Upload
others
View
2
Download
0
Embed Size (px)
Citation preview
chemicals & cleaning supplies
“Our exclusive guarantee is your assurance that all purchases from Iowa Prison Industries will last a long time and serve you in a man-ner you have a right to expect. If there are any problems with the quality of the mate-rials or workmanship, we will adjust, repair or replace to YOUR satisfaction.”
--Roger L. Baysden, Director IPI
Iowa Prison IndustriesA Division of The Department of Corrections800-670-4537 • www.iaprisonind.com
Iowa Prison IndustriesA Division of The Department of Corrections800-670-4537 • www.iaprisonind.com
For current prices, MSDS, new or revised
products and ordering information,
please visit Iowa Prison Industries’ web site at
http://www.iaprisonind.com
or contact a sales representative at
800-670-4537.
For more information on IPI products and services, visit our web site at www.iaprisonind.com or
contact your sales representative at 800-670-4537.
products & services
Iowa Prison IndustriesA Division of The Department of Corrections
Modular Systems• Space Planning & Design• Delivery & Installation
Parks & Recreation• Park Benches & Picnic Tables• Grills & Trash Receptacles• Bike Racks• Piers & Docks• Prefabricated Cabins
Cabinets & Countertops• Wood & Laminate Cabinets• Laminate & Solid Surface Coun-
tertops
Signs & Engraving• Indoor & Outdoor Signs• ADA Pictograms• Nameplates & Engraving
Church Furnishings• Pews & Chairs• Pulpits & Lecterns• Communion & Offering Tables
Filing & Storage• File Cabinets• Storage Cabinets• Bookcases
Library Furnishings• Literature Storage & Display• Desks & Tables• Seating
Detention Furnishings• Beds & Accessories • Storage• Tables, Dining Clusters & Desks • Seating
Specialty Products/Services• US Flags• Picture Framing• Awards & Plaques• Braille Transcription
Desks & Tables• Office Systems & Desks• Conference Tables• General Use & Computer Tables
Furniture Restoration• Wood Repair & Restoration• Reupholstery
Printing & Duplicating• 1-4 Color Printing & Duplicating• Bindery & Mailing Services• Envelopes & Business Cards
School Furnishings• Desks & Tables • Seating• Storage • Specialty Items
Seating • Office & Task• Stacking • Lounge
Federal Surplus• Acquires & Makes Available to
Iowa Organizations Excess Federal Vehicles & Equipment
Clothing & Textiles• Inmate Apparel• Bed & Bath• Dietary Apparel
Residence Furnishings• Loft & Bunk Beds• Desks, Dressers & Wardrobes• Lounge Furniture
Office & School Apparel• Embroidery• Digital Garment Printing
Chemicals & Maintenance• Floor Care• General• Germicidal• Green Seal• Laundry
• Personal Care• Restroom Care• Plastic Bags• Filters• Warewash
Data Entry• One-Time Projects• Everyday, Ongoing Tasks
2011 Chemicals & Cleaning Supplies • 1
Green CleaningGeneral Cleaners
Hydrogen Peroxide General Purpose CleanerGreen Seal Certified. Hydrogen Peroxide GP Cleaner is a unique, Hydrogen Peroxide, fortified product that is one of the most versatile general purpose cleaners you can buy. Virtually all of your daily cleaning can be done with one product! From glass cleaning to carpet spot remover, this product has a variety of uses when used at different dilutions. Designed with a powerful surfactant, Hydrogen Peroxide GP Cleaner penetrates and lifts tough stains without harsh solvents or alkalis.
FHYDROPEROXIDEGAL Gallon (4/cs)
TerraGreen DegreaserGreen Seal Certified industrial strength cleaner/degreaser. A one-product industrial solution -- simply vary use-solution to soil load - cleans most soils at 1:64. Cleans an amazing array of industrial soils on a wide variety of surfaces. Appropriate for tools & equipment, concrete floors, vehicles & ground equipment, food service surfaces and other surfaces. Mild citrus fragrance. Purchase in half gallons (for use with a dispenser).
FXTERRAGRNDEGRSR 1/2 Gallon (4/cs)
TerraGreen Glass CleanerGreen Seal Certified fast-acting no-streak glass & surface cleaner for routine multi-surface cleaning. Use on glass, Plexiglas, metal and other hard surfaces; reflective glass safe. Appropriate for restrooms, cabinets & counters and metal & brightwork. Mild floral fragrance. Blue in color. Use dilution 1:32. Purchase in half gallons (for use with a dispenser).
FXTERRAGRNGLSCLNR 1/2 Gallon (4/cs)
TerraGreen HyPer Maxx CleanerTerraGreen HyPer Maxx® is a 2x strength citrus, hydrogen peroxide All-Facility Cleaner! Green Seal™ Certified - Environmentally Responsible. HyPer Maxx is an all-facility cleaner, providing 13 products in 1, for housekeeping, carpet cleaning, shower & restroom cleaning. Dilutes to 3 cleaning strengths - Light, Medium & Heavy-Duty. For a complete facility program using only two products, add IPI’s low-cost Ultra Unique Disinfectant Cleaner. Purchase in half gallons (for use with a dispenser).
FXTERRAGRNHYPERMAXX 1/2 Gallon (4/cs)
TerraGreen Neutral CleanerGreen Seal Certified daily cleaner with a neutral pH. Appropriate for floors, walls & cabinets. Easily removes surface soils without dulling or harming finish gloss. Mild citrus fragrance. Non filming, no rinse needed. Low foaming. Use dilution 1:256. Purchase in half gallons (for use with a dispenser) or gallons (for use without a dispenser).
FXTERRAGRNNTRLCLNRFXTRGNTRLCLNRGAL
1/2 Gallon (4/cs)Gallon (4/cs)
Floor CareEnviro Care All Purpose Cleaner Enviro Care Low Foam All Purpose Cleaner is effective for all routine cleaning jobs. It is particularly effective for cleaning highly polished floors. Its almost neutral pH and low foam means no streaking and no foaming when used through an automatic scrubbing machine. This highly concentrated cleaner (dilutes 1 oz to 6 oz per gallon of water) will not attack, damage or dull any floor finish or wax. It lifts soil from any washable surface quickly and easily and dries film free. Use Enviro Care Low Foam All Purpose Cleaner for damp mopping, scrubbing, spray and wipe cleaning or with a hand bucket and cloth. Green Seal and EcoLogo certified.
