74
Knowledge Management in the DoD The Future is Now

Knowledge Management in the Department of Defense

Embed Size (px)

DESCRIPTION

David Hoopengardner (AF/FM CKO) & Jo-Ann Hague (Principal Analyst, Air Force Knowledge Now) delivered this presentation at the ASMC PDI in May 2009.

Citation preview

Page 1: Knowledge Management in the Department of Defense

Knowledge Management in the DoDThe Future is Now

KM in the DoD Presenters

David HoopengardnerChief Knowledge Officer

SAFFM

Jo-Ann HagueOD Architect (Web-Based)

Collaboration Anytime hellip Anywhere 2

Air Force Knowledge Now FM Knowledge Management

KM in the DoD Agenda

1 What Is Knowledge Management

2 The Future of KM Is Now

3 KM Has Many Faces in the DoD

4 The Air Force KM Solution Is AFKN

5 We Have Seen the Future of KM and It Is hellip

6 Continue the KM Journey

3Collaboration Anytime hellip Anywhere

WHAT IS KNOWLEDGE MANAGEMENT (KM)

What is KM hellip And Why is it important

4

Agenda

What is KnowledgeInformation from multiple domains that has been synthesized through inference or deduction into meaning or understanding that was not previously known

- Air Force Policy Directive 33-3

Knowledge Definitions

Knowmiddotledge (rsquonauml-lij) n The fact or condition of knowing something with familiarity gained through experience or association

- Merriam-Webster Online Dictionary

5Collaboration Anytime hellip Anywhere

What is Knowledge Management (KM)The capturing organizing and storing of knowledge and experiences of individual workers and groups within an organization and making this information available to others in the organization

- Air Force Policy Directive 33-3

Knowledge Management Definitions

Knowledge Management (KM) KM comprises a range of practices used by organizations to identify create represent and distribute knowledge

- Wikipedia

6Collaboration Anytime hellip Anywhere

KnowledgeManagement

ComputerScience andTechnology

InformationScience

CommunicationScience

Principles governing message handling under varying conditions and capabilities

Gathering manipulating storingretrieving and classifying information

Computing systems languagesand mechanical amp electronicdevices (hardware ampsoftware)

Technical

Social

KnowledgeManagement

SocialScience

ManagementScience

BehavioralScience

Applying scientific methodsto study society and individualrelationships within a society

Understanding human limits andcapacities for information processingand knowledge formulations

Using analytical methods andormathematics to make better decisions

KM hellip A Multidiscipline

7

8

Data Management

InformationManagement

KnowledgeManagement

Wisdom

Data are discrete objective facts that have no meaning in isolation

Information is data with relevance and purpose It ldquoinformsrdquo and causes the reader to change state

Knowledge is information placed in context based on facts and meaningmdashit is actionable

Knowledge enables understanding or wisdom necessary for effective decision making

KM Pyramid Data hellip Information hellip Knowledge

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 2: Knowledge Management in the Department of Defense

KM in the DoD Presenters

David HoopengardnerChief Knowledge Officer

SAFFM

Jo-Ann HagueOD Architect (Web-Based)

Collaboration Anytime hellip Anywhere 2

Air Force Knowledge Now FM Knowledge Management

KM in the DoD Agenda

1 What Is Knowledge Management

2 The Future of KM Is Now

3 KM Has Many Faces in the DoD

4 The Air Force KM Solution Is AFKN

5 We Have Seen the Future of KM and It Is hellip

6 Continue the KM Journey

3Collaboration Anytime hellip Anywhere

WHAT IS KNOWLEDGE MANAGEMENT (KM)

What is KM hellip And Why is it important

4

Agenda

What is KnowledgeInformation from multiple domains that has been synthesized through inference or deduction into meaning or understanding that was not previously known

- Air Force Policy Directive 33-3

Knowledge Definitions

Knowmiddotledge (rsquonauml-lij) n The fact or condition of knowing something with familiarity gained through experience or association

- Merriam-Webster Online Dictionary

5Collaboration Anytime hellip Anywhere

What is Knowledge Management (KM)The capturing organizing and storing of knowledge and experiences of individual workers and groups within an organization and making this information available to others in the organization

