 Pkg of 7 1-00-900450125 Y9 Flame Guide 3-00-06644 Y

10 Burn Pot Assembly

10.1 Burn Pot Weldment 1-10-999674W YGasket, Burn Pot/Tailpipe Pkg of 5 1-00-07381 Y

10.2 Igniter3-20-677200 Y

Pkg of 10 1-00-677200 Y

10.3 Igniter Cover w/Hardware 1-00-574402 Y10.4 Cleanout Cover w/Hardware 1-00-06623 Y

1/4/-20x5/8 Pkg of 10 3-31-782108-10 YAdditional service parts on following page.

#10 Burn Pot Assembly

10.1

10.2

10.310.4

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1818 3-90-999000c

Service Parts Absolute63Beginning Manufacturing Date: Dec 2016

Ending Manufacturing Date: Active

IMPORTANT: THIS IS DATED INFORMATION. Parts must be ordered from a dealer or distributor. Hearth and Home Technologies does not sell directly to consum-ers. Provide model number and serial number when requesting service parts from your dealer or distributor.

Stocked at Depot

ITEM DESCRIPTION COMMENTS PART NUMBER

11 Load Door

11.1 Cast Latch, Knob & Screw 1-00-0119 YWood Handle 3-40-00247

11.2 Load Door RopeBlack 4-00-999144P YMajolica Brown 1-00-999144-14 Y

11.3 Latch Bracket w/Hardware 1 Set 1-00-777665 Y11.4 Gasket 3/16 RD Blk LD W/PSA 10 Feet 1-00-1186258229 Y

11.5 Glass w/Gasket 1-00-999146 Y11.6 Glass Clips w/Hardware 1 Set 1-00-999145 Y11.7 Load Door Hinge w/Hardware 1 Set 1-00-999114 Y11.8 Gasket 3/8 4 Strand 30 Feet 1-00-00888 Y

12 AshlipBlack 3-00-999129P

Majolica Brown 1-00-999129-14

13 Ash Door Handle Assembly 1 Set 1-00-777149 YRollers & Hardware 1 Set 1-00-77723 Y

14 Ash Door, Complete 1-10-999135A

Gasket 3/8 4 Strand 30 Feet 1-00-00888 Y15 Ash Pan 1-10-999133A Y16 Inlet Cover 1-00-777607

17 Combustion Blower Fan Blade 1-10-574500A Y

18 Leg w/HardwareBlack 1-00-249100 YMajolica Brown 1-00-249100-14 Y

Leg Leveling Kit 1 Set 1-00-12302

19 Right Side CastBlack 4-00-999131P

Majolica Brown 1-00-999131-14

20 Gasket, Burn Pot / Tailpipe Pkg of 5 1-00-07381 YAdditional service parts on following page.

#11 Load Door

11.1

11.211.3

11.411.5

11.6

11.7

11.8

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1819 3-90-999000c

Service Parts Absolute63Beginning Manufacturing Date: Dec 2016

Ending Manufacturing Date: ActiveIMPORTANT: THIS IS DATED INFORMATION. Parts must be ordered from a dealer or distributor. Hearth and Home Technologies does not sell directly to consumers. Provide model number and serial number when requesting service parts from your dealer or distributor.

Stocked at Depot

ITEM DESCRIPTION COMMENTS PART NUMBER21 Combustion Blower 1-00-02275 Y

Combustion Blower Capacitor 1-00-00276 YStuds and Nuts 5 Sets 1-00-99922

22 Distribution Blower Qty 2 req 3-21-33647 Y23 Gasket, Burn Pot / Tailpipe Pkg of 5 1-00-07381 Y24 Pellet Tailpipe, Cast 3-00-247237 Y25 Rear Cover, Right 1-00-999125 Y26 Rear Cover, Left 1-00-999126 Y

27 Feeder Assembly

27.1 Feeder Body 1-10-680021W Y27.3 Slide Plate Assembly 1-10-677121A Y27.3 Feed Cover & Gasket 2 Sets 1-00-677122 Y27.4 Pusher Arm 1-10-677131W Y