FXENVROALLPURPGALFXENVROALLPURPPAILFXENVROALLPURPDRUM
Gallon (4/cs)5 Gallon Pail (1/cs)55 Gallon Drum
2 • Iowa Prison Industries
Enviro Care Enhancer Enviro Care Enhancer in an environmentally preferable, high dilution (dilutes 2 oz to 6 oz per gallon of water) floor maintenance product that can be used in multi-methods to maintain or restore damaged and dulling acrylic-based floor coatings to a deep vibrant gloss. EcoLogo certified.
FXENVROENHNCRGAL Gallon (4/cs)
Enviro Care Floor Finish Enviro Care Floor Finish creates a new standard in floor finishing by combining an unequaled level of envnironmental preference with performance, which surpasses conventional floor finish technology. Enviro Care Floor Finish excels with all maintenance systems: scrub and recoat, spray buff or burnish. You’ll get a tough, black-mark resistant shine with no powdering. No sealer is required, even after heavy stripping. EcoLogo certified.
FXENVROFINISHGALFXENVROFINISHPAILFXENVROFINISHDRUM
Gallon (4/cs)5 Gallon Pail (1/cs)55 Gallon Drum
Enviro Care Floor Stripper Enviro Care Floor Stripper is an environmentally preferable floor finish remover. Specifically designed to remove Enviro Care Floor Finish, it will also remove more conventional metal cross-linked floor polishes. This fast acting and pleasant-to-use stripper removes multiple layers of finish without harsh alkalis and other conventional components. Enviro Care Floor Stripper is highly concentrated (dilutes 16 oz to 42 oz per gallon of water) and requires no neutralization prior to finish application. EcoLogo certified.
FXENVROSTRIPGALFXENVROSTRIPPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
Equipment / SuppliesQuart Spray BottlesGreen Quart Sprayer
RBOTTLEQUARTCLEARFGREENSPRAYER
Quart Bottle Labels For Customer Application FHYDPEROXIDELABELFXLABELDEGREASER FXLABELGLASSCLNR FXLABELHYPERMAXHVYFXLABELHYPERMAXLT
FXLABELHYPERMAXMED FXLABELMAXIMA256FXLABELNEUTRALCLNR
Dispenser - Gas Pump Speed Filling 3.1Dispenser - Gas Pump 1 ProductMobile Dispenser - 1 dilution rate (1:256 dilution)Mobile Dispenser - 2 dilution rates (light & medium dilution)Locking Wire Basket - Holds Up To 4 Half-Gallon BottlesInlet Hose
FXGASPUMPDSPNSRFXGASPUMP1PRODUCTFXWSH1DILUTIONDISPFXWSH2DILUTIONDISPFXTHRBTLWRBSKTFXINLETWTRHOSE
2011 Chemicals & Cleaning Supplies • 3
General Cleaning ProductsMulti-Purpose Cleaners
All Purpose DetergentBiodegradable, concentrated formula (dilute 1-2 oz per gallon of water). For all washable surfaces, including floors.
FALLPURPDETGAL Gallon (4/cs)
Brite Arrow CleanserOne step, multi-purpose cleaner. Ready to use powder formula. Convenient plastic can.
FBRITEARROWPOWDER 20oz Can (24/cs)
Citra Turbo Clean Aggressor RTUWorks like a solvent... Safe as shampoo. An industrial strength multi-purpose cleaner/degreaser. A non-toxic, non-hazardous cleaner/degreaser that uses a natural microbial enzymatic action to safely and effectively clean any washable surface.
FCITRATURBORTUQT Quart (12/cs)
Green Giant All purpose detergent for all types of wall and woodwork, washable painted surfaces, venetian blinds, porcelain and ceramic tile, garbage cans, etc. Use in hard or soft water. Dilute 1/4 cup per gallon of water for general cleaning, may be used full strength for heavily soiled surfaces. Also works great as a detergent booster and prespotter.
FGREENGIANTGALFGREENGIANTPAILFGREENGIANTDRUM
Gallon (4/cs)5 Gallon Pail (1/cs)55 Gallon Drum
Heavy-Duty Cleaner / DegreaserFor all solid surfaces, including automotive and industrial soil. Biodegradable. Can be used for steam and mechanical cleaning. Deodorizes. Use in hot or cold water. Dilute 1:20 for light cleaning up to 1:3 for heavy cleaning.
FHVYDTYCLNDEGQTFHVYDTYCLNDEGGALFHVYDTYCLNDEGPAIL
Quart (12/cs)Gallon (1/cs)5 Gallon Pail (1/cs)
Lemon LavishCleans, shines & protects. This extra-rich, creamy formula cleans as it is applied. Removes dust, smudges, fingermarks, spots and haze. Highly recommended for use on fine furniture, woodwork, paneling and other finished wood surfaces. Also excellent on laminate, metal, kitchen cabinets, stainless steel, chrome, polished marble, leather, plastic, etc.
FLEMONLAVISH Quart (12/cs)
Mist It Wipe ItQuickly dissolves grease, oil, soap, film, inks, wax and grimy substances from all washable surfaces. Ready to use spray and wipe formula. Non-toxic and fume free.
FMISTITWIPEIT Quart (12/cs)
So Soft Cream CleanserRemoves heat stains and discoloration from steel, brass, chrome, urinals, marble, porcelain, Formica, toilet bowls and tile. Easy-to-use formula; simply apply with sponge or cloth, rinse and wipe dry.
FSOSOFT Quart (12/cs)
Stainless Steel Treatment A blend of special oils and solvents formulated to provide the best in cleaning, polishing and protection of all types of stainless steel surfaces. After the solvents evaporate, which aid in the cleaning, they leave behind the special blend of oils. These oils leave a pleasing luster which also serves as a protective coating to resist fingerprints, grease and water spatter.
