Upload
others
View
6
Download
0
Embed Size (px)
Citation preview
The Science & Business of BiopharmaceuticalsBioPharmINTERNATIONAL
September 2019
Volume 32 Number 9
PUTTING BIOPHARMA STABILITY TESTING UNDER
THE MICROSCOPE
www.biopharminternational.com
UPSTREAM PROCESSINGCELL-CULTURE ADVANCES
TEST BIOREACTOR PERFORMANCE MODELS
CELL AND GENE THERAPIESSEEKING SOLUTIONS FOR LARGE-SCALE GMP VIRAL
VECTOR MANUFACTURING
BIOSIMILARSMETHODS
ACCELERATE BIOSIMILAR ANALYSIS
www.biopharminternational.com
PUTTING BIOPHARMA STABILITY TESTING UNDER
THE MICROSCOPE
Discover more at www.yourway.com
The Only Truly Integrated Premium Courier & Clinical Packager.
Why Yourway?
+
ES113838_BP0919_CVTP1_FP.pgs 08.29.2019 03:12 UBM blackyellowmagentacyan
FOR PERSONAL, NON-COMMERCIAL USE
Yourway is headquartered in Allentown, Pennsylvania, close to three
major international airports. Global strategic locations enable us to
efficiently get your clinical materials around the world in hours, not
days. Our European headquarters is situated within Heathrow Airport
Industrial Park. With 21 GMP depots worldwide, we are among a small
handful of companies with the resources to independently handle all
aspects of your clinical trial.
Global Reach With
Our GMP Depot
Network
Discover more at www.yourway.com
ES113839_BP0919_CVTP2_FP.pgs 08.29.2019 03:12 UBM blackyellowmagentacyan
FOR PERSONAL, NON-COMMERCIAL USE
The Science & Business of Biopharmaceuticals
BioPharmINTERNATIONAL
Bio
Ph
arm
Inte
rn
atio
nal
Sep
tem
ber 2
019
A
naly
tical M
eth
od
s I Co
nta
iner C
losu
re In
teg
rity I P
roce
ss Ch
rom
ato
gra
ph
y
Vo
lum
e 3
2 N
um
ber 9
September 2019
Volume 32 Number 9
PUTTING BIOPHARMA STABILITY TESTING UNDER
THE MICROSCOPE
www.biopharminternational.com
UPSTREAM PROCESSING
CELL-CULTURE ADVANCES
TEST BIOREACTOR
PERFORMANCE MODELS
CELL AND GENE THERAPIES
SEEKING SOLUTIONS FOR
LARGE-SCALE GMP VIRAL
VECTOR MANUFACTURING
BIOSIMILARS
METHODS
ACCELERATE
BIOSIMILAR ANALYSIS
www.biopharminternational.com
PUTTING BIOPHARMA STABILITY TESTING UNDER
THE MICROSCOPE
FOR PERSONAL, NON-COMMERCIAL USE
“The answer we were pursuing was right here inside my body.”
No two cancers are alike. The same goes for cancer treatments. Innovative immunotherapies
like CAR-T can now reprogram patients’ immune systems to destroy the disease.
Fighting cancer has never been more personal. This is the future of medicine. For all of us.
Innovation.org
Boris / CAR-T Researcher Justin / CAR-T Patient
FOR PERSONAL, NON-COMMERCIAL USE
INTERNATIONAL
BioPharmThe Science & Business of Biopharmaceuticals
© 2019 MJH Life SciencesTM All rights reserved. No part of this publication may be reproduced or transmitted in any form or by any means, electronic or mechanical including by photocopy, recording, or information storage and retr ieval without permission in writing from the publisher. Authorization to photocopy items for internal/educational or personal use, or the internal/educational or personal use of specific clients is granted by MJH Life SciencesTM for libraries and other users registered with the Copyright Clearance Center, 222 Rosewood Dr. Danvers, MA 01923, 978-750-8400fa x 978-646-8700 or v is i t h t tp: //w w w.copyr ight .com onl ine. For uses beyond those l i s ted above, p lease d i rec t your wr i t ten reques t to Permiss ion Dept . Alexa Rockenstein, [email protected].