Pillow Block Pkg of 4 3-31-3614087-4 Y27.5 Auger 3-50-00565 Y

Gasket, Auger Pkg of 5 1-00-888196

27.6 Bearing Retainer w/Hardware 1-00-04035 YCam Bearing 3-31-3014 Y

27.7 Cam Block Assembly 1-10-777620A Y27.8 4 RPM CW Outboard Motor, 120V 3-20-00999 Y27.9 Motor Mount w/Hardware 1-00-999111 Y27.10 Feeder Crossover Tube Kit 1-00-67900 Y27.11 Gasket, Snout Pkg of 10 3-44-677160-10 Y27.12 Air Intake 1-10-06810A

27.13 Gasket, Air Intake Pgk of 6 3-44-72224-6 Y28 Power Cord 3-20-51578 Y

Line Filter 3-20-803744 Y

Additional service parts on following page.

#27 Feeder Assembly27.1

27.2

27.3

27.4

27.5

27.627.7

27.8

27.9

27.1027.11

27.1227.13

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1820 3-90-999000c

Service Parts Absolute63Beginning Manufacturing Date: Dec 2016

Ending Manufacturing Date: Active

IMPORTANT: THIS IS DATED INFORMATION. Parts must be ordered from a dealer or distributor. Hearth and Home Technologies does not sell directly to consum-ers. Provide model number and serial number when requesting service parts from your dealer or distributor.

Stocked at Depot

ITEM DESCRIPTION COMMENTS PART NUMBER5A Ceramic Fuse Pkg of 5 1-00-05237 YBurn Pot Scraper Pkg of 10 2-00-777692-10

Communication Cable 3-20-72662 YDifferential Switch 3-20-6866 YDraft Meter Assembly 1-00-00637

Draft Meter Bolt & Tube 1-00-04004

ESP Probe-Red/Red 3-20-00844 YExternal Temp Extension 3-20-70607 YFlue Tube Cleaning Brush 3-40-00126

Bottom Heat Shield 1-00-999144 YControl Board 1-00-05372 YReturn Air Sensor 3-20-08780 YSmoke Shield 1-00-999143

Thermostat Extension 3-20-00607 Y

Touch Up PaintBlack 3-42-19905

Majolica Brown 1-00-0014

Wiring Harness 3-20-08888 YTubing, 1/8 Silicone 5 Feet 1-00-5113574 Y

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1821 3-90-999000c4021-645J • 08-03-171

Hearth & Home TechnologiesLIMITED LIFETIME WARRANTY

Hearth & Home Technologies, on behalf of its hearth brands (“HHT”), extends the following warranty for HHT gas, wood, pellet and electric hearth appliances that are purchased from an HHT authorized dealer.

WARRANTY COVERAGE:HHT warrants to the original owner of the HHT appliance at the site of installation, and to any transferee taking ownership of the appliance at the site of installation within two years following the date of original purchase, that the HHT appliance will be free from defects in materials and workmanship at the time of manufacture. After installation, if covered components manufactured by HHT are found to be defective in materials or workmanship during the applicable warranty period, HHT will, at its option, repair or replace the covered components. HHT, at its own discretion, may fully discharge all of its obligations under such warranties by replacing the product itself or refunding the verified purchase price of the product itself. The maximum amount recoverable under this warranty is limited to the purchase price of the product. This warranty is subject to conditions, exclusions and limitations as described below.

WARRANTY PERIOD:Warranty coverage for consumers begins at the date of installation. In the case of new home construction, warranty coverage begins on the date of first occupancy of the dwelling or six months after the sale of the product by an independent, authorized HHT dealer/distributor, whichever occurs earlier. However, the warranty shall commence no later than 24 months following the date of product shipment from HHT, regardless of the installation or occupancy date. The warranty period for parts and labor for covered components is produced in the following table.The term “Limited Lifetime” in the table below is defined as: 20 years from the beginning date of warranty coverage for gas appliances, and 10 years from the beginning date of warranty coverage for wood and pellet appliances. These time periods reflect the minimum expected useful lives of the designated components under normal operating conditions.