- Air Force Policy Directive 33-3

Knowledge Management Definitions

Knowledge Management (KM) KM comprises a range of practices used by organizations to identify create represent and distribute knowledge

- Wikipedia

6Collaboration Anytime hellip Anywhere

KnowledgeManagement

ComputerScience andTechnology

InformationScience

CommunicationScience

Principles governing message handling under varying conditions and capabilities

Gathering manipulating storingretrieving and classifying information

Computing systems languagesand mechanical amp electronicdevices (hardware ampsoftware)

Technical

Social

KnowledgeManagement

SocialScience

ManagementScience

BehavioralScience

Applying scientific methodsto study society and individualrelationships within a society

Understanding human limits andcapacities for information processingand knowledge formulations

Using analytical methods andormathematics to make better decisions

KM hellip A Multidiscipline

7

8

Data Management

InformationManagement

KnowledgeManagement

Wisdom

Data are discrete objective facts that have no meaning in isolation

Information is data with relevance and purpose It ldquoinformsrdquo and causes the reader to change state

Knowledge is information placed in context based on facts and meaningmdashit is actionable

Knowledge enables understanding or wisdom necessary for effective decision making

KM Pyramid Data hellip Information hellip Knowledge

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 3: Knowledge Management in the Department of Defense

KM in the DoD Agenda

1 What Is Knowledge Management

2 The Future of KM Is Now

3 KM Has Many Faces in the DoD

4 The Air Force KM Solution Is AFKN

5 We Have Seen the Future of KM and It Is hellip

6 Continue the KM Journey

3Collaboration Anytime hellip Anywhere

WHAT IS KNOWLEDGE MANAGEMENT (KM)

What is KM hellip And Why is it important

4

Agenda

What is KnowledgeInformation from multiple domains that has been synthesized through inference or deduction into meaning or understanding that was not previously known

- Air Force Policy Directive 33-3

Knowledge Definitions

Knowmiddotledge (rsquonauml-lij) n The fact or condition of knowing something with familiarity gained through experience or association

- Merriam-Webster Online Dictionary

5Collaboration Anytime hellip Anywhere

What is Knowledge Management (KM)The capturing organizing and storing of knowledge and experiences of individual workers and groups within an organization and making this information available to others in the organization

- Air Force Policy Directive 33-3

Knowledge Management Definitions

Knowledge Management (KM) KM comprises a range of practices used by organizations to identify create represent and distribute knowledge

- Wikipedia

6Collaboration Anytime hellip Anywhere

KnowledgeManagement

ComputerScience andTechnology

InformationScience

CommunicationScience

Principles governing message handling under varying conditions and capabilities

Gathering manipulating storingretrieving and classifying information

Computing systems languagesand mechanical amp electronicdevices (hardware ampsoftware)

Technical

Social

KnowledgeManagement

SocialScience

ManagementScience

BehavioralScience

Applying scientific methodsto study society and individualrelationships within a society

Understanding human limits andcapacities for information processingand knowledge formulations

Using analytical methods andormathematics to make better decisions

KM hellip A Multidiscipline

7

8

Data Management

InformationManagement

KnowledgeManagement

Wisdom

Data are discrete objective facts that have no meaning in isolation

Information is data with relevance and purpose It ldquoinformsrdquo and causes the reader to change state

Knowledge is information placed in context based on facts and meaningmdashit is actionable

Knowledge enables understanding or wisdom necessary for effective decision making

KM Pyramid Data hellip Information hellip Knowledge

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 4: Knowledge Management in the Department of Defense

WHAT IS KNOWLEDGE MANAGEMENT (KM)

What is KM hellip And Why is it important

4

Agenda

What is KnowledgeInformation from multiple domains that has been synthesized through inference or deduction into meaning or understanding that was not previously known

- Air Force Policy Directive 33-3

Knowledge Definitions

Knowmiddotledge (rsquonauml-lij) n The fact or condition of knowing something with familiarity gained through experience or association

- Merriam-Webster Online Dictionary

5Collaboration Anytime hellip Anywhere

What is Knowledge Management (KM)The capturing organizing and storing of knowledge and experiences of individual workers and groups within an organization and making this information available to others in the organization

- Air Force Policy Directive 33-3

Knowledge Management Definitions

Knowledge Management (KM) KM comprises a range of practices used by organizations to identify create represent and distribute knowledge