MJH Life SciencesTM provides certain customer contact data (such as customers’ names, addresses, phone numbers, and e-mail addresses) to third parties who wish to promote relevant products, services, and other opportunities that may be of interest to you. If you do not want MJH Life SciencesTM to make your contact information available to third parties for marketing purposes, simply call toll-free 866-529-2922 between the hours of 7:30 a.m. and 5 p.m. CST and a customer service representative will assist you in removing your name from MJH Life SciencesTM’ lists. Outside the U.S., please phone 218-740-6477.
BioPharm International does not verify any claims or other information appearing in any of the advertisements contained in the publication, and cannot take responsibility for any losses or other damages incurred by readers in reliance of such content.
BioPharm International welcomes unsolicited articles, manuscripts, photographs, illustrations, and other materials but cannot be held responsible for their safekeeping or return.
To subscribe, call toll-free 888-527-7008. Outside the U.S. call 218-740-6477.
ADVERTISING
Publisher Mike Tracey [email protected]
National Sales Manager Scott Vail [email protected]
European Sales Manager Linda Hewitt [email protected]
European Senior Sales Executive Stephen Cleland [email protected]
VP/Managing Director, Pharm/Science Group Dave Esola [email protected]
C.A.S.T. Data and List Information Michael Kushner [email protected]
PRODUCTION
Production Manager Jesse Singer [email protected]
AUDIENCE DEVELOPMENT
Audience Development Christine Shappell [email protected]
MJH LIFE SCIENCES
Chairman and CEO Mike Hennessy, Sr
Vice Chairman Jack Lepping
President Mike Hennessy, Jr
Chief Strategy Officer & President, Agency Services George Glatcz
Chief Accounting Officer David Brennan
Chief Financial Officer Neil Glasser, CPA/CFE
Executive Vice President, Operations Tom Tolvé
Senior Vice President, Content Silas Inman
Senior Vice President, I.T. & Enterprise Systems John Moricone
Senior Vice President, Development & Enterprise Systems JP Uva
Senior Vice President, Audience Generation & Product Fulfillment Joy Puzzo
Vice President, Human Resources & Administration Shari Lundenberg
Vice President, Business Intelligence Chris Hennessy
Vice President, Corporate Branding & B2B Marketing Amy Erdman
Executive Creative Director, Creative Services Jeff Brown
Licensing and Reuse of Content: Contact our official partner, Wright’s Media,
about available usages, license fees, and award seal artwork at
[email protected] for more information. Please note that
Wright’s Media is the only authorized company that we’ve partnered
with for MJH Life SciencesTM materials.
K. A. Ajit-SimhPresident, Shiba Associates
Madhavan BuddhaFreelance Consultant
Rory BudihandojoDirector, Quality and EHS Audit
Boehringer-Ingelheim
Edward G. CalamaiManaging Partner
Pharmaceutical Manufacturing
and Compliance Associates, LLC
Suggy S. ChraiPresident and CEO
The Chrai Associates
Leonard J. GorenGlobal Leader, Human IdentityDivision, GE Healthcare
Uwe GottschalkVice-President,
Chief Technology Officer,
Pharma/Biotech
Lonza AG
Fiona M. GreerGlobal Director,
BioPharma Services Development
SGS Life Science Services
Rajesh K. GuptaVaccinnologist and Microbiologist
Denny KraichelyAssociate Director
Johnson & Johnson
Stephan O. KrauseDirector of QA Technology
AstraZeneca Biologics
Steven S. KuwaharaPrincipal Consultant
GXP BioTechnology LLC
Eric S. LangerPresident and Managing Partner
BioPlan Associates, Inc.
Howard L. LevinePresident
BioProcess Technology Consultants
Hank LiuHead of Quality Control
Sanofi Pasteur
Herb LutzPrincipal Consulting Engineer
Merck Millipore
Hanns-Christian MahlerHead Drug Product ServicesLonza AG
Jerold MartinIndependent Consultant
Hans-Peter MeyerLecturer, University of Applied Sciences and Arts Western Switzerland, Institute of Life Technologies
K. John MorrowPresident, Newport Biotech
David RadspinnerGlobal Head of Sales—BioproductionThermo Fisher Scientific
Tom RansohoffVice-President and Senior Consultant
BioProcess Technology Consultants
Anurag RathoreBiotech CMC Consultant
Faculty Member, Indian Institute of
Technology
Susan J. SchnieppExecutive Vice President of
Post-Approval Pharma
and Distinguished Fellow
Regulatory Compliance Associates, Inc.
