Upload
others
View
0
Download
0
Embed Size (px)
Citation preview
Subscriber access provided by Imperial College London | Library
Journal of Agricultural and Food Chemistry is published by the American ChemicalSociety. 1155 Sixteenth Street N.W., Washington, DC 20036Published by American Chemical Society. Copyright © American Chemical Society.However, no copyright claim is made to original U.S. Government works, or worksproduced by employees of any Commonwealth realm Crown government in the courseof their duties.
Article
Discovery of a bacterial glycoside hydrolase family 3 (GH3) #-glucosidasewith myrosinase activity from a Citrobacter strain isolated from soil
Abdulhadi Albaser, Eleanna Kazana, Mark Bennett, FatmaCebeci, Vijitra Luang-In, Pietro D. Spanu, and John T. Rossiter
J. Agric. Food Chem., Just Accepted Manuscript • DOI: 10.1021/acs.jafc.5b05381 • Publication Date (Web): 28 Jan 2016
Downloaded from http://pubs.acs.org on January 29, 2016
Just Accepted
“Just Accepted” manuscripts have been peer-reviewed and accepted for publication. They are postedonline prior to technical editing, formatting for publication and author proofing. The American ChemicalSociety provides “Just Accepted” as a free service to the research community to expedite thedissemination of scientific material as soon as possible after acceptance. “Just Accepted” manuscriptsappear in full in PDF format accompanied by an HTML abstract. “Just Accepted” manuscripts have beenfully peer reviewed, but should not be considered the official version of record. They are accessible to allreaders and citable by the Digital Object Identifier (DOI®). “Just Accepted” is an optional service offeredto authors. Therefore, the “Just Accepted” Web site may not include all articles that will be publishedin the journal. After a manuscript is technically edited and formatted, it will be removed from the “JustAccepted” Web site and published as an ASAP article. Note that technical editing may introduce minorchanges to the manuscript text and/or graphics which could affect content, and all legal disclaimersand ethical guidelines that apply to the journal pertain. ACS cannot be held responsible for errorsor consequences arising from the use of information contained in these “Just Accepted” manuscripts.
1
Discovery of a bacterial glycoside hydrolase family 3 (GH3) β-glucosidase with myrosinase activity 1
from a Citrobacter strain isolated from soil 2
3
Abdulhadi Albaser 1,5
, Eleanna Kazana 1,3
, Mark H Bennett 1, Fatma Cebeci
2, Vijitra Luang-In
1,4 Pietro 4
D Spanu 1 and John T Rossiter
1* 5
6
1 Imperial College London, Faculty of Life Sciences, London SW7 2AZ, UK 7
2 Food and Health Programme, Institute of Food Research, Norwich, NR4 7UA, UK 8
3Current address: School of Biosciences, University of Kent, Canterbury, Kent, CT2 7NJ 9
4Current Address: Mahasarakham University, Faculty of Technology, Department of Biotechnology, 10
Natural Antioxidant Research Unit, Mahasarakham 44150, Thailand 11
5Current address: Division of Microbiology, Faculty of Sciences, University of Sebha, Sebha Libya 12
*Corresponding author; John T Rossiter, Imperial College London, Faculty of Life Sciences, London 13
SW7 2AZ, UK; email: [email protected]
14
15
16
17
18
19
20
21
Page 1 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
2
ABSTRACT 22
A Citrobacter strain (WYE1) was isolated from a UK soil by enrichment using the glucosinolate sinigrin 23
as a sole carbon source. The enzyme myrosinase was purified using a combination of ion exchange and 24
gel filtration to give a pure protein of approximately 66 kDa. The N-terminal amino acid and internal 25
peptide sequence of the purified protein were determined and used to identify the gene which, based on 26
InterPro sequence analysis, belongs to the family GH3, contains a signal peptide and is a periplasmic 27
protein with a predicted molecular mass of 71.8 kDa. A preliminary characterization was carried out 28
using protein extracts from cell free preparations. The apparent KM and Vmax were 0.46 mM and 4.91 29
mmol dm-3
min-1
mg-1
respectively with sinigrin as substrate. The optimum temperature and pH for 30
enzyme activity were 25 oC and 6.0 respectively. The enzyme was marginally activated with ascorbate by 31
a factor of 1.67. 32
33
Keywords: myrosinase, bacteria, isothiocyanate, sequence 34
35
36
37
38
39
40
41
42
43
Page 2 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
3
INTRODUCTION 44
Bacterial myrosinases are not well understood and there has been little work on this topic. Bacterial 45
myrosinases were first purified some years ago as an active enzyme but without any characterisation in 46
terms of sequence.1, 2
Since then there have been various reports examining the metabolism of 47
glucosinolates by bacteria and attempts have been made to characterize the enzyme but with limited 48
success.3-7
We have set out to isolate a bacterium that can grow on sinigrin, purify the myrosinase and 49
obtain a sequence. β-Glucosidases (EC 3.2.1.21) catalyse the hydrolysis of the glucosidic linkages of a 50
variety of β-glucosides and, depending on sequence and structure, can be placed in the glycoside 51
hydrolase (GH) families GH1, GH3, GH9, GH 30 and GH116.8-10
With the exception of GH9, the 52
remainder utilize a two-step mechanism that involves a catalytic nucleophile that displaces the aglycone 53
and is followed by protonation of the nucleofuge and attack by a water molecule to give a glycosyl 54
residue. Plant myrosinases (thioglucoside glucohydrolase EC 3.2.3.147) belong to the family GH1 and 55
their structure and mechanisms have been well studied.11-14
Myrosinases hydrolyse glucosinolates, a 56
group of plant secondary metabolites, to give a variety of products (Figure 1) depending on the presence 57
of specifier proteins and type of glucosinolate, but the default product is an isothiocyanate (ITC).15-18
The 58
mechanism of plant myrosinase does not utilize the typical catalytic acid/base employed by β-59
glucosidases but instead uses ascorbate as a catalytic base. The Sinapis alba myrosinase is a dimer linked 60
by a zinc atom and has a characteristic (β/α)8-barrel structure in common with GH1 enzymes. The insect 61
Brevicoryne brassicae (cabbage aphid) contains a myrosinase that has been studied in some detail and 62
also belongs to the glucose hydrolase family GH1 19-21
and its structure has been determined.22
In contrast 63
to the S. alba myrosinase, the aphid myrosinase does not require ascorbate for activity and its mechanism 64
is the same as for β-glucosidases i.e. a nucleophile (glutamic acid residue) that forms a glycosyl-enzyme 65
intermediate together with a glutamic acid residue that acts as a catalytic base/acid typical of most GH1 66