Parts Labor Gas Pellet Wood Electric Venting Components Covered

X X Igniters, auger motors, electronic components, and glass

X X X Factory-installed blowers

X Molded refractory panels

X Ignition Modules

X Firepots, burnpots, mechanical feeders/auger assemblies

X Vent Free burners, Vent Free ceramic fiber logs, Aluminized Burners

X X Castings and Baffles

6 years 3 years X Catalyst - limitations listed

7 years 3 years X X Manifold tubes, HHT chimney and termination

10 years 1 year X Burners, logs and refractory

Limited Lifetime 3 years X X X

Firebox and heat exchanger, Grate and Stainless Steel Burners, FlexBurn® System (engine, inner

cover,access cover and fireback)

X X X X X All replacement parts beyond warranty period

Warranty Period HHT Manufactured Appliances and Venting

All parts and material except as covered by Conditions, Exclusions, and Limitations listedX X X

2 years

3 years

1 Year

90 Days

5 years 1 year

xX

B. Limited Lifetime Warranty

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1822 3-90-999000c4021-645J • 08-03-172

WARRANTY CONDITIONS:• This warranty only covers HHT appliances that are purchased through an HHT authorized dealer or distributor. A list of HHT

authorized dealers is available on the HHT branded websites.

• This warranty is only valid while the HHT appliance remains at the site of original installation.

• This warranty is only valid in the country in which the HHT authorized dealer or distributor that sold the appliance resides.

• Contact your installing dealer for warranty service. If the installing dealer or distributor is unable to provide necessary parts, contact the nearest HHT authorized dealer or supplier. Additional service fees may apply if you are seeking warranty service from a dealer other than the dealer from whom you originally purchased the product.

• Check with your dealer in advance for any costs to you when arranging a warranty call. Travel and shipping charges for parts are not covered by this warranty.

• Limited Catalyst Warranty

o For wood burning products containing a catalyst, the catalyst will be warranted for a six-year period as follows: if the original catalyst or a replacement catalyst proves defective or ceases to maintain 70% of its particulate emission reduction activity (as measured by an approved testing procedure) within 36 months from the purchase date, the catalyst will be replaced for free.

o From 37 to 72 months a pro-rated credit will be allowed against a replacement catalyst and labor credit necessary to install the replacement catalyst. The proration rate is as follows:

Amount of Time Since Purchase Credit Towards Replacement Cost0 - 36 Months 100%

37 - 48 Months 30%49 - 60 Months 20%61 - 72 Months 10%

o Any replacement catalyst will be warranted under the terms of the catalyst warranty for the remaining term of the original warranty. The purchaser must provide the name, address, and telephone number of the location where the product is installed, proof of original purchase date, date of failure, and any relevant information regarding the failure of the catalyst.

WARRANTY EXCLUSIONS:This warranty does not cover the following:

• Changes in surface finishes as a result of normal use. As a heating appliance, some changes in color of interior and exterior surface finishes may occur. This is not a flaw and is not covered under warranty.

• Damage to printed, plated, or enameled surfaces caused by fingerprints, accidents, misuse, scratches, melted items, or other external sources and residues left on the plated surfaces from the use of abrasive cleaners or polishes.

• Repair or replacement of parts that are subject to normal wear and tear during the warranty period are not covered. These parts include: paint, wood and pellet gaskets, firebricks, grates, flame guides, batteries and the discoloration of glass.

• Minor expansion, contraction, or movement of certain parts causing noise. These conditions are normal and complaints related to this noise are not covered by this warranty.

• Damages resulting from: (1) failure to install, operate, or maintain the appliance in accordance with the installation instructions, operating instructions, and listing agent identification label furnished with the appliance; (2) failure to install the appliance in accordance with local building codes; (3) shipping or improper handling; (4) improper operation, abuse, misuse, continued operation with damaged, corroded or failed components, accident, or improperly/incorrectly performed repairs (5) environmental conditions, inadequate ventilation, negative pressure, or drafting caused by tightly sealed constructions, insufficient make-up air supply, or handling devices such as exhaust fans or forced air furnaces or other such causes; (6) use of fuels other than those specified in the operation instructions; (7) installation or use of components not supplied with the appliance or any other components not expressly authorized and approved by HHT; (8) modification of the appliance not expressly authorized and approved by HHT in writing; and/or (9) interruptions or fluctuations of electrical power supply to the appliance.