Tim SchofieldConsultant
CMC Sciences, LLC
Paula ShadlePrincipal Consultant,
Shadle Consulting
Alexander F. SitoPresident,
BioValidation
Michiel E. UlteePrincipal
Ulteemit BioConsulting
Thomas J. Vanden BoomVP, Biosimilars Pharmaceutical Sciences
Pfizer
Krish VenkatManaging Partner
Anven Research
Steven WalfishPrincipal Scientific Liaison
USP
EDITORIAL ADVISORY BOARDBioPharm International’s Editorial Advisory Board comprises distinguished
specialists involved in the biologic manufacture of therapeutic drugs,
diagnostics, and vaccines. Members serve as a sounding board for the
editors and advise them on biotechnology trends, identify potential
authors, and review manuscripts submitted for publication.
EDITORIAL
Editorial Director Rita Peters [email protected]
Senior Editor Agnes M. Shanley [email protected]
Managing Editor Susan Haigney [email protected]
European Editor Felicity Thomas [email protected]
Science Editor Feliza Mirasol [email protected]
Manufacturing Editor Jennifer Markarian [email protected]
Assistant Editor Lauren Lavelle [email protected]
Art Director Dan Ward [email protected]
FOR PERSONAL, NON-COMMERCIAL USE
Table of Contents
4 BioPharm International September 2019 www.biopharminternational.com
BioPharm International is selectively abstracted or indexed in: • Biological Sciences Database (Cambridge Scientifi c Abstracts) • Biotechnology and Bioengineering Database (Cambridge Scientifi c Abstracts) • Biotechnology Citation Index (ISI/Thomson Scientifi c) • Chemical Abstracts (CAS) • Science Citation Index Expanded (ISI/Thomson Scientifi c) • Web of Science (ISI/Thomson Scientifi c)
BioPharm International ISSN 1542-166X (print); ISSN 1939-1862 (digital) is published monthly by MJH Life SciencesTM 325 W. First Street, STE 300 Duluth, MN 55802. Subscription rates: $76 for one year in the United States and Possessions; $103 for one year in Canada and Mexico; all other countries $146 for one year. Single copies (prepaid only): $8 in the United States; $10 all other countries. Back issues, if available: $21 in the United States, $26 all other countries. Add $6.75 per order for shipping and handling. Periodicals postage paid at Duluth, MN 55806, and additional mailing offi ces. Postmaster Please send address changes to BioPharm International, PO Box 6128, Duluth, MN 55806-6128, USA. PUBLICATIONS MAIL AGREEMENT NO. 40612608, Return Undeliverable Canadian Addresses to: IMEX Global Solutions, P. O. Box 25542, London, ON N6C 6B2, CANADA. Canadian GST number: R-124213133RT001. Printed in U.S.A.
FEATURES
UPSTREAM PROCESSINGCell-Culture Advances Test Bioreactor Performance ModelsCynthia A. ChallenerThe evolution of cell-culture technology is driving the need for
improvements in modeling solutions. . .22
CELL AND GENE THERAPIESSeeking Solutions for Large-Scale GMP Viral Vector ManufacturingCynthia A. ChallenerInnovation in manufacturing technologies must occur to ensure the availability of
gene and cell therapies. . . . . . . . . . . . .26
QUALITYBest Practices for Studying Stability in BiologicsSusan HaigneyIndustry experts discuss the challenges and regulations of setting up a CGMP-
compliant stability testing program. . .30
BIOSIMILARSMethods Accelerate Biosimilar AnalysisMario DiPaola and Indu JaveriEffective application of mass-spectrometry tools can optimize biosimilar analysis, reducing
development time and cost. . . . . . . . .34
ANALYTICAL METHODSImproving Oligonucleotide AnalysisAnjali AlvingOligonucleotides, which are classified as both small molecules and biomolecules, pose unique analytical challenges. High-resolution mass spectrometry is becoming a method of choice for their
development. . . . . . . . . . . . . . . . . . . . .40
OPERATIONSContainer Closure Integrity Testing of Finished Sterile Injectable ProductDerek DuncanAs regulatory guidance has changed, so too has CCIT testing. In this article, possible CCIT strategy approaches are
outlined. . . . . . . . . . . . . . . . . . . . . . . . .44
DOWNSTREAM PROCESSINGWhat’s New in Manufacturing: Process ChromatographyLauren LavelleThe latest advances in process chromatography include pre-packed chromatography columns, process characterization kits, fast protein liquid chromatography systems,and mixed-
mode chromatography resins. . . . . . . .47
COLUMNS AND DEPARTMENTS
FROM THE EDITOR
The editors welcome
technical article contributions
from biopharma industry experts.