glucosidases. 67
Page 3 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
4
There is, however, increasing interest in bacteria that can metabolise glucosinolates, particularly those of 68
the human gut, where the chemoprotective nature of glucosinolate hydrolysis products is of dietary 69
importance.23
In addition, soil bacteria are also of importance in terms of soil ecology and in the 70
application of biofumigation, where plants belonging to the Brassicaceae, which are high in glucosinolate 71
content, are used to fumigate soil.24-27
In this work we describe the isolation of a soil bacterium that 72
possesses an inducible β-glucosidase that transforms glucosinolates into isothiocyanates. The properties 73
and sequence of the enzyme are described. 74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
Page 4 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
5
METHODS 89
Glucosinolates 90
Glucosinolates were isolated from seed sources as previously described.28
91
Isolation of a glucosinolate-metabolizing bacterial strain by enrichment 92
Soil was taken from a field in Wye (Kent, UK), which had previously been used for growing oilseed rape, 93
and 1 gram was placed into 10 ml of M9 medium with sinigrin (10 mg) as the sole carbon source and 94
placed in the dark at room temperature for 2 weeks. After gentle agitation, 1 ml of solution was removed, 95
placed into fresh M9 media with sinigrin as the sole carbon source and incubated for a further 2 weeks. 96
This process was repeated a further 5 times. Finally, dilutions were made and a small amount of the 97
enrichment culture was streaked onto a nutrient agar plate for each dilution. The plates were incubated 98
overnight at 30 oC. Colonies were added to fresh M9 media containing sinigrin as the sole carbon source 99
and incubated at 30 oC, and the OD600nm (optical density at 600nm) was monitored. The culture was 100
centrifuged at 10000g for 5 min and stored at -20 oC until analysis. Sinigrin-metabolizing colonies were 101
grown overnight in M9 media supplemented with sinigrin as the sole carbon source, and the following 102
day glycerol stocks (40%) were made and stored at -80 oC. 103
HPLC analysis of sinigrin fermentation 104
The fermentation of sinigrin was monitored by removing 1 mL of culture into an Eppendorf (1.5 mL) tube 105
and centrifuging at 10000g for 10 min. The supernatant was removed and stored at -20 oC until analysis. 106
Samples were thawed out (1 mL), 100 µL of a barium/lead acetate solution (equimolar, 1M) were added, 107
and samples were thoroughly mixed and allowed to stand for a few minutes. The samples were 108
centrifuged at 10000g for 5 min and the supernatant was removed and transferred to a fresh Eppendorf 109
tube. DEAE Sephadex-A25 (Sigma, UK) was mixed with an excess of NaOAc buffer (1M, pH 5), which 110
was changed several times over 6 h and finally left overnight to equilibriate. The excess buffer was 111
decanted and the ion exchanger was mixed with deionized water, decanted (x 2) and finally stored in 20 112
Page 5 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
6
% EtOH to give an approximately 50% settled gel. One mL of suspended DEAE Sephadex-A25 slurry 113
was pipetted into Poly-Prep Chromatography Columns (BioRad, UK) and allowed to drain. The ion 114
exchange material was washed twice with 1 mL de-ionised water, and the sample was applied and 115
allowed to drain. The column was washed with 2 x 1 mL de-ionised water, followed by two washes of 0.5 116
mL sodium acetate buffer (0.05 M, pH 5.0). Sulfatase (Sigma, UK) was added (75 µL, 0.3U/mL) 117
carefully to the top of the gel and the column was left overnight at room temperature. The desulfo-118
glucosinolate (DS-GSL) was eluted with 3 x 0.5 mL of deionized water and stored at -20 oC until HPLC 119
analysis. The DS-GSLs were analysed by HPLC on a Synergi Hydro-RP column (4 µm, 15 x 0.2 cm, 120
Phenomenex Inc. Torrance, CA). The following conditions were used for the HPLC analysis: Water 121
(solvent A), ACN (solvent B); 2% B (15 min), 2-25% B (2 min), 25-70% B (2 min), 70% (2 min), 70-2% 122
B (2 min), 70-2%B (15 min); flow rate 0.2 mL/min, column temperature 35 oC. HPLC was carried out 123
using an Agilent HP1100 system with a Waters UV detector (model 486) at a wavelength of 229 nm. 124
GC-MS analysis of glucosinolate metabolites 125
One mL of culture or cell free extract was removed and centrifuged at 10000g for 10 min. The 126
supernatant was removed and transferred to a 2 mL Eppendorf tube, 0.5 mL DCM was added and the tube 127
was vortexed for 30 s. The tubes were centrifuged at 10000g for 5 min and the DCM was carefully 128
removed with a glass syringe. The sample was re-extracted with a further 0.5 mL DCM and combined 129
with the first extraction. A small amount of dried MgSO4 was added to the DCM extract to remove any 130
water and briefly vortexed. The extract was centrifuged and the DCM was carefully removed, transferred 131
to an Agilent 2 mL screw cap vial and stored at 4 oC until analysis. 132
An Agilent HP 6890 series system connected to an Agilent HP 5973 mass selective detector was used for 133
the GC-MS analysis. A capillary column, Agilent HP-5MS (5% Phenylmethylsiloxane, 30 m × 0.25 mm 134
i.d.; film thickness, 0.25 µm), was used with helium as the carrier gas (split mode, 25:1; splitter inlet 135
pressure, 40 kPa). The temperature was kept at 40 °C for 10 min and ramped up to 150 °C at the rate of 136
4°C/min for 25 min and then to 250°C at the rate of 4°C/min for 15 min, with the flow at 1 mL/min, 137
Page 6 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
7
average velocity of 36 cm/s, pressure at 7.56 kPa and injection volume of 1 µL. Mass spectra were 138
obtained by electron ionization (EI) over a range of 50−550 atomic mass units. Ion source temperature 139
was 230 °C and the electron multiplier voltage was 70.1 eV. The analysis of allyl amine, allyl nitrile and 140
2-propenoic acid (Sigma UK) were carried out on a Machery-Nagel (UK) Optima Delta-6 column (30 m 141
× 0.25 mm i.d.; film thickness, 0.25 µm) using the same programme as previously described, with the 142
exception that the final oven temperature was 200 °C. The limit of detection for pure ITC/NIT standards 143
by GC-MS analysis was 10 ng/mL. 144
16S rRNA Sequence determination, genomic DNA assembly and preparation of phylogenetic tree 145
An overnight culture was centrifuged at 13000g for 5 min, and the pellet was washed with milliQ water 146
(x1), resuspended in 15 µL milliQ water and boiled at 95 oC for 5 min. The sample was cooled on ice, 147
spun for 5 min at 13,000g and the supernatant was collected. The gene was amplified by PCR using the 148