FSTAINSTLTRTMNT 32oz Bottle (6/cs)
Ultra Turbo ConcentrateA non-toxic, non-hazardous cleaner/degreaser that uses natural microbial enzymatic action to safely and effectively clean any washable surface. Dilute 1:10.
FULTTURBOCONTGAL Gallon (4/cs)
4 • Iowa Prison Industries
Wall Wash ConcentrateAll-purpose cleaner for wall, floors, general cleaning, wax stripping, scrubbing machines, and damp mopping.
FWALLWASHGAL Gallon (4/cs)
DeodorizersOdor OffEliminates organic odors including urine, vomit, feces, garbage, smoke and paint. Apply directly to all washable surfaces.
FODOROFF Quart (12/cs)
Pine Oil ScentCovers odors with a pleasant pine scent. Use only to cover odors.
FPINEOILSCENT Gallon (4/cs)
Glass CleanersGlass CleanerHard surface cleaner for glass, windows, mirrors and display cases, as well as aluminum and stainless steel. Does not streak.
FGLASSCLNRQTFGLASSCLNRGAL
Quart (12/cs)Gallon (4/cs)
Glass Cleaner ConcentrateHard surface cleaner for glass, windows, mirrors and display cases as well as aluminum and stainless steel. Dilute 1:4.
FGLASSCLNRCONTGALFGLASSCLNRCONTPAILFGLASSCLNRCONTDRUM
Gallon (4/cs)5 Gallon Pail (1/cs)55 Gallon Drum
Upholstery CleanersCrypton GoldReady to use professional strength cleaner to remove tough stains like blood, grass, food beverages and even urine. Use this in combination with ink cleaner for stains like mayo and salad dressing.
FXUPHCLEANERGLD 24oz Bottle
Crypton PurpleReady to use professional strength cleaner to remove stains like ink, iodine, grease, markers, asphalt, crayon, lipstick and red stains.
FXUPHCLEANERPUR 24oz Bottle
Crypton Green/WhiteReady to use professional strength product removes odors on fabrics. It is a neutral quatemary disinfectant on non-porous surfaces, and is engineered to safely clean and deodorize upholstery and soft textiles.
FXUPHCLEANERGRN 24oz Bottle
Upholstery BrushHelps gently but firmly remove stubborn stains from your Crypton fabrics when used with the appropriate Crypton Upholstery Cleaner.
FXUPHBRUSH
Crypton Leather/Vinyl CleanerCrypton Leather/Vinyl Restorer
FXUPHCLEANERVNLFXUPHRESTOREVNL
24oz Bottle24oz Bottle
2011 Chemicals & Cleaning Supplies • 5
Restroom CareBac Zap Uric Acid NeutralizerA ready-to-use enzyme/bacteria-based deodorant specifically designed to attack uric acid odors. Use on virtually any surface from urinal fixtures to carpets to drains.
FNEUTURICACID Quart (12/cs)
Cling & Clean Bowl Cleaner Disinfects and deodorizes. One-step bowl cleaner and disinfectant. Eliminates rust, lime and uric acid deposits. Each case includes one bowl mop.
FCLINGCLEANQT Quart (12/cs)
Hanging Toilet BlockCherry fragrance, paradicholobenzene 4oz block with deluxe reinforced plastic hanger, deodorizes for up to 30 days, universal fit for most toilets.
FTOILETBLKHANG Case of 12
Lime & Scum RemoverDissolves bathroom ring, soap scum and light to medium lime scum build up. Safe for wall, floors, stainless steel, chrome, tile and porcelain/ceramic surfaces.
FLIMESCUMQTFLIMESCUMGAL
Quart (12/cs)Gallon (4/cs)
Urinal BlockParadichlorobenzene, 4oz block, deodorizes for up to 30 days.
FURINALBLKPARADZ(with screen)FURINALTOSSPARADZ (no screen)
Case of 12
Case of 12
Toilet Bowl MopsGeneric acid proof plastic swabs with 12” handles.
FTOILETBOWLMOPS Each (100/cs)
2011 Chemicals & Cleaning Supplies • 7
Floor CareCleaners
All Purpose DetergentBiodegradable, concentrated formula (dilute 1-2 oz per gallon of water). For all washable surfaces, including floors.
FALLPURPDETGAL Gallon (4/cs)
Mop It OnceMop In Once is a no-rinse, 100% organic floor cleaning system. Removes oil and dirt with no dulling residue. Cleans high gloss finishes without stripping. Dilute 1-2 oz per gallon of water for routine floor cleaning.
FMOPITONCEGALFMOPITONCEPAILFMOPITONCEDRUM
Gallon (4/cs)5 Gallon Pail (1/cs)55 Gallon Drum
Quarry GripHeavy duty floor cleaner, designed to effectively remove grease and soap scum deposits. When used full strength, Quarry Grip provides a microscopic traction texture to the tile surface, helping to create a safer work environment.
FQUARRYGRIP Gallon (4/cs)
Thermo Clean All Purpose Cleaner Thermo Clean No Rinse All Purpose Cleaner is a low-foaming neutral cleaner with exceptional cleaning properties. Thermo Clean will not streak, haze or leave a detergent film residue on cleaned surfaces. Routine floor maintenance is quick and easy with Thermo Clean; use it to damp mop or in an autoscrubber. Thermo Clean will not dull the gloss or harm the floor finish. Thermo Clean also works as an all-purpose cleaner on walls, woodwork, chrome, porcelain and stainless steel. Dilutes 1/2 oz to 6 oz per gallon of water.
FTHERMOCLNGALFTHERMOCLNPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
FinishesCommand Performance 22%High speed floor finish uses a polymer coating for high gloss on tile and terrazzo.
FCOMMANDPERFGALFCOMMANDPERFPAILFCOMMANDPERFDRUM
Gallon (2/cs)5-Gallon pail (1/cs)55 Gallon Drum
Gloss Coat 18%Heavy-duty floor finish for freshly stripped floors. Long-wearing and durable, maintain with or without buffing. Can be used as a sealer if no floor seal is used.
FGLOSSCOATGALFGLOSSCOATDRUM
Gallon (4/cs)55 Gallon Drum
Pro-Line High Speed Floor Finish 21%Gives floor a spectacular gloss or “wet finish” with high-speed buffing machines. Heel mark and scuff resistant. Designed for heavy traffic areas and great durability.