- Wikipedia

6Collaboration Anytime hellip Anywhere

KnowledgeManagement

ComputerScience andTechnology

InformationScience

CommunicationScience

Principles governing message handling under varying conditions and capabilities

Gathering manipulating storingretrieving and classifying information

Computing systems languagesand mechanical amp electronicdevices (hardware ampsoftware)

Technical

Social

KnowledgeManagement

SocialScience

ManagementScience

BehavioralScience

Applying scientific methodsto study society and individualrelationships within a society

Understanding human limits andcapacities for information processingand knowledge formulations

Using analytical methods andormathematics to make better decisions

KM hellip A Multidiscipline

7

8

Data Management

InformationManagement

KnowledgeManagement

Wisdom

Data are discrete objective facts that have no meaning in isolation

Information is data with relevance and purpose It ldquoinformsrdquo and causes the reader to change state

Knowledge is information placed in context based on facts and meaningmdashit is actionable

Knowledge enables understanding or wisdom necessary for effective decision making

KM Pyramid Data hellip Information hellip Knowledge

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 5: Knowledge Management in the Department of Defense

What is KnowledgeInformation from multiple domains that has been synthesized through inference or deduction into meaning or understanding that was not previously known

- Air Force Policy Directive 33-3

Knowledge Definitions

Knowmiddotledge (rsquonauml-lij) n The fact or condition of knowing something with familiarity gained through experience or association

- Merriam-Webster Online Dictionary

5Collaboration Anytime hellip Anywhere

What is Knowledge Management (KM)The capturing organizing and storing of knowledge and experiences of individual workers and groups within an organization and making this information available to others in the organization

- Air Force Policy Directive 33-3

Knowledge Management Definitions

Knowledge Management (KM) KM comprises a range of practices used by organizations to identify create represent and distribute knowledge

- Wikipedia

6Collaboration Anytime hellip Anywhere

KnowledgeManagement

ComputerScience andTechnology

InformationScience

CommunicationScience

Principles governing message handling under varying conditions and capabilities

Gathering manipulating storingretrieving and classifying information

Computing systems languagesand mechanical amp electronicdevices (hardware ampsoftware)

Technical

Social

KnowledgeManagement

SocialScience

ManagementScience

BehavioralScience

Applying scientific methodsto study society and individualrelationships within a society

Understanding human limits andcapacities for information processingand knowledge formulations

Using analytical methods andormathematics to make better decisions

KM hellip A Multidiscipline

7

8

Data Management

InformationManagement

KnowledgeManagement

Wisdom

Data are discrete objective facts that have no meaning in isolation

Information is data with relevance and purpose It ldquoinformsrdquo and causes the reader to change state

Knowledge is information placed in context based on facts and meaningmdashit is actionable

Knowledge enables understanding or wisdom necessary for effective decision making

KM Pyramid Data hellip Information hellip Knowledge

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 6: Knowledge Management in the Department of Defense

What is Knowledge Management (KM)The capturing organizing and storing of knowledge and experiences of individual workers and groups within an organization and making this information available to others in the organization

- Air Force Policy Directive 33-3

Knowledge Management Definitions

Knowledge Management (KM) KM comprises a range of practices used by organizations to identify create represent and distribute knowledge

- Wikipedia

6Collaboration Anytime hellip Anywhere

KnowledgeManagement

ComputerScience andTechnology

InformationScience

CommunicationScience

Principles governing message handling under varying conditions and capabilities

Gathering manipulating storingretrieving and classifying information

Computing systems languagesand mechanical amp electronicdevices (hardware ampsoftware)

Technical

Social

KnowledgeManagement

SocialScience

ManagementScience

BehavioralScience

Applying scientific methodsto study society and individualrelationships within a society

Understanding human limits andcapacities for information processingand knowledge formulations

Using analytical methods andormathematics to make better decisions

KM hellip A Multidiscipline

7

8

Data Management

InformationManagement

KnowledgeManagement

Wisdom

Data are discrete objective facts that have no meaning in isolation

Information is data with relevance and purpose It ldquoinformsrdquo and causes the reader to change state

Knowledge is information placed in context based on facts and meaningmdashit is actionable

Knowledge enables understanding or wisdom necessary for effective decision making