primers AMP_F: 5': GAG AGT TTG ATY CTG GCT CAG, Tm: 60.5 and AMP_R: 5': AAG GAG GTG 149
ATC CAR CCG CA, Tm: 68.9, GoTaq DNA polymerase, PCR buffer (Promega) and dNTPs (200 µM 150
each). The PCR conditions were the following: initial denaturation 95 oC, 2 min (1 cycle); denaturation 151
95oC, 30 s (20 cycles); annealing 55
oC, 30 s (20 cycles); extension 72 °C, 1 min 30 s (20 cycles); final 152
extension 72 °C, 1 min (1 cycle). The PCR product (1500 bp) was purified by QIAquick PCR 153
purification kit (Qiagen) and quantified by a Nanodrop 2000 spectrometer (Thermo scientific). The 154
product was sequenced with both primers (AMP_F and AMP_R; Eurofins Sequencing). The sequences 155
were assembled using Seqman to create a contig and this contig was searched on the RDP database 156
(https://rdp.cme.msu.edu/seqmatch/seqmatch_intro.jsp). The genomic DNA of the Citrobacter WYE1 157
was sequenced at The Genome Analysis Centre, Norwich, UK, using the Illumina MiSeq platform as 158
previously reported (29). The 251bp length of DNA reads from Genomic DNA sequencing was analysed 159
and quality-trimmed extended contigs were produced by using SPAdes program version 3.6.1.29
These 160
contigs of Citrobacter WYE1 were used in construction of a phylogenetic tree. Draft genomes of different 161
Citrobacter species were obtained from Genbank whole genome shutgun projects. Core genome single 162
Page 7 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
8
nucleotide polymorphisms (SNPs) in draft genomes and Citrobacter WYE1 were used to prepare the 163
phylogenetic tree using parSNP program Version 1.2 30
. 164
Myrosinase assay 165
Myrosinase activity determinations were based on the glucose oxidase/peroxidase enzyme assay of 166
glucose.31
Preparation of the GOD-PERID (glucose oxidase-peroxidase) reagent (all reagents purchased 167
from Sigma, UK): 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) 250 mg, glucose oxidase 12.7 168
mg (157.5 U/mg) and peroxidase 4.7 mg (148U/mg) were dissolved in Tris buffer (3 g Tris, final 169
concentration 0.1M, pH 7.2) to a volume of 250 mL. The reagent was mixed well, wrapped with 170
aluminium foil and kept at 4°C. A calibration curve was obtained using glucose. Samples were assayed in 171
a total volume of 300 µL containing the myrosinase extract (maximum volume 20 µL), 2 mM sinigrin, 172
CPB (citrate phosphate buffer, 20 mM, pH 6.0), and incubated at 25 oC for 2 h or less depending on the 173
activity. The reaction was stopped by placing in a heating block (95 oC) for 5 min and cooled on ice. 1 174
mL of GOD-PERID reagent was added to the sample and incubated for 15 min at 37 °C. The absorbance 175
at 420 nm was measured and the glucose concentration was determined from a calibration graph. 176
General assay conditions for myrosinase activity 177
As there was insufficient pure protein for characterization studies, preliminary studies were carried out 178
using cell-free protein extracts. An overnight culture of Citrobacter WYE1 was grown on nutrient broth 179
(NB), inoculated into M9 medium (50 mL) with 50 mg of sinigrin and incubated aerobically overnight at 180
30 °C in a shaking incubator at 180 rpm. The culture was centrifuged, the pellet was washed as described 181
in the purification methods and the cells re-suspended in 5 ml of extraction buffer (CPB, 50 µL 100 xs 182
protease inhibitor cocktail (Melford Ltd) and 1 mM DTT) and lysed using a one shot cell disruptor 183
(CONSTANT SYSTEMS Ltd, Northants, UK). The lysate was centrifuged at 10,000 g for 15 min at 4oC. 184
The cell-free protein extract was desalted against CPB using Econo-Pac 10DG Desalting Columns 185
(BIORAD, UK) and stored at 4oC. The protein concentration was determined using Bradford reagent 186
Page 8 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
9
(BIORAD, UK). The activity of the myrosinase was initially determined to ensure linearity and an 187
appropriate amount of protein used for each assay. As the activity of the myrosinase markedly diminished 188
over time, the cell-free protein extracts were used within 72 h of preparation. 189
pH Optimisation 190
Citrate phosphate buffer (pH range of 3.6-7.6, 20 mM) was used to determine the optimum pH for 191
Citrobacter WYE1myrosinase. Crude protein extract (5 µg) was added to a mixture of sinigrin (2 mM) in 192
CPB to a final volume of 300 µL at specific pH values over the range 3.6 -7.6 and incubated at 37 °C for 193
2 h. The reaction was stopped by immersing the tubes in boiling water for 5 min. Glucose release 194
measurements were then carried out using the GOD-PERID assay. 195
Temperature optimization 196
The effect of temperature on the activity of the Citrobacter WYE1 myrosinase was measured over a range 197
of temperatures (5-70 ºC). A total volume (300 µL) with protein (5µg), sinigrin (2 mM) and CPB was 198
incubated at the specified temperature for 30 min and glucose release was assayed by the GOD Perid 199
assay. 200
Substrate specificity 201
Myrosinase assays were carried out using CPB, 2 mM glucosinolate substrate, 60 min incubation and 20 202
µg protein. Samples for qualitative GC-MS analysis were incubated overnight and extracted with DCM as 203
previously described for glucosinolate metabolites. 204
Activation by ascorbate 205
A mixture of the protein (16 µg) and CPB was incubated (30 ºC, 1h) with ascorbate concentrations in the 206
range 0.025-20 mM and gluconasturtiin (0.5 mM) to a volume of 300 µL. The reaction was stopped by 207
boiling (5 min). ITCs were extracted with dichloromethane and quantitated by GC-MS using an Agilent 208
Page 9 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
10
HP-5MS column as previously described. Quantitation was carried out using a calibration graph of known 209
phenethylisothiocyanate concentrations versus total ion current. 210
Determination of apparent Km & Vmax for sinigrin 211
A range of sinigrin concentrations (0.1-5 mM) was incubated (25 °C, 10 min) with protein (2 µg) and 212
CPB in a total volume of 300 µL. The reaction was stopped by boiling (5 min) and cooled before the 213
GOD Perid reagent (1 mL) was added and incubated (15 min, 37 °C), followed by absorbance 214
measurement (420 nm). Assays were carried out in triplicate and the kinetic parameters evaluated using 215
GraphPad version 6. 216
Estimation of pI 217
A range of buffers at different pH (N-methyl piperazine pH 4.5 and 5; L- histidine pH 5.5 and 6.0; bis-218
Tris pH 6.6; bis-Tris propane pH 7; triethanolamine pH 7.6; Tris pH 8) was used to determine the 219
approximate pI of the Citrobacter myrosinase. Mini anion Q columns (Thermo scientific) were 220
equilibrated with the appropriate buffer (400 µL) and centrifuged on an Eppendorf 5425 centrifuge 221