FPROLINE21GALFPROLINE21PAIL
Gallon (4/cs)5 Gallon (1/cs)
Thermo Gloss Plus FinishThermo Gloss Plus Professional Ultra High Speed Floor Finish/Sealer is a high solids, dry bright floor finish that burnishes to a brilliant gloss “wet look”. It is recommended for frequent burnishing programs and becomes more durable each time it’s burnished. Thermo Gloss Plus is the perfect choice to be used when only the highest levels of appearance will do. More durable and scuff resistant than other burnishable finishes, Thermo Gloss Plus provides brilliant gloss and tough protection 24 hours a day.
FTHERMOGLSGALFTHERMOGLSPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
Ultra Marathon Finish Ultra Marathon Low Maintenance Floor Finish is a new dimension in durability which offers exceptional performance and reduced labor with any maintenance system. Dries to a brilliant gloss and maintains its appearance despite heavy traffic. Micro-emulsion technology gives superb bonding to almost any surface, no sealer is required.
FULTRAFINSHGALFULTRAFINSHPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
8 • Iowa Prison Industries
MaintainersMop On Buffer ConcentrateThermoplastic urethane components restore service floors to “wet look” appearance. Prevents brittleness and prolongs the life of floor finishes. Use with high-speed equipment. Dilute 1:2.5.
FMOPONBUFFERGAL Gallon (4/cs)
Spray Buff A ready-to-use maintainer. Restorative polymeric treatment that enhances the brilliance of floor finishes in a spray buff program.
FSPRAYBUFFQTFSPRAYBUFFGAL
Quart (12/cs)Gallon (4/cs)
Mop TreatmentsDustbrite Mop TreatmentReduces dust and airborne bacteria. Water-based for easy treating and washing of mops.
FDUSTBRITEQTFDUSTBRITEGAL
Quart (12/cs)Gallon (4/cs)
Super Flo-Spray Dust Mop Treatment Super Flo-Spray Dust Mop Treatment is a floor/dust mop treatment that combines refined petroleum distillates with a light perfume. Super Flo-Spray is designed to enable dust mops to capture and hold dust and grit without leaving a slippery or dust attracting film. It can be used on all floor types and will not damage floor finishes.
FSUPERFLOGALFSUPERFLOPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
SealersReliable Seal - 20% SolidsRemovable, water-based acrylic seal for concrete, quarry tile, ceramic tile, synthetic marble and finished wood floors.
FRELIABLESEALPAIL 5 Gallon Pail (1/cs)
Thermo Seal Ultra High Gloss SealerThermo Seal Ultra High Gloss Sealer is specifically formulated to seal floors that have become porous due to wear or chemical attack and for use on all types of flooring and with all types of finishes. Thermo Seal dries to a clear, transparent, high gloss shine, and may be stripped with Thermo Strip or Ultra Strip when necessary for proper maintenance of the floor surface.
FTHERMOSEALGALFTHERMOSEALPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
Undercoat SealerAcrylic undercoat sealer for use on asphalt tile, vinyl asbestos, linoleum, vinyl rubber, cork, concrete, terrazzo, magnasite and travertine marble. Seals the floor against water, stains and soiling. Provides a salt and detergent-resistant base coat and can also be used as top coat.
FUNDERCOATSEALGALFUNDERCOATSEALPL
Gallon (4/cs)5 Gallon Pail (1/cs)
StrippersMop Away StripperA concentrated, water-based stripper for water emulsion floor finishes. Safe on most floors. Fast acting, perfect for hard-to-reach areas. Dilute 1:2.
FMOPAWAYSTRIPGALFMOPAWAYSTRIPDR
Gallon (4/cs)55 Gallon Drum
Super Strip Floor Stripper Super Strip Professional Strength Floor Stripper is a heavy-duty floor finish remover designed to combine stripping power and user-friendly technology. Super Strip removes sealers and floor finishes hardened by frequent burnishing. This non-ammoniated stripper will easily remove the toughest strippable coatings including urethane fortified, heavily coated and propane burnished floors. Dilutes 1:4 to 1:16.
FSUPERSTRIPGALFSUPERSTRIPPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
Ultra Strip Heavy Duty Floor StripperUltra Strip is a heavy duty floor finish remover designed to combine stripping power and user friendly technology. This non-ammonionated stripper will easily remove the toughest strippable coatings including urethane fortified, heavily coated and propane burnished floors. Dilutes 1:16 to 1:4.
FULTRASTRIPGALFULTRASTRIPPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
2011 Chemicals & Cleaning Supplies • 9
GermicidalC-Spra DisinfectantTurberculocidal-Disinfectant-Deodorant Spray. For all washable surfaces including floors.
FC-SPRA Quart (12/cs)
Drinking Water Additives FBLCHDRNKWTR15GALFBLCHDRNKWTR52GAL
15 Gallon Drum52 Gallon Drum
Quat Clean IVNo rinse sanitizer with superior organic soil tolerance for food sanitation areas. Recommended for food handling and processing areas, floors, walls and other hard surfaces. Dilute .34oz per gallon.
FQUATCLEANIV Gallon (4/cs)
Unique RTUSpecially formulated, Unique RTU is a low pH quaternary ammonium germicide that cleans, disinfects and deodorizes. A one-product system of sanitation.
FUNIQUERTU Quart (12/qt)
Ultra UniqueSpecially formulated, Ultra Unique is a low pH quaternary ammonium germicide that cleans, disinfects and deodorizes. A one-product system of sanitation. Dilute 1/2 ounce per gallon of water.
FULTRAUNIQUEDISPFULTRAUNIQUEGALFULTRAUNIQUEPAIL
1/2 Gallon (4/cs)Gallon (4/cs)5 Gallon Pail (1/cs)
Shurguard Plus SanitizerConcentrated EPA registered quaternary-based sanitizer is formulated to kill microorganisms on contact and leave behind a barrier that controls bacterial growth. Shurguard Plus is a rinse-free formula. It disinfects and sanitizes all non-porous food contact surfaces while being non-corrosive and non-irritating to the skin.