Rita Peters. . . . . . . . . . . . . . . . . . . . . . . . .6
REGULATORY BEAT
Industry and regulators seek global
system that reduces regional differences.
Jill Wechsler . . . . . . . . . . . . . . . . . . . . . .8
PERSPECTIVES ON OUTSOURCING
CDMOs are adding facilities and services
to their portfolios in anticipation of the
biologics industry’s continued growth.
Susan Haigney . . . . . . . . . . . . . . . . . . . .12
NEW TECHNOLOGY SHOWCASE . . . .49
AD INDEX . . . . . . . . . . . . . . . . . . . . . . . .49
ASK THE EXPERT
Providing regulators with a holistic
approach to addressing deficiencies is
the best response to an inspection.
Siegfried Schmitt . . . . . . . . . . . . . . . . . .50
COVER STORY
16 Putting Biopharma Stability Testing Under the MicroscopeStability testing for biologics is more complex than for small-molecule drugs, so companies should be aware of the potentially serious issues that can be costly and jeopardize drug development.
Cover Design by Maria ReyesImages: kkolosov/Stock.Adobe.com
BioPharm International integrates the science and business of biopharmaceutical research, development, and manufacturing. We provide practical, peer-reviewed technical solutions to enable biopharmaceutical professionals to perform their jobs more effectively.
FOR PERSONAL, NON-COMMERCIAL USE
The Foundations for
Single-Use Manufacturing.
Redefined from A–Z.
In the past, biopharma companies were struggling with various risk
factors which kept them from implementing single-use solutions.
With our solid single-use foundation for biomanufacturing processes
we are solving all of these challenges simultaneously. Our fully
integrated single-use platform connects an exclusive approach in
biocompatibility, state-of-the-art integrity control and testing as
well as a unique automation platform and supply network.
This strategy provides flexibility and acceleration which leads to
a cost-effective process that ensures the quality of your biologics
and enhances patient safety.
www.sartorius.com/single-use-redefined
FOR PERSONAL, NON-COMMERCIAL USE
6 BioPharm International www.biopharminternational.com September 2019
From the Editor
Rita Peters is the
editorial director of
BioPharm International.
The editors
welcome
technical article
contributions
from biopharma
industry experts.
Plan Now to Share Your Expertise in 2020
September—the traditional back-to-school time—has arrived, and the annual
holiday shopping season is sure to follow quickly. Personally, I don’t like rush-
ing the holidays and shop at the last minute. The publishing profession, how-
ever, forces me to plan and work well ahead of the calendar.
While we have yet to enter the last quarter of 2019, the editorial team is look-
ing ahead to 2020, planning topics, special issues, and features that BioPharm
International will cover next year. It is also prime time to remind readers of the
opportunities to share knowledge about bioprocessing by contributing a technical
article or peer-review paper to the publication.
Through peer-reviewed papers, technical articles, technology reports, regulatory
and business columns, and expert commentary, BioPharm International publishes
objective information related to process and formulation development, manufactur-
ing, analytics, drug delivery, and business development topics in print magazines,
digital publications, ebooks, and online at www.BioPharmInternational.com.
Ways to contributePeer-review papers are a vital part of BioPharm International’s coverage of scientific
and technical advances in biopharmaceutical development and manufacturing. Four
types of peer-review papers are considered: standard data-driven, novel research;
topical literature or patent review; technical case studies/technical application notes;
and science-based opinion papers. Manuscripts for peer-review papers are accepted
and reviewed on an ongoing basis; papers are published in the order in which they
are accepted by the editorial advisory board.
BioPharm International editors also welcome technical articles that are not peer-
reviewed from experts at bio/pharmaceutical companies, regulatory authorities,
industry suppliers, and consultants. The magazine’s editorial calendar lists the top-
ics scheduled for the monthly print issues, supplements, ebooks, or online at www.