(2000g, 4 ºC, 5 min). The protein extract was desalted using Zebra spin desalting columns 0.5 mL 222
(Thermo scientific) against the appropriate pH buffer and applied to the mini anion Q column and then 223
centrifuged (2000 x g, 4 ºC, 5 min). The column was washed twice with the appropriate buffer (400µL). 224
Finally the protein was eluted with buffer that contained NaCl (1 M) and desalted against CPB before 225
being assayed for activity. 226
Inducibility of myrosinase 227
Citrobacter WYE1 was grown overnight in M9 media and separately supplemented with sinigrin (10 228
mM) or glucose (10 mM). Cell protein extracts were prepared as previously described (general assay 229
conditions) and assayed for myrosinase activity using 5 µg of crude desalted protein extract/assay. 230
Purification of Citrobacter WYE1 myrosinase 231
Page 10 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
11
An overnight culture of Citrobacter WYE1 was grown on nutrient broth (NB), inoculated into M9 232
medium (500 mL) with 0.5 g of sinigrin and incubated aerobically overnight at 30 °C in a shaking 233
incubator at 180 rpm. The bacteria were harvested by centrifugation (Avanti J26 XP, Beckman coulter, 234
USA) (8000g, 15 min, 4 °C) and washed twice with CPB. The cell pellet was re-suspended in extraction 235
buffer (CPB, 250 µL 100 Xs protease inhibitor cocktail (Melford Ltd), 1 mM DTT) and lysed using a one 236
shot cell disruption system. The cell debris was pelleted by centrifugation (20,000 x g, 20 min, 4°C) and 237
the supernatant was desalted against CPB using a desalting column (Econo-Pac 10DG) and concentrated 238
to 11 mL using an ultrafiltration membrane tube (molecular weight cut-off 10 KDa, 4 mL UFC801024, 239
Amicon ultra, Millipore, USA). The protein concentration was measured using Bradford’s reagent 240
(BioRad, UK) and the activity of the extract using the GOD-PERID reagent. 241
Proteins were separated on a Mono Q HR 515 column (50 x 5 mm I.D., Pharmacia, Uppsala, Sweden). 242
The column was attached to a WATERS HPLC purification system (650 E, Millipore, USA) equipped 243
with a UV detector (ABI 757 absorbance detector, Applied Biosystems) and protein elution monitored at 244
A280nm. Both the initial starting buffer (Tris 20 mM, pH 8.0) and elution buffer (Tris 20 mM, plus NaCl 245
1M pH 8.0) were filtered using a Millipore membrane filter. The column was pre-equilibrated with 246
starting buffer. The sample (40 mg of protein) was desalted against the initial starting buffer using Econo-247
Pac 10DG desalting columns then filtered through a 0.2 µm mini-Sart filter prior to injection. Fractions 248
(1.5 mL) were collected every 2 min at flow rate of 0.75 mL/min. The bound protein was eluted by using 249
a linear buffer concentration gradient from 0-1M NaCl (Supplementary information S1). 250
Fractions with myrosinase activity were combined and desalted against starting buffer using Econo-Pac 251
10DG desalting columns and concentrated using an ultrafiltration membrane tube. The sample (0.77 mg) 252
was applied to an ion exchange column (Mono Q column) equilibrated with the same buffer. The 253
separation was carried out exactly as previously outlined except that 0.75mL fractions were collected. 254
The active fractions following the ion exchange purification second step were combined, desalted against 255
CPB (50 mM, pH 6.0) using Econo-Pac 10DG desalting columns and concentrated by ultrafiltration 256
Page 11 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
12
(molecular weight cut-off 10 KDa, 4 mL UFC801024, Amicon ultra, Millipore, USA). The sample (50 257
µg) was loaded onto a Superdex 75 gel filtration column (Superdex 75, 75, 10/300 GL, GE Healthcare 258
Life Sciences, Sweden) equilibrated with CPB buffer containing NaCl (150 mM) and sodium azide 259
(0.02%). Fractions (0.35 mL) were collected every 1 min at flow rate of 0.35 mL/min and assayed for 260
myrosinase activity. Molecular weight markers 12 - 79 kDa (GE Healthcare Ltd) were used to calibrate 261
the column: cytochrome c (12.4 kDa), carbonic anhydrase (29 kDa), albumin (45 kDa), albumin bovine 262
serum (66 kDa) and transferrin (79 kDa). 263
SDS PAGE 264
Gels (13%) were prepared as previously described32
and stained with SimplyBlue™ SafeStain (Life 265
Technologies). 266
N-Terminal sequencing and internal peptide sequencing 267
Pure protein was used for N-terminal sequencing (Edman degradation) which was carried out at the 268
Protein Sequence Analysis Facility, Department of Biochemistry, Cambridge (UK). Internal peptide 269
analysis was carried out by slicing out the pure protein from an SDS-PAGE gel stained with 270
SimplyBlue™ SafeStain. The gel bands were processed and analysed by LC-MS as previously 271
described.33
272
The full-length DNA coding sequence was obtained using Geneious Pro 5.6.6. Software. 273
GenBank accession numbers 274
Citrobacter_WYE1_Myr_KT821094; Citrobacter_WYE1_16sRNA_KT825141 275
276
277
278
Page 12 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
13
279
280
281
282
RESULTS 283
Strain isolation and identification 284
Serial dilutions were made from the enrichment culture and 100 µL spread onto nutrient agar plates 285
followed by incubation at 30 oC. A single colony was picked and cultured in M9 medium with sinigrin as 286
the sole carbon source overnight. The pure isolate was identified by 16S rRNA sequence analysis. S_ab 287
scores of > 0.95 for twenty matches with known Citrobacter species were obtained and it was deduced 288
that the isolated organism belongs to the family Enterobacteriaceae and the genus Citrobacter and was 289
named Citrobacter WYE1 to indicate the origin of the isolate. It was not possible to assign Citrobacter 290
WYE1 to a specific species based on the 16S rRNA sequence. A phylogenetic tree was constructed to 291
show its relationship among selected Citrobacter strains (Figure 2). It is likely that Citrobacter WYE1 is 292
a new species. 293
Fermentation of sinigrin 294
The metabolism of sinigrin was monitored by HPLC and OD values were recorded over a 24 h period 295
(Figure 3). Sinigrin was completely utilized although no product could be identified. The potential 296
products allyisothiocyanate, or corresponding nitrile, carboxylic acid or amine could not be detected by 297
GC-MS. 298
Properties of the myrosinase activity 299
Page 13 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
14
Fresh cell-free protein extracts were used for all assays and were tested for activity prior to use. The 300
testing of activity was necessary as there were differences between preparations. An experiment was 301
carried out to determine whether the myrosinase was constitutive or inducible. Growth of Citrobacter 302