WW70560 WW70540
Gallon (4/cs)5 Gallon Pail
2011 Chemicals & Cleaning Supplies • 11
Health CareLiquid Soaps
Body Wash, Shampoo & Hand SoapA mild synthetic cleanser with aloe vera. Provided mild but thorough skin and hair cleaning, softening and conditioning.
FBDYSHAMPHANDPINTFBDYSHAMPHANDGAL
Pint (12/cs)Gallon (4/cs)
Indulgence Foaming Antimicrobial Hand SoapA antimicrobial hand soap that kills a wide variety of germs. Active ingredient: Triclosan at .5%. Golden in color with a spring-sweet citrus fragrance. Use with Indulgence dispenser which features a large, ADA-compliant, easy-to-use push pad located at the top of the dispenser. Dispenser free with purchase of 8 units of soap.
FINDULGNCEANTIMICFDISPINDULGENCE
1000mL Bags (4/cs)Dispenser
Indulgence Foaming Hand SoapA general purpose foaming hand soap for light to medium soil removal. Ruby pink in color with a pleasant tropical fragrance. Use with Indulgence dispenser which features a large, ADA-compliant, easy-to-use push pad located at the top of the dispenser. Dispenser free with purchase of 8 units of soap.
FINDULGENCEFDISPINDULGENCE
1000mL Bags (4/cs)Dispenser
Liquid Hand SoapAn inexpensive general purpose skin cleanser.
FLIQHANDSOAPGALFLIQHANDSOAP5GAL
Gallon (4/cs)5 Gallon pail (1/cs)
Mechanics Liquid Hand SoapQuickly removes grease, oil and grime.
FMECHANICSOAPGAL Gallon (4/cs)
Bar SoapsAntibacterial Deodorant Soap - WrappedIndividually-wrapped 1.5 oz bars clean, deodorize and fight bacteria. Contains Triclosan to fight bacteria and odor. Mildly perfumed.
FANTIBACDEOBAR1.5 Case of 500
Deodorant Soap-Wrapped3oz bar. High-grade, milled cake soap. Mildly perfumed.
FDEOSOAPWRPD3OZ Case of 144
Hand SanitizersAntiseptic Bio-Hand CleanerHand sanitizer with bactericidal and virucidal efficacy.
FANTISEPBIOHND4OZ 4 oz Bottle (24/cs)
Eco-Shield Hand Sanitizer - $3.75/1.7oz, $10.98/16ozFormerly called No-Rinse® Alcohol Free Hand Sanitizer, Eco-Shield Hand Sanitizer is an antibacterial foaming formula with aloe vera. Non-drying, non-flammable.
FNORNSNONALCFM160ZFNORNSNONALCFM50M
16oz Bottles (12/cs)50mL Bottles (12/cs)
Non-Alcohol Foaming Hand SanitizerFormerly called No-Rinse® Alcohol Free Hand Sanitizer, Non-Alcohol Foaming Hand Sanitizer is an antibacterial foaming formula with aloe vera. Non-drying, non-flammable. For use with dispenser. One-touch dispenser free with the purchase of 8 liters; a hands-free touchless dispenser is also available
FNORNSNONALCFM1LFDISP1TOUCHLTRFDISPTOUCHLESSLTR
1L Bag (6/cs)One Touch DispenserTouchless Dispenser
12 • Iowa Prison Industries
ShampoosSky Blue Shampoo A gentle yet effective beauty shampoo. Leaves hair clean, soft and manageable.
FSKYBLUESHAMP8OZFSKYBLUESHAMPGAL
8 oz Bottle (48/cs)Gallon (4/cs)
MoisturizersSkin CreamMoisturizing lotion softens skin and helps maintain skin’s natural oils with a special blend of skin softening moisturizers enhanced with Aloe Vera. Pleasantly scented.
FSKINCRMALOE8OZFSKINCRMALOEGAL
8 oz Bottle (48/cs)Gallon (4/cs)
2011 Chemicals & Cleaning Supplies • 13
LaundryInjection System Products
I/S Bleach 10%Concentrated organic chlorine laundry bleach. It is stable and fast acting to quickly and economically remove stains and whiten laundry. This product is well buffered to avoid pinpoint burning of fabric and loss of tensile strength. It is designed to do a safe, effective bleaching job on sheets, linens, diapers and other institutional laundry.
LA50650 LA50600LA50625
5 Gallon Pail15 Gallon Drum30 Gallon Drum
I/S BuilderHighly concentrated alkali booster for institutional laundry. This liquid blend of alkali builders, water sequesterants and soil suspension agents is designed to be used in combination with IS Detergent or Premium Suds for optimum cleaning efficiency.
LA50675LA50700LA50725
5 Gallon Pail15 Gallon Drum30 Gallon Drum
I/S Chlorine NeutralizerEffective liquid anti-chlorine compound that prevents unwanted residual chlorine on treated fabric. It is capable of removing many reducible stains.
LA50750 30 Gallon Drum
I/S Detergent Liquid detergent designed for use in combination with IS Builder in automated dispensing systems. The combination of these products provides the ultimate in cleaning performance, economy and flexibility. It rapidly wets and penetrates cloth, lifts soil, emulsifies greases and oils and prevents soil redeposition.
LA50775LA50800LA50825
5 Gallon Pail15 Gallon Drum30 Gallon Drum
I/S Rust Sour Specially designed to neutralize the alkaline residues of detergents, water hardness minerals or iron in the rinse cycle of laundry programs. It prevents fabric harshness, excess wear and browning during ironing.
LA50850LA50875LA50900
5 Gallon Pail15 Gallon Drum30 Gallon Drum
I/S SoftenerLiquid catatonic fabric softener for all types of laundry operations. It is highly concentrated to provide fluffy and soft fabric. This product is economical to use because it reduces the pulling and extraction time of loads, eliminates static, reduces sticking and increases comfort of all clothes and linens.
LA50925LA50950LA50975
5 Gallon Pail15 Gallon Drum30 Gallon Drum
DetergentsHigh Efficiency Liquid Laundry DetergentIPI’s new High Efficiency Liquid Laundry Detergent is dye and perfume free, low suds and environmentally friendly. It contains no toxic or carcinogenic substances to harm the environment. For home machines, use 2 oz per load.