KM Pyramid Data hellip Information hellip Knowledge

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 7: Knowledge Management in the Department of Defense

KnowledgeManagement

ComputerScience andTechnology

InformationScience

CommunicationScience

Principles governing message handling under varying conditions and capabilities

Gathering manipulating storingretrieving and classifying information

Computing systems languagesand mechanical amp electronicdevices (hardware ampsoftware)

Technical

Social

KnowledgeManagement

SocialScience

ManagementScience

BehavioralScience

Applying scientific methodsto study society and individualrelationships within a society

Understanding human limits andcapacities for information processingand knowledge formulations

Using analytical methods andormathematics to make better decisions

KM hellip A Multidiscipline

7

8

Data Management

InformationManagement

KnowledgeManagement

Wisdom

Data are discrete objective facts that have no meaning in isolation

Information is data with relevance and purpose It ldquoinformsrdquo and causes the reader to change state

Knowledge is information placed in context based on facts and meaningmdashit is actionable

Knowledge enables understanding or wisdom necessary for effective decision making

KM Pyramid Data hellip Information hellip Knowledge

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 8: Knowledge Management in the Department of Defense

8

Data Management

InformationManagement

KnowledgeManagement

Wisdom

Data are discrete objective facts that have no meaning in isolation

Information is data with relevance and purpose It ldquoinformsrdquo and causes the reader to change state

Knowledge is information placed in context based on facts and meaningmdashit is actionable

Knowledge enables understanding or wisdom necessary for effective decision making

KM Pyramid Data hellip Information hellip Knowledge

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 9: Knowledge Management in the Department of Defense

9

Wisdom

bull Headingbull Wind Speedbull Storm Surgebull Levy Specificationsbull Population

bull Projected Pathbull WindSurge Effectsbull Previous Storm Historiesbull Levy Vulnerabilities

FAILURE People didnrsquot apply facts and information to situation to meet objectivesGovernmentrsquos (FederalStateLocal) inability to collaborate and act resulted in catastrophe

bull Personal Practicesbull Experiencebull Expertise

Data Management

InformationManagement

KnowledgeManagement

Hurricane Katrina Example

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 10: Knowledge Management in the Department of Defense

Continuity Book Standard of Procedure (SoP) Operating Instruction Knowledge Management Website

10Collaboration Anytime hellip Anywhere

DoDrsquos Common KM Tools

Presenter
Presentation Notes
Historical Continuity Books are changing to online versions

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 11: Knowledge Management in the Department of Defense

THE FUTURE OF KM IS NOWWeb 20 hellip Blogs hellip Wikis hellip Tweets amp Twitters hellip Cloud Computing hellip

11

Agenda

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 12: Knowledge Management in the Department of Defense

Presidential Mandate

12

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 13: Knowledge Management in the Department of Defense

White House Blog

13

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 14: Knowledge Management in the Department of Defense

KM Imperative Now

Future adversaries will continue to employ new readily available technologies in sinister ways

They will adapt and develop new tactics techniques and procedures as fast as they can imagine ways to gain any advantage over us to get inside our decision cycle

Secretary of Defense Robert GatesArmy War College 16 April 2009

Transcript httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=440414

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 15: Knowledge Management in the Department of Defense

KM Imperative Now

Information is powerThatrsquos absolutely the case on the battlefield today

And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

15

Presenter
Presentation Notes
ldquoWersquore all familiar with the old adage ldquoInformation is powerrdquo Well thatrsquos absolutely the case on the battlefield today And to stay ahead of our adversaries we have had to get better at sharing and coordinating knowledge ndash in order to use it effectively 1313ldquoTruckloads of information and data ndash without the proper context ndash can ultimately provide more harm than good to an organization Itrsquos not enough to simply enhance or increase the number of information-gathering technologies We must also be able to interpret that information and make it available to the right people as quickly as possiblerdquo

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 16: Knowledge Management in the Department of Defense

KM Imperative Now

The reality is that most game-changing decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars

Vice Chief of Staff ndash Army General Peter W ChiarelliKM Conference Washington DC ndash April 28 2009