WYE1 in M9 media supplemented with glucose gave only low levels of myrosinase activity as did 303
nutrient broth. It was clear, however, that in the presence of sinigrin, myrosinase activity was 304
substantially induced (Figure 4). Sinigrin was stable over the 24 h period in M9 medium alone. The 305
approximate pI of the protein was between pH 6-7, based on binding of the enzyme to miniQ ion 306
exchange columns. Thus, for purification purposes, ion exchange buffers of pH 8 were used. The 307
temperature optimum was 25 oC for the myrosinase (Figure 5), which is unlike most plant and aphid 308
myrosinases where temperature optima are generally higher.17, 18
The pH optimum of the enzyme was 309
found to be 6, while at pH 7.6 the activity was markedly diminished (Figure 6). With this in mind, it was 310
necessary to desalt all purified fractions against CPB in order to obtain the full myrosinase activity. The 311
myrosinase was active towards three other glucosinolates tested: glucoerucin had similar specific activity 312
to sinigrin, while glucotropaeolin and glucoraphanin had lower values, suggesting that the nature of the 313
side chain is important (Figure 7). In addition to the GOD-PERID assays, the ITCs were identified by 314
GC-MS. All of the substrates gave the expected ITCs and no other products such as nitriles were observed 315
(Supplementary information S2). GC-MS analysis of the hydrolysis products was used to determine the 316
activation of myrosinase by ascorbate, as this compound interferes with the GOD-PERID assay. In 317
addition, gluconasturtiin, which results in phenethylisothiocyanate on hydrolysis, was used as the 318
substrate, since allylisothiocyanate produced by sinigrin is very volatile and can result in significant 319
losses during work up. The ascorbate-treated myrosinase assays resulted in an activation of 1.67 (Figure 320
8) which is very low in comparison to the plant enzymes. The apparent Km and Vmax were 0.46 mM and 321
4.91 mmol dm-3
min-1
mg-1
respectively (Figure 9). The Km value of the Citrobacter WYE1 myrosinase 322
was similar to those obtained for the aphid myrosinase19, 20, 22
and some plant myrosinases.18
323
Purification of Citrobacter WYE1 myrosinase 324
Page 14 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
15
The enzyme was purified by ion exchange chromatography (Supplementary information S1) on a high 325
resolution monoQ ion exchange column, followed by gel filtration The procedure gave a pure single band 326
with an approximate molecular mass of 66 kDa on analysis by SDS-PAGE (Figure 10). The gel filtration 327
step using a high resolution Superdex 75 column gave a native molecular size of approximately 66 kDa, 328
based on GE-Health Care molecular weight markers. Thus it would appear that the bacterial myrosinase is 329
a monomeric protein. The myrosinase is however of low abundance, with a yield of 4.5 µg pure protein 330
from a fermentation of 500 ml (Table 1). 331
Sequence analysis 332
The N-terminal sequence (SIQSAQQPELGYDTV) of the purified protein was determined (Figure 11a) as 333
well as peptides from tryptic digestion. The N-terminal peptide was used as a query to identify the 334
respective gene by tBLASTn against the genomic sequence reads obtained by Illumina. The DNA 335
sequences found were then assembled; the resulting consensus sequence was then used in iterative 336
searches of the non-assembled genome reads to extend the locus encoding the myrosinase gene, until a 337
full-length coding sequence corresponding to a plausible ORF for myrosinase was obtained. No other 338
genes could be identified using the sequence data obtained, suggesting that there is only one myrosinase 339
gene. The validity of the DNA sequence was confirmed by carrying out PCR of the genomic DNA 340
(unpublished data). 341
BLAST analysis of the translated sequence of Citrobacter WYE1 myrosinase showed a high degree of 342
homology with a number of bacterial β-O-glucosidases (Figure 11b), the greatest being with a 343
hypothetical protein sequence from Citrobacter sp. 30_2. This bacterium was made available (Dr. Emma 344
Allen-Vercoe, University of Guelph) to us but showed no activity towards glucosinolates. There was no 345
significant homology with either plant or aphid myrosinases. Using InterProt34
, the protein was shown to 346
belong to the GH 3 family of glucosidases. This is in contrast to known myrosinases which so far all 347
belong to GH 1. 348
Page 15 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
16
The full length gene appears to code for an N-terminal signal peptide which presumably targets the 349
enzyme to the periplasm. This observation fits with the purified protein which appears to have lost a 350
peptide as evident from the actual N-terminal sequencing of the protein (Figure 11a). 351
352
353
354
355
356
357
DISCUSSION 358
The bacterial myrosinase is of low abundance in comparison with plant and aphid myrosinases18, 20, 21
but 359
nonetheless is an active inducible enzyme (Figure 4). In contrast to both plant and insect myrosinases, 360
which appear to have a function in defence, the bacterial myrosinases are more likely to be involved in 361
scavenging glucose from glucosides. Citrobacter WYE1 is a soil microorganism which was isolated from 362
a field where oilseed rape had previously grown. The stubble and roots left in the field were ploughed 363
back into the soil which would consequently contain a significant amount of glucosinolate that would be 364
available for bacterial growth. It would seem therefore that bacteria can adapt35
to changes in the 365
environment, and it is likely that other soil bacteria will also have the ability of the Citrobacter WYE1 to 366
metabolise glucosinolates. This is of importance in the field of biofumigation with Brassicaceae crops 367
where glucosinolate metabolism can yield the bioactive isothiocyanates, and is key to the success of this 368
technology. Thus bacteria that degrade glucosinolates can potentially counter the effects of biofumigation 369
by decreasing the available glucosinolate, although at this stage more work is required to establish the 370
Page 16 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
17
products of hydrolysis in the soil.25, 36, 37
On the other hand, bacteria that can metabolise glucosinolates in 371
the human gut play a key role in the generation of the chemoprotective isothiocyanates.3, 28, 38
372
The Citrobacter WYE1 myrosinase belongs to the GH3 family of the glucosidases 9 and INTERPRO 373
analysis shows that the full length gene codes for a signal peptide, which presumably targets it to the 374
periplasm. In terms of sequence homology there is no resemblance to either plant or aphid myrosinases, 375