LA50125 Gallon (4/cs)
Laundry Detergent Plus Low suds detergent with color safe oxygen bleach for automatic washers. Dustless formula. Tough on stains. Color safe.
LA50450LA50475
10 lb Pail50 lb Carton
Liquid Laundry DetergentEasy to use; effective in hot or cold water; can be used as a pre-spotter. For home machines, use 2 oz per load.
LA50325LA50340 LA50330
Gallon (4/cs)5 Gallon Pail 30 Gallon Drum
TrigLow suds detergent for automatic washers. Dustless formula. Use in hot water only.
LA50400LA50425
10 lb Pail50 lb Carton
14 • Iowa Prison Industries
Fabric SoftenersFabric Softener SheetsEasy-to-use sheets reduce static cling and enhance the softness of fabrics. Floral fragrance. 6.5” x 11” white rayon sheets. Purchase in boxes or 80 or 200.
LA50525LA50550 LA50575
Box of 480 SheetsBox of 80 SheetsBox of 200 Sheets
Liquid Fabric SoftenerImproves wrinkle recovery. Ends static problems and reduces sticking problems.
LA50500 Gallon (4/cs)
Bleaches12.5% Bleach12.5% bleach, drink water certified.
FBLCHDRNKWTR15GAL FBLCHDRNKWTR52GAL
15 Gallon Drum52 Gallon Drum
Dry Chlorine Laundry BleachPowdered 10% chlorine bleach.
LA50150 50 lb Zip
Regal Liquid Bleach All purpose liquid bleach for use in laundry, removing stains, etc. Contains sodium hypochlorite.
LA50200LA50250LA50275LA50300
5 Gallon PailGallon (4/cs)15 Gallon Drum55 Gallon Drum
Stain TreatmentsLaundry Stain Treatment Solvent treatment #1Enzyme treatment #2 Rust & tannin treatment #3
LA51175 LA51125LA51150
16 oz Bottle (6/cs)16 oz Bottle (6/cs)16 oz Bottle (6/cs)
2011 Chemicals & Cleaning Supplies • 15
WarewashMachine Dishwashing
Clean ‘N Brite Dishwash DetergentPowdered dish wash packets.
WW70850 2 oz Packet (72/cs)
Dish-DipDestainer for plastic ware. Purchase by the case.
WW70525 3.7 lb Container (4/cs)
Drying AgentA fast-acting food service rinse additive. Very effective rinse additive for high temperature mechanical dishwashing final rinse application. It lowers the water surface tension to speed surface drainage and provides clean, spot-free dishware. Elimination of water mineral spots on dishware removes one place where bacteria can grow and multiply. This product will do an effective job in most water conditions and can be dispensed through any type of commonly used dispensing equipment.
WW70725 WW70700
Gallon (4/cs) 5 Gallon Pail
Ease Pot & pan detergent powder. Low sudsing. Purchase by the case.
WW70575 6 oz Packet (65/cs)
FailsafeChlorinated heavy duty formula that provides stain removal on tough/greasy soils. Contains metal protectors to prolong dishmachine life. Unique designed canister that is safe, simple and convenient to use. Free flowing powder provides no solid waste. Can be used in all water hardness conditions. Purchase by the case.
WW70625 9 lb Container (4/cs)
Fury Metal Safe DetergentFor institutional mechanical dishwashing and pot washing systems. Encapsulated concentrate with polymer technology. Contains no free caustic. Contains water conditioners. Will not react with iron in water supply. Works best in soft to medium water hardness conditions. Safe on aluminum. Purchase by the case.
WW71000 8 lb. Container (4/cs)
Liquid FuryNon-chlorinated liquid warewash detergent designed for all temperature warewashing and for use in automatic hood cleaning systems. It is fortified with special water conditioners and grease emulsifiers to tackle tough jobs. It is very economical, yet strong enough for most applications.
WW70785 WW70775
Gallon (4/cs)5 Gallon Pail
Liquid Soak-It Moderately alkaline and chlorinated formula.
WW70975 Gallon (4/cs)
Plasti-DriHighest quality dishmachine rinse additive. Very effective rinse additive for high temperature mechanical dishwashing final rinse application. It lowers water surface tension to speed surface drainage and provides clean, spot free dishware. This product will do an effective job in most water conditions and can be dispensed through any commonly used rinse additive dispensing equipment.
WW70925 Gallon (4/cs)
16 • Iowa Prison Industries
Powdered Presoak Plus (Flatware Presoak) For use on silver and stainless steel cutlery. Purchase by the case.
WW70750 8.8 lb Container (2/cs)
Hand DishwashingDetergent Special detergent designed for the manual washing of pots, pans, dishes, utensils and kitchen equipment. It features rich, long lasting suds, excellent grease cutting ability and outstanding results. It is mild to the hands and pleasantly scented for regular kitchen use.
WW70450WW70475
Gallon (4/cs)5 Gallon Pail
Liquid Dishwash Concentrate A fine, economical manual pot and pan detergent designed for institutional use. It is fortified with the high suds, grease cutting components that make up the most expensive of products, yet costs much less. Mild to the hands and has a pleasant lemon scent.
FLIQDISHWASH8OZFLIQDISHWASHQTFLIQDISHWASHGALFLIQDISHWASHPAIL
8 oz Bottle (48/cs)Quart (12/cs)Gallon (4/cs)5 Gallon Pail
Pro-Solid (Pot & Pan Detergent)Citrus-scented hand dishwashing detergent cuts grease and food soil. Purchase by the case.
WW70800 8.8 lb Container (2/cs)
Sani-TabsA Quaternary-Based Tablet For Sanitizing Glassware. Product features include excellent rinsability, easy dispensing tablet form, fast-drying, mild to hand and long-lasting effectiveness. Purchase by the case.
WW70600 150 Tablet Bottle (6/cs)
Surface CleanersCitra Turbo Clean Aggressor RTUWorks like a solvent... Safe as shampoo. An industrial strength multi-purpose cleaner/degreaser. A non-toxic, non-hazardous cleaner/degreaser that uses a natural microbial enzymatic action to safely and effectively clean any washable surface.