16

Presenter
Presentation Notes
ldquoWho the right people are has also changed significantly in recent years Knowledge is no longer restricted to senior levels of command it canrsquot be or wersquore doomed to failure 1313ldquoThe reality is most lsquogame-changingrsquo decisions are now made by the individual on the ground And many of these decisions are required in a matter of minutes or hours ndash not weeks or months as was the case in past wars 1313ldquoKrulak coined the term lsquoStrategic Corporalrsquo to reflect this new reality 1313ldquoIn the last few years the Army has had to make the necessary adjustments to meet the challenges of this new strategic environment ndash including changes to our knowledge- and intelligence-gathering processesrdquo

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 17: Knowledge Management in the Department of Defense

KM HAS MANY FACES IN THE DoDVarious platforms amp tools hellip Diverse rules amp protocols hellip

17

Agenda

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 18: Knowledge Management in the Department of Defense

DoD Serves Many Customers

18

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 19: Knowledge Management in the Department of Defense

DoD KM Portals

Defense Connect Online (DCO) Joint Knowledge OnlineDefense Knowledge Online (DKO)

DKO is the DoD version of AKO and supports DoD users

Army Knowledge Online (AKO)Navy Knowledge Online (NKO)MarineNetAir Force PortalAir Force Knowledge Now (AFKN)

19

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 20: Knowledge Management in the Department of Defense

Defense Connect Online (DCO)

20

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 21: Knowledge Management in the Department of Defense

Joint Knowledge Online

Collaboration Anytime hellip Anywhere 21

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 22: Knowledge Management in the Department of Defense

Joint Knowledge Management

JKO features Certified Joint Courseware Learning Management System (LMS) using Advanced Distributed Learning Technology Instant messaging chat forums and newsfeeds Lessons LearnedSME Reach Back

JKO currently hosts more than 50 Communities of Interest that provide a customized collaborative work area to share knowledge and experiences

JKO provides numerous links Online reference resources Servicesrsquo distributed learning portals Academic Institutions

22

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 23: Knowledge Management in the Department of Defense

ArmyDefense Knowledge Online

Collaboration Anytime hellip Anywhere 23

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 24: Knowledge Management in the Department of Defense

Collaboration Anytime hellip Anywhere 24

Army Knowledge Online (AKO)

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 25: Knowledge Management in the Department of Defense

Army Knowledge Management

Department of the Army memo titled ldquoArmy Knowledge Management Principlesrdquo signed 23 Jul 08 by the Chief of Staff and Secretary of the Army First step in developing an enterprise approach to KM

Established 12 Principles to complement AR 25-1 (Army KM and Information Technology Management) Peopleculture process and technology focused

Memo explicitly Encourages collaboration and knowledge sharing Influences changes to organizational structures and business

processes that drive KM Recognizes KM leaders as positive change agents Demonstrates value and contributes to mission objectives

25

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 26: Knowledge Management in the Department of Defense

Army KM Structure

Army CIOG6 has responsibility for KM in the Army Army KM Advisor to the CIO G-6 position established

New KM positions includebull KM sections at Division and Corps HQbull KM Officers at Brigadebull Chief Knowledge Officer positions including

bull Armyrsquos Human Resources Command with supporting GS KM positions

Combined Arms Center Knowledge Director position created at Fort Leavenworth

26

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 27: Knowledge Management in the Department of Defense

Army Knowledge Online

Battle Command Knowledge System enables rapid knowledge transfer using full-time facilitators using online professional forums in Knowledge Centers Leadersrsquo Forum

bull Company Commandersbull NCO Net

o ldquoTrouble at Checkpoint 4rdquo enabled 220 responses in a few days from four different continents

Staff Forums such as S3-XO Net Functional Forums such as counterinsurgency and Infantry

Forum

27

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 28: Knowledge Management in the Department of Defense

Navy Knowledge Online

Collaboration Anytime hellip Anywhere 28

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 29: Knowledge Management in the Department of Defense

DON KM Strategy Vision

The vision is to create capture share and reuse knowledge to Enable effective and agile

decision-making Increase the efficiency of

task accomplishment Improve mission

effectiveness

Collaboration Anytime hellip Anywhere 29

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 30: Knowledge Management in the Department of Defense

KM Is Integral Part of DON

At the heart of Network Centric Warfare

Knowledge Dominance Information Superiority Knowledge Management

To be effective there must be a significantly increased commitment to advancemaritime domain awareness (MDA) and expand intelligence surveillance andreconnaissance (ISR) capability and capacity