although there is high homology with other bacterial β-O-glucosidases (Figure 11b). A feature of the GH3 376
glucosidases is the conserved motif ‘SDW’ which contains aspartate as the nucleophile, as part of the 377
mechanism for hydrolysis.8, 39
The SWISS-MODEL webpage tools40
were used to generate models based 378
on available templates. The scores, however, were too low to obtain a meaningful model. With the GH3 379
glucosidases, the general acid/base catalytic component of the mechanism is much more variable and will 380
require structure determination to fully elucidate the mechanism, work that is currently underway. Recent 381
reports41
have suggested that E. coli 0157:H7 possesses 6-phospho-β-glucosidases (bglA and ascbB) and, 382
following gene disruption, the sinigrin degradation capacity of the bacteria is substantially diminished. 383
This result41
is supported by previous work7 where it was not possible to isolate myrosinase activity in 384
cell free extracts of bacteria, despite the production of isothiocyanates and nitriles during fermentation. A 385
differential proteomic study of E. coli VL8 with or without sinigrin did not reveal any glucosidase 386
associated with glucosinolate hydrolysis.33
A glucose-specific phosphotransferase system was however 387
induced, which suggests that glucosinolates may undergo phosphorylation at the 6-hydroxyl group of the 388
sugar residue. If this is the case, then it may well be that 6-phospho-β-glucosidases in cell free extracts 389
cannot recognize glucosinolates without prior phosphorylation or that they are membrane-bound and loss 390
of integrity results in loss of activity. This might explain why it has proven so difficult to show 391
myrosinase activity in cell free extracts of bacteria4, 28
that can metabolise glucosinolates, although 392
enzyme instability cannot be ruled out. Thus a synthesis, either chemical or chemoenzymatic42
, of a 6-393
phospho-glucosinolate would go some way to probing the mechanism of glucosinolate metabolism if 6-394
phospho-β-glucosidases are involved. Clearly at this time there are several potential distinct mechanisms 395
Page 17 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
18
for glucosinolate hydrolysis by bacteria that may involve phosphorylation, membrane-bound enzyme 396
systems and a more typical hydrolysis by a glucosidase as shown in our work. 397
It was not possible to identify the fermentation products at this time, although they were not any of the 398
usual glucosinolate hydrolysis products, i.e. nitrile, carboxylic acid, amine or thiocyanate (unpublished 399
data) that have been previously described.17, 18
Previous work43
has shown isothiocyanates to be unstable 400
over a period of 24 h in phosphate buffers, although cell free extracts of the Citrobacter WYE1 produce 401
isothiocyanates in citrate phosphate buffer. Of course, it may also be possible that Citrobacter WYE1 402
possesses a detoxification pathway. M9 media contain not just phosphate but also ammonium ions which 403
likely add to the possible interactions with ITCs. Thus at this stage it is not clear what the actual 404
degradation metabolites are in vivo and more work is required on this topic. In conclusion, this is the first 405
report to describe a fully characterized bacterial myrosinase in terms of its properties and sequence. 406
407
ACKNOWLEDGEMENTS 408
Abdul Albaser was funded by the Libyan Government and Vijitra Luang-In by the Royal Thai 409
Government. We thank Dr Arnoud Van Vliet of the Institute of Food Research, Norwich, UK for help 410
with the bioinformatics. 411
SUPPORTING INFORMATION 412
A table describing the FPLC programme for the ion exchange chromatography is shown in S1. 413
Figures for the qualitative GC-MS analysis of cell free extracts with sinigrin, glucoerucin, glucoraphanin, 414
glucotropaeolin, glucoraphanin and gluconasturtiin are shown in S2. This material is available free of 415
charge via the internet at http://pubs.acs.org. 416
417
418
Page 18 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
19
419
420
421
422
423
424
425
426
427
428
REFERENCES 429
(1) Tani, N.; Ohtsuru, M.; Hata, T., Studies on bacterial myrosinase .1. Isolation of myrosinase producing 430
microorganism. Agric. Biol. Chem. 1974, 38, 1617-1622. 431
(2) Tani, N.; Ohtsuru, M.; Hata, T., Studies on bacterial myrosinase .2. Purification and general 432
characteristics of bacterial myrosinase produced by enterobacter-cloacae. Agric. Biol. Chem. 1974, 38, 433
1623-1630. 434
(3) Saha, S.; Hollands, W.; Teucher, B.; Needs, P. W.; Narbad, A.; Ortori, C. A.; Barrett, D. A.; Rossiter, 435
J. T.; Mithen, R. F.; Kroon, P. A., Isothiocyanate concentrations and interconversion of sulforaphane to 436
erucin in human subjects after consumption of commercial frozen broccoli compared to fresh broccoli. 437
Mol. Nutr. Food Res. 2012, 56, 1906-1916. 438
(4) Palop, M. L.; Smiths, J. P.; Tenbrink, B., Degradation of sinigrin by lactobacillus-agilis strain r16. Int. 439
J. Food Microbiol. 1995, 26, 219-229. 440
Page 19 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
20
(5) Rabot, S.; Nugonbaudon, L.; Raibaud, P.; Szylit, O., Rapeseed meal toxicity in gnotobiotic-rats - 441
influence of a whole human fecal flora or single human strains of escherichia-coli and bacteroides-442
vulgatus. Br. J. Nutr. 1993, 70, 323-331. 443
(6) Nugonbaudon, L.; Rabot, S.; Wal, J. M.; Szylit, O., Interactions of the intestinal microflora with 444
glucosinolates in rapeseed meal toxicity - 1st evidence of an intestinal lactobacillus possessing a 445
myrosinase-like activity invivo. J. Sci. Food Agric. 1990, 52, 547-559. 446
(7) Luang-In, V., Influence of Human Gut Microbiota on the Metabolic Fate of Glucosinolates. PhD 447
Thesis, Imperial College London 2013. 448
(8) Ketudat Cairns, J. R.; Esen, A., beta-Glucosidases. Cell. Mol. Life. Sci. 2010, 67, 3389-405. 449
(9) Cantarel, B. L.; Coutinho, P. M.; Rancurel, C.; Bernard, T.; Lombard, V.; Henrissat, B., The 450
Carbohydrate-Active EnZymes database (CAZy): an expert resource for Glycogenomics. Nucleic Acids 451
Res. 2009, 37, D233-D238. 452
(10) Sansenya, S.; Opassiri, R.; Kuaprasert, B.; Chen, C.-J.; Cairns, J. R. K., The crystal structure of rice 453
(Oryza sativa L.) Os4BGlu12, an oligosaccharide and tuberonic acid glucoside-hydrolyzing beta-454
glucosidase with significant thioglucohydrolase activity. Arch. Biochem. Biophys. 2011, 510, 62-72. 455
(11) Mahn, A.; Angulo, A.; Cabanas, F., Purification and Characterization of Broccoli (Brassica oleracea 456
var. italica) Myrosinase (beta-Thioglucosidase Glucohydrolase). J. Agric. Food Chem. 2014, 62, 11666-457
11671. 458