FCITRATURBORTUQT Quart (12/cs)
DegreaserConcentrated all purpose liquid cleaner that dissolves grease and removes stubborn stains and dirt. It leaves no film or residue. This concentrate product is economical to use. Its free rinsing formula rapidly removes all types of soils.
WW70375WW70400
Gallon (4/cs)5 Gallon Pail
DelimerA quality lime solvent for general and recirculation lime removal. As a high performance lime scale remover, it provides quick penetration of lime soils with free rinsing for exceptional results. This product is designed to tackle the toughest soils as it can be used at any concentration. It is an excellent choice for recirculation cleaning of dishmachines as well as the general removal of mineral deposits on kitchen equipment or utensils.
WW70425 Gallon (4/cs)
Freezer Cleaner Specially designed for cleaning walk-in freezers. It provides effective cleaning in sub-zero temperatures, eliminating costly freezer shut downs. It is institutional strength, saving time and labor. This product is non-corrosive and ready to use for safety and convenience.
WW70150 Gallon (4/cs)
MISCO Spray CleanOven and grill cleaner. Institutional strength cleaner, formulated for removing heavy, baked on deposits of grease. It clings to vertical surfaces for maximum contact time and chemical cleaning action. Non-flammable and ideal for use on gas-operated equipment. It’s perfect for use on all stoves, ovens, deep-fat fryers, exhaust fans, hoods, filters and barbecues.
WW70175 Gallon (4/cs)
2011 Chemicals & Cleaning Supplies • 17
Quarry GripHeavy duty floor cleaner, designed to effectively remove grease and soap scum deposits. When used full strength, Quarry Grip provides a microscopic traction texture to the tile surface, helping to create a safer work environment.
FQUARRYGRIP Gallon (4/cs)
Quat Clean IVNo rinse sanitizer. Dilute .34oz per gallon.
FQUATCLEANIV Gallon (4/cs)
Shurguard Plus SanitizerConcentrated EPA registered quaternary-based sanitizer is formulated to kill microorganisms on contact and leave behind a barrier that controls bacterial growth. Shurguard Plus is a rinse-free formula. It disinfects and sanitizes all non-porous food contact surfaces while being non-corrosive and non-irritating to the skin.
WW70560 WW70540
Gallon (4/cs)5 Gallon Pail
Stainless Steel Treatment A blend of special oils and solvents formulated to provide the best in cleaning, polishing and protection of all types of stainless steel surfaces. After the solvents evaporate, which aid in the cleaning, they leave behind the special blend of oils. These oils leave a pleasing luster which also serves as a protective coating to resist fingerprints, grease and water spatter.
FSTAINSTLTRTMNT 32oz Bottle (6/cs)
MiscellanyBacterial Digestant Digester cleaner for drains & grease traps. This concentrated digestant contains selected strains of natural enzyme-producing bacteria. Contains no harmful acids, caustics or solvents and is ideal for use in maintaining free-flowing, odor-free drains, plumbing, grease traps and septic systems.
WW70650WW70675
Gallon (4/cs)5 Gallon Pail
Disposable Thermometer T-Stick. 160 degrees F. Single use disposable thermometer. Tests dishwasher rinse water, may be placed anywhere in dishwasher rack. Also for checking temperature of food. Purchase by the case.
WW70100 250/cs
Enviro Care Liqui BacEnviro Care Liqui-Bac is a living, non-pathogenic bacterial treatment which breaks down and liquefies organic waste, grease and food by-products. It contains both aerobic and anaerobic bacteria and immediately neutralizes all malodors.
FENVROLIQBACGALFENVROLIQBAGPAIL
Gallon (4/cs)5 Gallon Pail (1/cs)
Quat Test StripsTesting device for quat based sanitizers. Purchase in rolls.
FQUATTSTSTRIP100 100/Roll
2011 Chemicals & Cleaning Supplies • 19
Plastic BagsBiodegradable Starseal BagsIPI Biodegradable Bags naturally degrade in 9 months to 5 years in in landfills, in compost (backyard or commercial), buried in the ground or littered and in agricultural and erosion control settings. They require no special handling or storage and are competitively priced while providing the same strength per mil as our non-biogradable bags. All Biodegradable Bags contain 30% recycled material and feature starseal, which allows bag to conform to shape of container while preventing leaks.
24x23, 7-10 Gallon, .5 mil, Clear33x39, 33 Gallon, .7 mil, Clear33x39, 33 Gallon, .9 mil, Black39x58, 55 Gallon, .9 mil, Clear39x58, 55 Gallon, .9 mil, Black
FP242305SDFP333907SDFP333909SDBFP395809SDFP395809SDB
Case of 800 bagsCase of 250 bagsCase of 200 bagsCase of 100 bagsCase of 100 bags
Clear Starseal BagsIndustrial strength bags are strong, affordable and convenient. Constructed from a combination of plastics, IPI Starseal Plastic Bags are thinner but just as strong as thicker bags. Providing maximum puncture resistance and strength, bags will carry heavy loads. Most sizes (marked “*”) contain 30% recycled material. Starseal allows bag to conform to shape of container while preventing leaks
17x18, 4-6 Gallon, .3 mil24x23, 7-10 Gallon, .5 mil*24x25, 8-10 Gallon, .5 mil*24x30, 10-12 Gallon, .5 mil*30x36, 20-30 Gallon, .6 mil*30x50, 35-40 Gallon, .6 mil*33x32, 20-30 Gallon, .7 mil*33x39, 33 Gallon, .7 mil*33x41, 34 Gallon, .7 mil*36x58, 55 Gallon, .6 mil*39x58, 55 Gallon, .9 mil*39x90, 80 Gallon, .9 mil*40x46, 40-45 Gallon, .8 mil*43x48, 50 Gallon, 2.0 mil*45x48, 55 Gallon, 1.2 mil*45x54, 60 Gallon, 1.2 mil*
FP171803SCFP242305SNFP242505SNFP243005SNFP303606SNFP305006SNFP333207SNFP333907SNFP334107SNFP365806SNFP395809SNFP399009SNFP404608SNFP434820SNFP454812SNFP455412SN
Case of 2,000 bagsCase of 800 bagsCase of 800 bagsCase of 700 bagsCase of 300 bagsCase of 300 bagsCase of 300 bagsCase of 300 bagsCase of 300 bagsCase of 200 bagsCase of 100 bagsCase of 100 bagsCase of 150 bagsCase of 50 bagsCase of 100 bagsCase of 100 bags
Black Starseal BagsMulti-purpose Black Starsel Plastic bags are highly puncture and tear resistant. They are constructed from either Triolefin plastic – a combination of plastics with 30% recycled material (marked “*”) or HDPE plastic. Starseal allows bags to conform to shape of container while preventing leaks.