Maritime forces will contribute to enhance information sharing underpinningand energizing our capability to neutralize threats to our Nation as far fromour shores as possible

A Cooperative Strategy for 21st Century Seapower October 2007

30

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 31: Knowledge Management in the Department of Defense

DON KM Approach

Two Key Aspectsbull Centralized vision executed through decentralized

implementationbull Implemented by commands that recognize its value as

an enabler for improved performance

31

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 32: Knowledge Management in the Department of Defense

Goal 4 Knowledge Dominance

Goal 4 Create align and share knowledge to enable effective and agile decision-making to achieve knowledge dominance41 Establish processes within the Enterprise

and create functional communities of practice to enable net-centric knowledge sharing

42 Implement a comprehensive standards-based content management strategy Department wide

43 Manage records effectively and continue Department wide implementation of electronic records management

44 Manage bandwidth constraints to support rapid knowledge exchange particularly for tactical users

Collaboration Anytime hellip Anywhere 32

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 33: Knowledge Management in the Department of Defense

KM Examples in the Navy

KM officers at PACFLT C2F C3F USFFC NETWARCOM

KM officers in Carrier Strike Groups

KM officers at NETC Learning Centers

33

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 34: Knowledge Management in the Department of Defense

MarineNet

Collaboration Anytime hellip Anywhere 34

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 35: Knowledge Management in the Department of Defense

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 35

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 36: Knowledge Management in the Department of Defense

THE AIR FORCE KM SOLUTION IS AFKNAir Force Knowledge Now (AFKN)FM Knowledge Management (FM KM)

Collaboration Anytime hellip Anywhere 36

Agenda

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 37: Knowledge Management in the Department of Defense

Portal Access

Collaboration Anytime hellip Anywhere 37

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 38: Knowledge Management in the Department of Defense

Air Force Portal

Collaboration Anytime hellip Anywhere 38

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 39: Knowledge Management in the Department of Defense

Air Force Knowledge Now

Collaboration Anytime hellip Anywhere 39

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 40: Knowledge Management in the Department of Defense

FM Knowledge Management

Collaboration Anytime hellip Anywhere 40

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 41: Knowledge Management in the Department of Defense

Collaboration Anytime hellip Anywhere 41

A CoP Is Born hellip

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 42: Knowledge Management in the Department of Defense

Team Living in a Virtual World

42

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 43: Knowledge Management in the Department of Defense

Team Living in a Virtual World

43

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 44: Knowledge Management in the Department of Defense

Discussion Forum

44

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 45: Knowledge Management in the Department of Defense

Questionnaire Wiki amp More

45

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 46: Knowledge Management in the Department of Defense

FM Combat Comptroller

Collaboration Anytime hellip Anywhere 46

Unique CoP Personalities from a Single Template

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 47: Knowledge Management in the Department of Defense

FM Joint Deployment

Collaboration Anytime hellip Anywhere 47

Unique CoP Personalities from a Single Template

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 48: Knowledge Management in the Department of Defense

My AFKN

48

Carving Your Place in the KM World

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 49: Knowledge Management in the Department of Defense

Build Your Own InterfaceThe Future of KM

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 50: Knowledge Management in the Department of Defense

WE HAVE SEEN THE FUTURE OF KM AND IT IS hellip

Web 20 hellip Blogs hellip Wiki hellip Tweets amp Twitters hellip Cloud Computing hellip

Collaboration Anytime hellip Anywhere 50

Agenda

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 51: Knowledge Management in the Department of Defense

Innovative Government 20

Collaboration Anytime hellip Anywhere 51Government 20 Creating Transparency with KM Nate Allen - National Defense University

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 52: Knowledge Management in the Department of Defense

Visionary amp Connected

Collaboration Anytime hellip Anywhere 52Government 20 Creating Transparency with KM Nate Allen - National Defense University

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 53: Knowledge Management in the Department of Defense

Collaborative amp Timely

Collaboration Anytime hellip Anywhere 53Creating Communities of Practice for Results Tony Adams - Anteon

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 54: Knowledge Management in the Department of Defense

Wiki-Enhanced (Intellipedia)