(12) Burmeister, W. P.; Cottaz, S.; Driguez, H.; Iori, R.; Palmieri, S.; Henrissat, B., The crystal structures 459
of Sinapis alba myrosinase and a covalent glycosyl-enzyme intermediate provide insights into the 460
substrate recognition and active-site machinery of an S-glycosidase. Structure. 1997, 5, 663-675. 461
(13) Burmeister, W. P.; Cottaz, S.; Rollin, P.; Vasella, A.; Henrissat, B., High resolution x-ray 462
crystallography shows that ascorbate is a cofactor for myrosinase and substitutes for the function of the 463
catalytic base. J. Biol. Chem. 2000, 275, 39385-39393. 464
(14) Cottaz, S.; Henrissat, B.; Driguez, H., Mechanism-based inhibition and stereochemistry of 465
glucosinolate hydrolysis by myrosinase. Biochemistry. 1996, 35, 15256-15259. 466
Page 20 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
21
(15) Dosz, E. B.; Ku, K.-M.; Juvik, J. A.; Jeffery, E. H., Total Myrosinase Activity Estimates in Brassica 467
Vegetable Produce. J. Agric. Food Chem. 2014, 62, 8094-8100. 468
(16) Hanschen, F. S.; Lamy, E.; Schreiner, M.; Rohn, S., Reactivity and Stability of Glucosinolates and 469
Their Breakdown Products in Foods. Angew. Chem., Int. Ed. 2014, 53, 11430-11450. 470
(17) Bones, A. M.; Rossiter, J. T., The enzymic and chemically induced decomposition of glucosinolates. 471
Phytochemistry. 2006, 67, 1053-1067. 472
(18) Bones, A. M.; Rossiter, J. T., The myrosinase-glucosinolate system, its organisation and 473
biochemistry. Physiol. Plant. 1996, 97, 194-208. 474
(19) Pontoppidan, B.; Ekbom, B.; Eriksson, S.; Meijer, J., Purification and characterization of myrosinase 475
from the cabbage aphid (Brevicoryne brassicae), a brassica herbivore. Eur. J. Biochem. 2001, 268, 1041-476
1048. 477
(20) Jones, A. M. E.; Bridges, M.; Bones, A. M.; Cole, R.; Rossiter, J. T., Purification and 478
characterisation of a non-plant myrosinase from the cabbage aphid Brevicoryne brassicae (L.). Insect 479
Biochem. Mol. Biol. 2001, 31, 1-5. 480
(21) Jones, A. M. E.; Winge, P.; Bones, A. M.; Cole, R.; Rossiter, J. T., Characterization and evolution of 481
a myrosinase from the cabbage aphid Brevicoryne brassicae. Insect Biochem. Mol. Biol. 2002, 32, 275-482
284. 483
(22) Husebye, H.; Arzt, S.; Burmeister, W. P.; Hartel, F. V.; Brandt, A.; Rossiter, J. T.; Bones, A. M., 484
Crystal structure at 1.1 angstrom resolution of an insect myrosinase from Brevicoryne brassicae shows its 485
close relationship to beta-glucosidases. Insect Biochem. Mol. Biol. 2005, 35, 1311-1320. 486
(23) Higdon, J. V.; Delage, B.; Williams, D. E.; Dashwood, R. H., Cruciferous vegetables and human 487
cancer risk: epidemiologic evidence and mechanistic basis. Pharmacol. Res. 2007, 55, 224-236. 488
(24) Neubauer, C.; Heitmann, B.; Mueller, C., Biofumigation potential of Brassicaceae cultivars to 489
Verticillium dahliae. Eur. J. Plant Pathol. 2014, 140, 341-352. 490
Page 21 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
22
(25) Ngala, B. M.; Haydock, P. P. J.; Woods, S.; Back, M. A., Biofumigation with brassica juncea, 491
raphanus sativus and eruca sativa for the management of field populations of globodera pallida. J. 492
Nematol. 2014, 46, 210-211. 493
(26) Sotelo, T.; Lema, M.; Soengas, P.; Cartea, M. E.; Velasco, P., In Vitro Activity of Glucosinolates 494
and Their Degradation Products against Brassica-Pathogenic Bacteria and Fungi. Appl. Environ. 495
Microbiol. 2015, 81, 432-440. 496
(27) Taylor, F. I.; Kenyon, D.; Rosser, S., Isothiocyanates inhibit fungal pathogens of potato in in vitro 497
assays. Plant Soil. 2014, 382, 281-289. 498
(28) Luang-In, V.; Narbad, A.; Nueno-Palop, C.; Mithen, R.; Bennett, M.; Rossiter, J. T., The metabolism 499
of methylsulfinylalkyl- and methylthioalkyl- glucosinolates by a selection of human gut bacteria. Mol. 500
Nutr. Food Res. 2014, 58, 875-883. 501
(29) Nurk, S.; Bankevich, A.; Antipov, D.; Gurevich, A. A.; Korobeynikov, A.; Lapidus, A.; Prjibelski, 502
A. D.; Pyshkin, A.; Sirotkin, A.; Sirotkin, Y.; Stepanauskas, R.; Clingenpeel, S. R.; Woyke, T.; McLean, 503
J. S.; Lasken, R.; Tesler, G.; Alekseyev, M. A.; Pevzner, P. A., Assembling Single-Cell Genomes and 504
Mini-Metagenomes From Chimeric MDA Products. J. Comput. Biol. 2013, 20, 714-737. 505
(30) Treangen, T. J.; Ondov, B. D.; Koren, S.; Phillippy, A. M., The Harvest suite for rapid core-genome 506
alignment and visualization of thousands of intraspecific microbial genomes. Genome biology 2014, 15, 507
524. 508
(31) Huggett, A. S.; Nixon, D. A., Use of glucose oxidase, peroxidase, and O-dianisidine in determination 509
of blood and urinary glucose. Lancet (London, England). 1957, 273, 368-70. 510
(32) James, D. C.; Rossiter, J. T., Development and characteristics of myrosinase in brassica-napus during 511
early seedling growth. Physiol. Plant. 1991, 82, 163-170. 512
(33) Luang-In, V.; Narbad, A.; Cebeci, F.; Bennett, M.; Rossiter, J. T., Identification of Proteins Possibly 513
Involved in Glucosinolate Metabolism in L. agilis R16 and E. coli VL8. Protein J. 2015, 34, 135-46. 514
(34) Jones, P.; Binns, D.; Chang, H. Y.; Fraser, M.; Li, W.; McAnulla, C.; McWilliam, H.; Maslen, J.; 515
Mitchell, A.; Nuka, G.; Pesseat, S.; Quinn, A. F.; Sangrador-Vegas, A.; Scheremetjew, M.; Yong, S. Y.; 516
Page 22 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
23
Lopez, R.; Hunter, S., InterProScan 5: genome-scale protein function classification. Bioinformatics. 2014, 517
30, 1236-40. 518
(35) Diaz, E., Bacterial degradation of aromatic pollutants: a paradigm of metabolic versatility. Int. 519
Microbiol. 2004, 7, 173-180. 520
(36) Gimsing, A. L.; Kirkegaard, J. A., Glucosinolate and isothiocyanate concentration in soil following 521
incorporation of Brassica biofumigants. Soil Biol. Biochem. 2006, 38, 2255-2264. 522
(37) Gimsing, A. L.; Kirkegaard, J. A., Glucosinolates and biofumigation: fate of glucosinolates and their 523
hydrolysis products in soil. Phytochem. Rev. 2009, 8, 299-310. 524
(38) Mullaney, J. A.; Kelly, W. J.; McGhie, T. K.; Ansell, J.; Heyes, J. A., Lactic Acid Bacteria Convert 525
Glucosinolates to Nitriles Efficiently Yet Differently from Enterobacteriaceae. J. Agric. Food Chem. 526
2013, 61, 3039-3046. 527
(39) Withers, S. G., Mechanisms of glycosyl transferases and hydrolases. Carbohydrate Polymers 2001, 528
44, 325-337. 529
(40) Biasini, M.; Bienert, S.; Waterhouse, A.; Arnold, K.; Studer, G.; Schmidt, T.; Kiefer, F.; Cassarino, 530
T. G.; Bertoni, M.; Bordoli, L.; Schwede, T., SWISS-MODEL: modelling protein tertiary and quaternary 531
structure using evolutionary information. Nucleic Acids Res. 2014, 42, W252-W258. 532
(41) Cordeiro, R. P.; Doria, J. H.; Zhanel, G. G.; Sparling, R.; Holley, R. A., Role of glycoside hydrolase 533
genes in sinigrin degradation by E. coli O157:H7. Int. J. Food Microbiol. 2015, 205, 105-111. 534