• Non-HHT venting components, hearth connections or other accessories used in conjunction with the appliance.

• Any part of a pre-existing fireplace system in which an insert or a decorative gas appliance is installed.

• HHT’s obligation under this warranty does not extend to the appliance’s capability to heat the desired space. Information is provided to assist the consumer and the dealer in selecting the proper appliance for the application. Consideration must be given to the appliance location and configuration, environmental conditions, insulation and air tightness of the structure.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1823 3-90-999000c

4021-645J • 08-03-173

This warranty is void if:• The appliance has been over-fired, operated in atmospheres contaminated by chlorine, fluorine, or other damaging chemicals.

Over-firing can be identified by, but not limited to, warped plates or tubes, deformation/warping of interior cast iron structure or components, rust colored cast iron, bubbling, cracking and discoloration of steel or enamel finishes.

• The appliance is subjected to prolonged periods of dampness or condensation.

• There is any damage to the appliance or other components due to water or weather damage which is the result of, but not limited to, improper chimney or venting installation.

LIMITATIONS OF LIABILITY• The owner’s exclusive remedy and HHT’s sole obligation under this warranty, under any other warranty, express or implied, or in

contract, tort or otherwise, shall be limited to replacement, repair, or refund, as specified above. In no event will HHT be liable for any incidental or consequential damages caused by defects in the appliance. Some states do not allow exclusions or limitation of incidental or consequential damages, so these limitations may not apply to you. This warranty gives you specific rights; you may also have other rights, which vary from state to state. EXCEPT TO THE EXTENT PROVIDED BY LAW, HHT MAKES NO EXPRESS WARRANTIES OTHER THAN THE WARRANTY SPECIFIED HEREIN. THE DURATION OF ANY IMPLIED WARRANTY IS LIMITED TO DURATION OF THE EXPRESSED WARRANTY SPECIFIED ABOVE.

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1824 3-90-999000c

C. Loss of PowerMinimizing Smoke During Loss of Power Using Battery Back-upHarman® strongly recommends installing battery back-up to minimize entry of smoke into the room in the event of power loss.Your pellet/biomass burning appliance relies on acombustionblowertoremoveexhaust.Apowerfailurewillcause the combustion blower to stop. This may lead to exhaustseepingintotheroom.Verticalriseintheventingmay provide natural draft. It is, however, no guarantee against leakage.There are two Harman® approved battery back-up options for your appliance:Uninterruptible Power Supply (UPS) battery back-upsare available online or at computer and office equipmentstores. Your Harman® appliance may be plugged directly into a Harman® approved UPS:• The APC (American Power Conversion) model

#BE750G and the TrippLite model INTERNET750U are testedandapproved.Otherbrandsormodelsmaynotbe compatible.

When power is lost, a fully charged UPS will power a safe, combustion blower only shut-down. Your appliance willpulsetheblowereveryfewsecondstoclearexhaustuntilthefireisout. NOTE: The UPS provides safe shut-down only. It is not intended for continued operation.• TheSurefire512connectstoa12voltdeepcyclebattery

thatwill runyourappliance forup toeight (8)hours. Itincludes a trickle charge feature that keeps your battery chargedwhenpowerisavailable.NOTE:Ifthepowerisout for longer than battery life, smoke leakage may still occur unless your stove has been safely shut down.

Your appliance will recognize when power is restored. What happens depends on ESP temperature and whether it is equipped with automatic ignition:• In “Automatic” Mode, units will respond to the set point

and ESP temperature and resume normal operation.• In “Idle” Mode, or for units without automatic ignition:

• If the ESP is cool, the appliance will remain shut down.

• IfthefireisoutandtheESPisstillwarm,thefeedermayrestart.Sincethefireisout,theESPtemperaturewillnotrise.Theunitwillthenshut-down,andmayflashasix-blinkstatuserror.(SeeESPerrorcodes)

• If the fire is still burning, it will resume normaloperation.

Contact your dealer if you have questions about UPS compatibility with your appliance.