24x24, 7-10 Gallon, .4 mil24x31, 12-14 Gallon, .8 mil*24x36, 12-16 Gallon, .4 mil33x34, 25-30 Gallon, .9 mil*33x39, 33 Gallon, .9 mil*33x43, 35 Gallon, .9 mil*39x56, 55 Gallon, .9 mil*39x56, 55 Gallon, 1.2 mil*39x58, 55 Gallon, .9 mil*40x56, 55 Gallon, 2.0 mil*44x48, 55 Gallon, 1.5 mil*
FP242405SBFP243108SBFP243604SBFP333409SBFP333909SBFP334309SBFP395609SBFP395612SBFP395809SBFP405620SBFP444815SB
Case of 500 bagsCase of 500 bagsCase of 500 bagsCase of 250 bagsCase of 200 bagsCase of 200 bagsCase of 100 bagsCase of 100 bagsCase of 100 bagsCase of 80 bagsCase of 100 bags
Layflat BagsHeavy-duty bags feature a layflat seal. Choose clear or black bags.
12x8, 1.5 Gallon, 1.2 mil, Clear12x12, 2.5 Gallon, 1.2 mil, Clear12x18, 3.5-4 Gallon, 1.2 mil, Clear12x24, 5 Gallon, 1.2 mil, Clear24x30, 11 Gallon, 2.0 mil, Clear24x36, 12-16 Gallon, 2.0 mil, Clear24x58, 25-35 Gallon, 2.0 mil, Clear44x48, 55 Gallon, 3.0 mil, Black
FP120812LCFP121212LCFP121812LCFP122412LCFP243020LCFP243620LCFP245820LCFP444830LB
Case of 1,000 bagsCase of 4,000 bagsCase of 1,000 bagsCase of 2,000 bagsCase of 400 bagsCase of 400 bagsCase of 100 bagsCase of 50 bags
20 • Iowa Prison Industries
Gusseted (Food Safe) BagsClear gusseted food-safe bags are great for numerous kitchen uses. USDA compliant and FDA approved for food storage.
35x16x32, 80-85 Gallon, 2.0 mil7x4x11, 1 Gallon, .9 mil7x4x19.5, 2 Gallon, .9 mil
FP35163620GCFP741109GCFP741909GC
Case of 100 bagsCase of 1,450 bagsCase of 1,000 bags
Biohazard BagsIPI Biohazard Bags allow safe and secure storage and disposal of biohazard waste. Choose from red or yellow bags pre-printed with biohazard warning. They are produced with Triolefin plastic, which is a blend of HDPE, LLDPE and Polypropylene resins and contains 30% recycled contect, for its superior film characteristics. Layflat seal and gusseted styles are available.
12x4x21 Gusseted, .9 mil, Yellow24x24 Layflat, 1.25 mil, Red24x36 Layflat, 1.25 mil, Red24x6x33 Gusseted, .9 mil, Red
FP1242109GYHFP2424125LRHFP2436125LRHFP2463309GRH
Case of 1,000 bagsCase of 250 bagsCase of 160 bagsCase of 200 bags
2011 Chemicals & Cleaning Supplies • 21
Paper ProductsSanitary Napkin Bags FSANTNAPKINBAGS Case of 500 bags
Facial Tissue 100 count boxes. 2-ply 9”x8”.
FTISSFACIAL100CNT Case of 30 boxes
Toilet Tissue1 or 2-ply varieties.
FTISSTOILET1PLYFTISSTOILET2PLY
Case of 96 rollsCase of 96 rolls
Paper Towels - Folded Single-fold, multi-fold (brown) and C-fold (white) towels available.
FPAPERTOWELC-FOLDFPAPERTOWELMULTIFPAPERTOWELSGLFLD
Case of 2,400Case of 4,000Case of 4,000
Paper Towels - RollsAvailable in brown hand towel or white absorbent kitchen type.
FPAPERTOWEL8X425FPAPERTOWEL11X9
Case of 12Case of 30
Miscellaneous ProductsContainers
Bottle Sprayer - Quart, GreenWall Bracket - Pint Bottle Wall Bracket - Quart BottleBottle - PintBottle - QuartBottle - Quart, ClearCap - Quart Foil Seal White with Flip TopCarton - 4 GallonPail - 5 GallonPail Lid - 5 Gallon
FGREENSPRAYERFWALLBRACKETPINTFWALLBRACKETQUARTRBOTTLEPINTRBOTTLEQUARTRBOTTLEQUARTCLEARRCAPFOILSEALWHTQTRCARTON4GALLONRPAIL5GALLONRPAILLID5GALLON
Pumps/Dispensers1/4oz Meter Pump For Gallon Bottles1/2oz Meter Pump For Gallon Bottles1oz Meter Pump For Gallon Bottles 5-Gallon Carboy with Spigot Dispenser For Pints Dispenser For QuartsDrum Pump-MR50-B For 15 or 55-Gallon Drums 1-Button Proportioner J100 Fast For Filling Mop Buckets 1-Button Proportioner J100 Slow For Gallon Bottles
F.25OZMETEREDPUMPF.5OZMETEREDPUMP F1OZMETEREDPUMPFDISP5GALLONFDISPPINTFDISPQUARTFDRUMPUMPMR50-BFPROPRTJ100FASTFPROPRTJ100SLOW
MiscellaneousChemical Foamer / ApplicatorToilet Bowl Mop
FCHEMFOAMAPPLCTRFTOILETBOWLMOPS