BioPharmInternational.com. All submissions are reviewed and edited by the editorial
team; final publication is determined by the editors.
Ideas for contributions should be discussed with the editors four months prior to
the publication date. The editors will review an abstract (250 words) describing the
article focus and other details. If the topic is suitable, a word count—typically 1800–
2000 words—and deadline are assigned. Final articles, figures, and signed license
agreements are due approximately two months prior to publication.
The article/paper must be objective and cannot promote a company or its prod-
ucts. It must be original and submitted to BioPharm International on an exclusive
basis. And, all authors must sign a license agreement that provides BioPharm
International permission to publish the original article and its associated figures/
tables in print and online.
Share your knowledgeThe editors also interview industry experts from biopharma companies, contract ser-
vice providers, industry suppliers, regulatory authorities, and consulting groups for
technical articles on drug development and manufacturing topics. And, similar to
contributed articles, responses to questions must be objective and non-promotional.
To be considered for an interview, consult the editorial calendar for scheduled topics
and contact the editors approximately four months prior to the publication date.
Learn moreBioPharm International’s 2020 editorial calendar, which lists topics scheduled
for publication next year, plus sample articles, and an online form to submit an
article idea to the editors are available on the Submission Guidelines page on
www.BioPharmInternational.com. X
FOR PERSONAL, NON-COMMERCIAL USE
November 21st 2019
The Oitavos
Lisbon/Cascais, Portugal
Eppendorf® and the Eppendorf Brand Design are registered trademarks of Eppendorf AG, Germany. All rights reserved, including graphics and images. Copyright © 2019 by Eppendorf AG.
Poster Session with Poster Prize / Abstract Submission and Registration on www.stemcellday.de
Bioprocessing Technologies in Stem Cell ResearchChaired by Paula Alves, PhD CEO of iBET (Instituto de Biologia Experimental e Tecnológica, Oeiras, Portugal)
Sessions
> Challenges in Bioprocess Engineering and
Scale-Up of Stem Cell Culture
> Process Controls and Analytics
> Successful Translation and Commercialization
Early-Morning-Workshop
with Dr. Robert Zweigerdt (Hannover Medical School)
and Dr. Philipp Nold (Eppendorf AG)
»Introduction to Stem Cell Bioprocessing –
Lineage-directed Differentiation of
Human Pluripotent Stem Cells in Stirred Bioreactors«
Lisbon 2019
www.stemcellday.de or [email protected]
FOR PERSONAL, NON-COMMERCIAL USE
8 BioPharm International www.biopharminternational.com September 2019
Regulatory Beat
Vis
ion
so
fAm
eri
ca
/Jo
e S
oh
m/G
ett
y I
ma
ge
s
Regulatory officials in the United States,
Europe, and other regions are collabo-
rating with manufacturers to advance a
new framework for managing chemistry, manu-
facturing, and controls (CMC) changes more
efficiently across the product lifecycle. The
process is outlined in the Q12 guideline devel-
oped by an expert working group formed under
the International Council for Harmonization
(ICH) (1). ICH is expected to approve a revised
core Q12 guideline at the November 2019 ICH
meeting in Singapore, along with more detailed
annexes and a global training plan for industry
and regulators.
Support for a harmonized approach for
authorizing new manufacturing and testing
methods on approved drugs and biologics
reflects general agreement on a risk-based sys-
tem for categorizing and managing changes,
despite continuing differences among authori-
ties over specifics for reduced oversight of cer-
tain variations. In the works formally since
2014, the Q12 guideline is expected to provide
flexible oversight of post-approval changes with
reduced regulatory reporting for manufacturers
able to demonstrate enhanced knowledge about
product, manufacturing process, and
analytical procedures, as provided by
a company’s product quality system
(PQS).
A key feature of Q12 outlines how
manufacturers should define those
established conditions (ECs) that are
considered necessary to assure prod-
uct quality. Thus, a change to an EC
would require a regulatory submis-
sion, explained Chikako Torigoe, biol-
ogist in the office of the director of
FDA’s Center for Biologics Evaluation
and Research (CBER). At the same
time, those parameters that have less
risk of impacting product quality or process
consistency would not be considered ECs and
could be managed by a manufacturer’s internal
PQS and implemented without prior approval,
Torigoe noted at the July 2019 CMC Forum
sponsored by CASSS (2).