Use only Harman® approved battery back-up devices. Other products may not operate properly, can create unsafe conditions or damage your appliance.

CAUTION!Always keep appliance doors and hopper lid closed and latched during operation and during power failures to minimize risk of smoke or burn-back.

D. Emergency Manual IgnitionHarman® pellet stoves and inserts should be lit using the automatic ignition system. This is the safest and most reliable way for igniting the unit. In the event the automatic igniter is not functioning, the steps below may be followed to manually light the stove or insert in the “Constant Burn” mode. Manual lighting is for emergency purposes only, and the igniter should be repaired or replaced as soon as practical.

WARNING!Only use firestarter commercially marketed for pelletstoves and inserts, including wax coated wood chips,pellet starter gel and pellet igniter blocks. Use of any othertypeoffirestarterisprohibited.

To avoid serious injury or death read and followmanufacturer’swarningandinstructionsforuseoffirestarter.Useoffirestarterisonlypermittedwhenperformingacoldstart.Never attempt to manually light a stove or insert that has been operated recently and is not at room temperature. If automatic ignition was attempted, be sure to give the stove or insert at least 30 minutes or longer to cool to room temperature.Besurethatthestoveorinsertisinthe“Igniter-Disabled”mode of operation.Once all the precautions have been taken, follow thesesteps:1.On the touch control, select theBurnMode icon then

select “Constant Burn”.2. Arrow back and select the Igniter icon then select “Manual”

for the ignition method. Select the Home Icon to go back to the Main Menu.

3.Fillburnpotwithpellets,onlyhalfway.(DoNotOverFill).4. Add firestarter to pellets following manufacturer’s

instructions.5.Lightpelletfirestarterwithamatch,andclosethedoor,

touchtheOn/Officononthehomescreen.Operationwillbeginwhenthefirereachesthepropertemperature.

WARNING!

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1825 3-90-999000c

ISSUES SOLUTIONSStove does not feed • No fuel in hopper.

• Fireboxdraftmaybetoolowforsensingswitchinfeedercircuit to operate. Check for closed doors, loose or missing gasket on doors or hopper lid.

• Restriction in the hopper or feeder. Remove all fuel and examine.Cleartheobstruction.

• Feed motor has failed.

Partially burned pellets • Feed rate too high.• Poorairtofuelmixture.(Checkburnpotclean-outcover

and air intake).• Burn pot may need to be cleaned.• Combination of all the above.

Smoke smell Sealtheventpipejointsandconnectiontostovewithsilicone.Theexhaustventistheonlypartofthesystemthatisunderpositive pressure.

Fire has gone out • No fuel in hopper.• Draftistoolow,blockedflue.• Somethingisrestrictingfuelflow.• Hopper lid not closed properly.• Feed motor or combustion fan has failed.

Smoke is visible coming out of vent • Air-fuelratioistoorich.-Feedratetoohigh.-Drafttoolowcausedbyagasketleak.

Low heat output • Feed rate too low.• Draft too low because of gasket leak.• Poor quality or damp pellets.• Combination of 1 and 2.

Stove does not ignite but igniter is operating correctly • Burnpothasexcessashlocatedaroundigniterandbracket.• Burpot grate holes are blocked or partially block.

E. Troubleshooting

Harman® • Absolute63 Owner’s Manual_R7 • 2016 -___ • 01/1826 3-90-999000c

F. Contact Information

Please contact your Harman® dealer with any questions or concerns. For the location of your nearest Harman® dealer,

please visit www.harmanstoves.com.

- NOTES -

________________________________________________________________________________

________________________________________________________________________________

________________________________________________________________________________

________________________________________________________________________________

________________________________________________________________________________

________________________________________________________________________________

________________________________________________________________________________

________________________________________________________________________________

________________________________________________________________________________

DO NOT DISCARD THIS MANUAL

NOTICE

• Leave this manual with party responsible for use and operation.

• Important operating and maintenance instructions included.

• Read, understand and follow these instructions for safe installation and operation.

Printed in U.S.A.

a brand ofHearth & Home Technologies

352MountainHouseRoad,Halifax,PA17032www.harmanstoves.com