Collaboration Anytime hellip Anywhere 54

JWICS is a system of interconnectedcomputer networks used by the USDepartment of Defense and the USDepartment of State to transmit classifiedinformation It is cleared up to TopSecret The JWICS is the DoDrsquos Top Secretversion of the Internet together with itsSecret counterpart SIPRNet

JWICS is used primarily within theintelligence community with SIPRNet andNIPRNet comprising the overwhelmingbulk of usage within US DoD

Wiki on Joint Worldwide Intelligence Communications System (JWICS)

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 55: Knowledge Management in the Department of Defense

Collaboration Anytime hellip Anywhere 55

Everywhere

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 56: Knowledge Management in the Department of Defense

56

TimelyThe Twitter Connection

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 57: Knowledge Management in the Department of Defense

TimelyNews NOW ndash White House LIVE

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 58: Knowledge Management in the Department of Defense

TargetedThe US Army on Facebook

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 59: Knowledge Management in the Department of Defense

Collaboration Anytime hellip Anywhere 59

MyBase in SL

Three-DimensionalSecond Life (SL)

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 60: Knowledge Management in the Department of Defense

CONTINUE THE KM JOURNEYRead hellip Join hellip Contribute hellip Walk in the Clouds hellip

60

Agenda

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 61: Knowledge Management in the Department of Defense

DoD ndash KM Sites amp ResourcesDefense Connect Online

httpswwwdcododmilJoint Knowledge Online

httpjkocmilorg [Public access via the internet]httpjkojfcommil [Unclassified access via the NIPRnet]httpjkojwfcjfcomsmilmil [Classified access via the SIPRnet]

Army Knowledge Online (AKO) Defense Knowledge Online (DKO)httpswwwusarmymil

Navy Knowledge Onlinehttpswwwankonavymilportalhome

MarineNethttpswwwmarinenetusmcmilMarineNetdefaultaspx

Air Force Portalhttpswwwmyafmil

Air Force Knowledge Now (AFKN)httpsafkmwpafbafmil

Financial Management Knowledge Management (FM KM)httpsafkmwpafbafmilfmkm

Air Education and Training Command ndash Lessons Learnedhttpwwwauafmilauawcawcgateawc-lesnhtmstratcorp

US Army Combined Arms Center ndash Army Lessons Learnedhttpusacacarmymilcac2callindexasp

61

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 62: Knowledge Management in the Department of Defense

DoD KM VoicesUS Army ndash Facebook Presence (Become a Fan)

httpwwwfacebookcomUSarmy

TroopTube (DoDrsquos Response to YouTube)httpwwwtrooptubetv

DoD Live (Blogging Platform)httpwwwdodlivemil

Air Force Blue Tube ndash YouTube Presencehttpwwwyoutubecomafbluetube

Federal KM Working Group (KMWG)httpKMgov

Jeanne Holm NASA (Federal KMWG Chair) on TwitterhttptwittercomFederal_KMWG

Dr Mark Drapeau (Director of Social Software for Security project at Center for Technology and National Security Policy of the National Defense University) on Twitter

httptwittercomcheeky_geeky

62

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 63: Knowledge Management in the Department of Defense

US Army Facebook

63

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 64: Knowledge Management in the Department of Defense

DoDrsquos TroopTube

64

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 65: Knowledge Management in the Department of Defense

DoD Live (Blogging Platform)

65

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 66: Knowledge Management in the Department of Defense

Air Force Blue Tube (YouTube)

66

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 67: Knowledge Management in the Department of Defense

Federal KM Working Group

67

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 68: Knowledge Management in the Department of Defense

Federal KM Working Group

68

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 69: Knowledge Management in the Department of Defense

Cheeky_geeky on Twitter

69

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 70: Knowledge Management in the Department of Defense

Online KM Dialogues amp Resource

APQCrsquos KM Edge Where the Best in KM Come Togetherhttpkmedgeorg

MIT Center for Collective Intelligencehttpscriptsmitedu~cciHCIindexphptitle=Main_Page

70

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 71: Knowledge Management in the Department of Defense

Additional KM Reading

The Strategic Corporal Leadership in the Three-Block Warhttpwwwauafmilauawcawcgateusmcstrategic_corporalhtm

