5
MCQ 015 Save paper… Save trees… For more Questions and Resources for your CSIR/ICMR/DBT/ICAR/UGC/JRF NET Life Science Examination please visit: www.easybiologyclass.com 1 Biology MCQ (Multiple Choice Questions in Life Science) (Sample/Model/Practice Questions for JRF/NET Life Science Examination, ICMR JRF, DBT JRF, GATE, ICAR NET, PG Entrance) ICMR JRF Entrance Examination 2015 Model Questions with Answers and Explanations Part 3 (MCQ 015) 1. Pick out the correct taxonomic hierarchy in zoological systematics. a. Phylum – Class – Order – Family – Genus b. Class – Phylum – Order – Family – Genus c. Phylum – Class – Family – Order – Genus d. Phylum – Class – Order – Genus – Species 2. In molecular systematics of animals, which for the following candidate gene have been extensively used? a. DNA Polymerase b. Cytochrome C c. RNA Polymerase d. Collagen 3. The most probable place where life would have originated _________‐‐. a. Outer space b. Barren rocks c. In oceans d. Deep hydrothermal vents 4. Which of the following factor is least responsible for genetic drift? a. Migration b. Founder effect c. Bottle neck phenomenon d. Restriction of resources 5. In stomach, the mucus which protect the epithelial lining of stomach, is secreted by: a. Goblet cells b. Parietal cells c. Microvilli d. Aciner cells 6. In a population with Hardy‐Weinberg equilibrium, two alleles ‘b’ and ‘B’ showed an allelic frequency of 0.7 and 0.3 respectively. How many individuals in a sample of 250 from this population can be expected to be heterozygous (bB)? www.easybiologyclass.com

MCQ 015 ICMR JRF Exam July 2015 Model Question Paper with Answers and Explanations Part 3

Embed Size (px)

Citation preview

Page 1: MCQ 015 ICMR JRF Exam July 2015 Model Question Paper with Answers and Explanations Part 3

MCQ015 Savepaper…Savetrees…

FormoreQuestionsandResourcesforyourCSIR/ICMR/DBT/ICAR/UGC/JRFNETLifeScienceExaminationpleasevisit:

www.easybiologyclass.com 1

BiologyMCQ(MultipleChoiceQuestionsinLifeScience)(Sample/Model/PracticeQuestionsforJRF/NETLifeScienceExamination,ICMRJRF,DBTJRF,GATE,ICARNET,PGEntrance)

ICMRJRFEntranceExamination2015ModelQuestionswithAnswersandExplanationsPart3(MCQ015)

1. Pickoutthecorrecttaxonomichierarchyinzoologicalsystematics.a. Phylum–Class–Order–Family–Genusb. Class–Phylum–Order–Family–Genusc. Phylum–Class–Family–Order–Genusd. Phylum–Class–Order–Genus–Species

2. Inmolecular systematics of animals,which for the following candidate gene havebeenextensivelyused?

a. DNAPolymeraseb. CytochromeCc. RNAPolymerased. Collagen

3. Themostprobableplacewherelifewouldhaveoriginated_________‐‐.a. Outerspaceb. Barrenrocksc. Inoceansd. Deephydrothermalvents

4. Whichofthefollowingfactorisleastresponsibleforgeneticdrift?a. Migrationb. Foundereffectc. Bottleneckphenomenond. Restrictionofresources

5. Instomach,themucuswhichprotecttheepithelialliningofstomach,issecretedby:a. Gobletcellsb. Parietalcellsc. Microvillid. Acinercells

6. InapopulationwithHardy‐Weinbergequilibrium,twoalleles‘b’and‘B’showedanallelic frequencyof0.7and0.3 respectively.Howmany individuals ina sampleof250fromthispopulationcanbeexpectedtobeheterozygous(bB)?www.easybiologycla

ss.co

m

Page 2: MCQ 015 ICMR JRF Exam July 2015 Model Question Paper with Answers and Explanations Part 3

MCQ015Savepaper…Savetrees… 

FormoreQuestionsandResourcesforyourCSIR/ICMR/DBT/ICAR/UGC/JRFNETLifeScienceExaminationpleasevisit:

www.easybiologyclass.com 2 

a. 55b. 105c. 110d. 42

7. Chitinisamajorcellwallcomponentof__________a. Bacteriab. Arthropodsc. Fungusd. Mollusks

8. Theanti‐cancerousdrugobtainedfromCatharanthusroseusis__________.a. Taxolb. Vincristinec. Colchicined. Serpentine

9. Yeastwithpetite colonywhen crossedwithwild type generates nopetite colony.Themostprobablemodeofinheritanceis__________

a. Chloroplastb. Mitochondriac. Episomald. Nuclear

10. An oligonucleotide DNA sequence tagged with fluorescent tag used to identifyunknowngenebyhybridizationistermedas

a. Probeb. Reportergenec. Ligandd. c‐DNA

11. Bacteriaundergomultiplicationby:a. Binaryfissionb. Mitosisc. FissionandMitosisd. Fragmentation

12. BacterialDNApolymeraseIlackwhichofthefollowingactivity?a. 5’→3’polymeraseactivityb. 3’→5’polymeraseactivityc. 5’→3’exo‐nucleaseactivityd. 3’→5’exo‐nucleaseactivity

www.easybiologyclass.