(42) Thompson, J.; Lichtenthaler, F. W.; Peters, S.; Pikis, A., beta-glucoside kinase (BglK) from 535
Klebsiella pneumoniae - Purification, properties, and preparative synthesis of 6-phospho-beta-D-536
glucosides. J. Biol. Chem. 2002, 277, 34310-34321. 537
(43) Mays, J. R.; Roska, R. L. W.; Sarfaraz, S.; Mukhtar, H.; Rajski, S. R., Identification, synthesis, and 538
enzymology of non-natural glucosinolate chemopreventive candidates. ChemBioChem. 2008, 9, 729-747. 539
540
541
Page 23 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
24
542
543
544
545
546
547
548
549
550
551
Figure Legends. 552
Figure 1. Generalised scheme of the hydrolysis of glucosinolates by myrosinase. RNCS, isothiocyanate; 553
RCN, nitrile; RSCN, thiocyanate; ETN, epithionitriles. 554
Figure 2. Phylogenetic tree of Citrobacter WYE1 compared with related Citrobacter species. Draft 555
genomes of Citrobacter species were obtained from Genbank WGS projects (accession prefix 556
supplied). Core genome single nucleotide polymorphisms (SNPs) in draft genomes were used to 557
prepare the phylogenetic tree using the parSNP program. 558
Figure 3. The metabolism of sinigrin (10 mM) in M9 media by Citrobacter WYE1 over 24 h. The 559
metabolism of sinigrin was monitored by HPLC and OD600nm recorded. 560
Page 24 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
25
Figure 4. The induction of myrosinase activity in cultures grown with sinigrin. Cell free protein extracts 561
were prepared as described in the methods and assayed for myrosinase activity with 5 µg of crude 562
desalted protein extract/assay. 563
Figure 5. The effect of temperature on the activity of the Citrobacter WYE1 myrosinase was measured 564
over a range of temperatures (5-70 ºC). Assays were carried out as described in the methods with 5µg 565
crude cell free protein. 566
Figure 6. The pH optimisation of the enzymatic degradation of sinigrin. Crude protein extract (5 µg) was 567
added to a mixture of sinigrin (2 mM) in CPB to a final volume of 300 µL at specific pH values over the 568
range 3.6 -7.6 and incubated at 37 °C for 2 h. Activity was measured by determining the release of 569
glucose using the GOD-PERID assay. 570
Figure 7. The enzymatic degradation of a range of glucosinolates (10 mM) in CPB. Activity was 571
measured by determining the release of glucose using the GOD-PERID assay. 572
Figure 8. The effect of differing concentrations of ascorbate on the enzymatic activity of myrosinase. 573
Activity was determined by monitoring the production of phenethylisothiocyanate using GC-MS. ● = 574
ascorbate, ■ = control. 575
Figure 9. The determination of the apparent Km and Vmax of the myrosinase. 576
Figure 10. SDS PAGE analysis of the purification steps of Citrobacter WYE1 myrosinase; M= marker; 577
IE1= Ion exchange first run; IE2= Ion exchange second run; GF= gel filtration fraction of pure 578
myrosinase at 66 kDa. Gels were washed three times with MilliQ H2O (100 mL) and stained with 579
SimplyBlue SafeStain (Invitrogen LC6060) for an hour and destained in MilliQ H2O. 580
Figure 11a. Full length protein based on the first ORF derived from the annotated gene. Putative signal 581
peptide is underlined, N-terminal sequence in bold and italics and internal peptide sequence in bold type. 582
Figure 11b. BLAST search results of the Citrobacter WYE1 showing the homology with a range of 583
bacterial β-O-glucosidases. The signature ‘SDW’ of the GH3 glucosidases is highlighted. 584
Page 25 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
26
585
586
587
588
589
590
591
592
593
594
595
596
597
Page 26 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
27
Purification step
Volume
(mL)
Protein
(mg)
Specific activity
(nmole/mg
protein/min)
Total
activity
Crude extract 10 40 611 24,444
Ion exchange 1st (Mono Q
column ) 2.5 0.775 1111 861
Ion exchange 2nd (Mono Q
column ) 0.5 0.05 593 29.6
Gel filtration (Superdex 75
column) 0.35 0.0045 2686 12.1
Table 1 Summary of the purification steps of Citrobacter myrosinase. Activity assays were carried out
with sinigrin (10 mM) at 25°C (pH 6.0, CPB 20 mM) and are based on glucose release (GOD-Perid assay).
Page 27 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
28
Figure 1
Page 28 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
29
Figure 2
Page 29 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
30
Figure 3
h
0 4 8 12 16 20 24 28
0
20
40
60
80
100
0.0
0.2
0.4
0.6
0.8
Page 30 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
31
Figure 4
Page 31 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
32
Figure 5
Page 32 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
33
Figure 6
Page 33 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
34
Figure 7
Page 34 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
35
Figure 8
Page 35 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
36
Figure 9
Page 36 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
37
Figure 10
Page 37 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
38
MLTAFKMNTVSLAVLVCLPLSVSASIQSAQQPELGYDTVPLLHLSGLSFKDLNRDGKLNPYEDWRLSPQTRAADLVKRMSVAEKAGVM
MHGTAPAEGSTFGNGSVYDSEATRKMVVDAHVNSLITRLNGEEPARLAEQNNMIQKTAETTRLGIPVTISTDPRNSYQALVGISNPAGK
FTQWPEAIGLGAAGSEALAQEYADHVRREYRAVGITEALSPQADITTEPRWARISGTFGEDPELAKKLVRGYITGMQKGGQGLNPQSV
AAVVKHWVGYGAAEDGWDGHNAYGKHTVLSNESLQKHIIPFRGAFEANVAAVMPTYSVMKGVTWNGRETEQVAAGFSHFLLTDLL
RKQNNFSGVIISDWLITNDCDDECVNGSAPGKKPVAGGMPWGVESLSKERRFVKAVNAGIDQFGGVTDSAVLVTAVEKGLITQARLDA
SVERILQQKFELGLFEQPYVDAKLAEKIVGAPDTKKAADDAQFRTLVLLQNKNILPLKPGTKVWLYGADKSAAEKAGLEVVSEPEDAD
VALMRTSAPFEQPHYNYFFGRRHHEGSLEYREDNKDFAVLKRVSKHTPVIMTMYMERPAVLTNVTDKTSGFIANFGLSDEVFFSRLTSD
TPYTARLPFALPSSMASVLKQKSDEPDDLDTPLFQRGFGLTR
Figure 11a
Figure 11b
361 420Citrobacter WYE1 VIISDWLITNDCDDECVNGSAPGKKPVAGGMPWGVESLSKERRFVKAVNAGIDQFGGVTD Enterobacter cloacae β-glucosidase(70%) LIISDWLITADCDEECVNGTTGDKKPVPGGMPWGVEHLSKEQRFVKAVNAGIDQFGGVTD
Citrobacter sp.30_2 hypothetical protein(71%) VIISDWLITNDCDDECIHGAPGGKKPVTGGMPWGVESLTQEQRFVKAVQAGIDQFGGVTD Escherichia vulneris β-glucosidase (72%) VIISDWLITNDCDNECLNGAPEGKKPVTGGMPWGVESLTKEQRFVKAIHAGIDQFGGVTD
Rahnella aquatilis β-glucosidase VILSDWLITSNCEGECLNGSPEGKEPVPGGMPWGVENLTPQQRFVKAVLAGVDQFGGVTN Pectobacterium carotovorum β-glucosidase(60%) VILSDWLITNDCKDDCVTGAKPNEKPVPRGMPWGVENLTVEQRFIKAVEAGVDQFGGVTN
Serratia sp 1,4- β-xylosidase (61%) VILSDWLITQDCKADCINGFKPGEKPVPRGMPWGVEHMTVDQRFIQAVKAGIDQFGGVTD Dickeya solani β-xylosidase periplasmic (61%) VILSDWLITNDCKGDCLTGVKPGEKPVPRGMPWGVENLTPAERFIKAVNAGVDQFGGVTD
Page 38 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry
Table of Contents Graphic
334x202mm (96 x 96 DPI)
Page 39 of 39
ACS Paragon Plus Environment
Journal of Agricultural and Food Chemistry