2009 Knowledge Management Conference Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=KM09

2009 Cloud Computing Summit Briefingshttp1105govinfoeventscomEventDownloadsaspxEvent=CLC09

Army Knowledge Management Principleshttp1105govinfoeventscomKMConferenceNeilson_AKM_Principles_25_JUN_2008[1]pdf

New Media and the Air ForcehttpwwwafmilsharedmediadocumentAFD-090406-036pdf

White House Technologyhttpwwwwhitehousegovissuestechnology

Secretary of Defense Robert Gatesrsquo Speech at the Army War College ndash 16 Apr 2009httpwwwdefenselinkmiltranscriptstranscriptaspxtranscriptid=4404

71

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 72: Knowledge Management in the Department of Defense

Network with Us ndashItrsquos the KM Thing To Do

David HoopengardnerChief Knowledge Officer SAFFMAir Force Knowledge Now (AFKN)

DavidHoopengardnerctrpentagonafmil

Jo-Ann HagueKM Architect Financial Management Knowledge Management (FM KM)Air Force Knowledge Now (AFKN)

JoannHaguewpafbafmil

72

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 73: Knowledge Management in the Department of Defense

Atlantis Crew Tweets on HubbleldquoThe View Is Awesomerdquo

Collaboration Anytime hellip Anywhere 73

KM Get on Board

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009
Page 74: Knowledge Management in the Department of Defense

That little speck in the lower left quadrant is the only imageever taken of a Space Shuttle and the Hubble Space Telescopein front of the sun - 13 May 2009

httplaughingsquidcomphoto-of-space-shuttle-atlantis-hubble-space-telescope-transiting-the-sun

Collaboration Anytime hellip Anywhere 74

KM The View Is Awesome

  • Knowledge Management in the DoD
  • KM in the DoD Presenters
  • KM in the DoD Agenda
  • What is Knowledge Management (KM)
  • Knowledge Definitions
  • Knowledge Management Definitions
  • KM hellip A Multidiscipline
  • KM Pyramid Data hellip Information hellip Knowledge
  • Hurricane Katrina Example
  • DoDrsquos Common KM Tools
  • The Future of KM is Now
  • Presidential Mandate
  • White House Blog
  • KM Imperative Now
  • KM Imperative Now
  • KM Imperative Now
  • KM Has Many Faces in the DoD
  • DoD Serves Many Customers
  • DoD KM Portals
  • Defense Connect Online (DCO)
  • Joint Knowledge Online
  • Joint Knowledge Management
  • ArmyDefense Knowledge Online
  • Slide Number 24
  • Army Knowledge Management
  • Army KM Structure
  • Army Knowledge Online
  • Navy Knowledge Online
  • DON KM Strategy Vision
  • KM Is Integral Part of DON
  • DON KM Approach
  • Goal 4 Knowledge Dominance
  • KM Examples in the Navy
  • MarineNet
  • Air Force Knowledge Now
  • The Air Force KM Solution Is AFKN
  • Portal Access
  • Air Force Portal
  • Air Force Knowledge Now
  • FM Knowledge Management
  • Slide Number 41
  • Team Living in a Virtual World
  • Team Living in a Virtual World
  • Discussion Forum
  • Questionnaire Wiki amp More
  • FM Combat Comptroller
  • FM Joint Deployment
  • My AFKN
  • Build Your Own Interface
  • We have seen the future of KM and it is hellip
  • Innovative Government 20
  • Visionary amp Connected
  • Collaborative amp Timely
  • Wiki-Enhanced (Intellipedia)
  • Slide Number 55
  • Timely
  • Timely
  • Targeted
  • Slide Number 59
  • Continue the KM Journey
  • DoD ndash KM Sites amp Resources
  • DoD KM Voices
  • US Army Facebook
  • DoDrsquos TroopTube
  • DoD Live (Blogging Platform)
  • Air Force Blue Tube (YouTube)
  • Federal KM Working Group
  • Federal KM Working Group
  • Cheeky_geeky on Twitter
  • Online KM Dialogues amp Resource
  • Additional KM Reading
  • Network with Us ndash Itrsquos the KM Thing To Do
  • Atlantis Crew Tweets on Hubble
  • That little speck in the lower left quadrant is the only image ever taken of a Space Shuttle and the Hubble Space Telescope in front of the sun - 13 May 2009