com

Page 3: MCQ 015 ICMR JRF Exam July 2015 Model Question Paper with Answers and Explanations Part 3

MCQ015Savepaper…Savetrees… 

FormoreQuestionsandResourcesforyourCSIR/ICMR/DBT/ICAR/UGC/JRFNETLifeScienceExaminationpleasevisit:

www.easybiologyclass.com 3 

13. Acrossbetweenaredeyedmaleflyandawhiteeyedfemaleflyproducesredeyedfemaleandwhiteeyedmaleprogenies.Whilereciprocalcrossproducesalloffspringwithredeyes.Thetraitforeyecolouris:

a. Sexlinkedtraitsb. Sexinfluencedtraitc. Sexlinkedhomogameticmaled. Sexlinkedheterogameticmale

14. ThenaturalhabitatofNilgiri‐tahrisa. Sholagrasslandsb. Nilgiriforestsc. SholagrasslandsandNilgiriforestsd. AthighaltitudesofSouth‐WesternGhats

15. When releasing factor binds to stop codon on m‐RNA during translation, thesynthesizedpeptidechainistransferredto

a. t‐RNAb. Waterc. H+d. Aminoacids

16. LocationofGlutamatesynthetaseenzymeinplantsis:a. Onlycytoplasmb. Onlychloroplastc. Bothincytoplasmandchloroplastd. Inmitochondria

17. Whichistrueforβ‐oxidationoffattyacidsa. FormationofmalonylCoAb. FormationofacetoacylACPc. TransportofAcylCoAintomitochondriad. UseofNADPH2

18. The radio isotope which is usually incorporated into thymine to study DNAreplicationprocessis

a. 32Pb. 35Sc. 3Hd. 14C

19. Enzymesacceleratesrateofreactionby:a. Loweringnumberoftransitionstatesb. Loweringtheactivationenergyofhighesttransitionstatec. Providingenergytosubstratewww.easybiologycla

ss.co

m

Page 4: MCQ 015 ICMR JRF Exam July 2015 Model Question Paper with Answers and Explanations Part 3

MCQ015Savepaper…Savetrees… 

FormoreQuestionsandResourcesforyourCSIR/ICMR/DBT/ICAR/UGC/JRFNETLifeScienceExaminationpleasevisit:

www.easybiologyclass.com 4 

d. Providingmorechancetosubstratestoreacttogether20. Enzymeneverinterferewith:

a. Freeenergyofreactionb. Rateofreactionc. Activationenergyoftransitionstated. Reactionequilibrium

21. As we move from one geographical region to next neighbouring region, speciesdiversitytendstochange.Itistermedas

a. α‐diversityb. β‐diversityc. γ‐diversityd. δ‐diversity

22. Globular proteins when treated with organic solvents get denatured. The maininteractionwhichisaffectedontreatmentwithorganicsolventis:

a. Hodrogenbondsb. Covalentbondsc. Ionicinteractionsd. Hydrophobicinteractions

23. Whichregionofvisiblelightismostusefulforphotosynthesis?a. Blueandredb. Greenandredc. Violetandblued. Greenandblue

24. Fog,whichiscommonlyobservedduringwinterismainlyseenata. Lowaltitudewithpollutionb. Highaltitudewithoutpollutionc. Highaltitudewithpollutiond. Lowaltitudewithoutpollution

25. Whatwouldbetheeffectofincreasinghumidityintherateoftranspiration?a. Rateoftranspirationwilldecreaseb. Rateoftranspirationwillincreasec. Initiallytheratewillbelowthenitwillbehighd. Rateoftranspirationwillbeunaffected

www.easybiologyclass.

com

Page 5: MCQ 015 ICMR JRF Exam July 2015 Model Question Paper with Answers and Explanations Part 3

MCQ015 Savepaper…Savetrees…

FormoreQuestionsandResourcesforyourCSIR/ICMR/DBT/ICAR/UGC/JRFNETLifeScienceExaminationpleasevisit:

www.easybiologyclass.com 5

Forcorrectanswersandexplanationsclickbelow(http://www.easybiologyclass.com/biology‐mcq‐multiple‐choice‐questions/

Youmayalsolike…BiologyMCQBiologyMockTestCSIRLectureNotesCSIRPreviousYearQuestionsBiologyPPTBiologyVideoTutorials

YoucandownloadthisquestionpaperfromourSLIDESHAREaccount

Visitwww.easybiologyclass.comformore….

www.easybiologyclass.

com