Manufacturers may reduce ECs requiring
regulatory approval through development and
submission of a post-approval change man-
agement protocol (PACMP) that describes
anticipated changes to a product or products.
The PACMP would provide the basis for agree-
ment between the applicant and regulatory
authority about information required to sup-
port certain changes. PACMPs could involve
multiple products, as with establishing a new
process to improve product sterility assurance,
upgrades to a vial wash room, or introduc-
ing a new product to a manufacturing facil-
ity. FDA is launching a pilot program to gain
experience in assessing proposed ECs, with
the aim of reviewing nine submissions of new
drugs, generics, and biotech products to see
how much time and effort is involved in identi-
fying ECs at time of approval.
An approach similar to Q12 already has been
established in Japan, pointed out Tomonori
Nakagawa, API project manager at Otsuka
More Predictable Post-Approval Change Policy on Horizon Industry and regulators seek global system that reduces regional differences.
Jill Wechsler
is BioPharm International’s
Washington editor,
It can take four to six years
to add a new site or comply
with a new standard for a
product that is approved
and distributed globally.
FOR PERSONAL, NON-COMMERCIAL USE
Quality goes up.
Headaches go down.
Quality isn't just a box you check. It’s not limited to a process or even a department. It’s the
ultimate differentiator. The MasterControl Platform helps you digitize, automate and connect critical
processes, documents and data so you can improve quality across your entire product life cycle.
Explore how quality changes everything at www.mastercontrol.com
FOR PERSONAL, NON-COMMERCIAL USE
10 BioPharm International www.biopharminternational.com September 2019
Regulatory BeatRegulatory Beat
Pharmaceutical Co., at the CASSS
Forum. This initiative by Japan’s
Pharmaceuticals and Medical
Devices Agency (PMDA) has pro-
duced a more efficient program for
overseeing a robust change man-
agement system, he noted, based
on a demonstration of product and
process knowledge. And Health
Canada is ready to implement ICH
Q12, reported senior regulatory sci-
entist Anthony Ridgway at Health
Canada’s Biologics & Genetic
Therapies Directorate. That agency
has issued guidance on categories,
conditions, and data expected for
different reporting categories, and
policies already are aligned to pro-
vide flexibility in defining ECs
and in justifying reduced report-
ing. Health Canada encourages
adoption of risk-based categoriza-
tion of post-approval changes that
require only notification or listing
in an annual report, Ridgway said,
adding that more work is needed
to better define and align with
ICH recommendations for PACMPs.
Kavita Vyas, policy lead in the
Office of Policy for Pharmaceutical
Quality in the Center for Drug
Evaluation and Research (CDER),
described ongoing FDA efforts to
prepare to meet Q12 challenges.
An agency group is examining
case studies related to established
conditions and anticipates gaining
useful learnings from the upcom-
ing pilot project. Alexey Khrenov,
senior staff fellow at CBER’s Office
of Tissues and Advanced Therapies
(OTAT), noted that training is
being developed to familiarize
reviewers with Q12 approaches.
Greater regulatory f lexibi l ity
should benefit manufacturers, he
commented, although the specif-
ics for defining ECs and for assess-
ing PACMP and product lifecycle
management (PLCM) documents
remains uncertain.
ENCOURAGING IMPROVEMENTDespite the challenges, manufac-
turers hope to move forward with
Q12 as more products are tested,
produced, and dist r ibuted in
multiple regions, creating com-
plex supply chains that trigger
diverse testing requirements and
inspection processes. It can take
four to six years to add a new site
or comply with a new standard
for a product that is approved
and distributed globally, noted
Nakagawa. Similarly, consultant
Moheb Nasr, formerly with FDA
and Amgen, described how the
current system discourages firms
from adopting more efficient lab-
oratory test methods and modern
production systems.
Many manufacturers look to
advance strategies for managing
CMC changes under the firm’s
PQS, as supported by a series of
earlier ICH quality guidelines (Q8–
11). Leslie Bloom, executive direc-
tor of regulatory CMC at Pfizer,
described efforts to develop PLCM
plans to manage ECs over the
product lifecycle even before Q12
is finalized. And ongoing efforts
aim to provide more justification
for a range of risks related to ECs
and non-ECs, especially in process
and analytical methods.
K imberly Wolfram, director
of global regulatory affairs CMC
at Biogen, described herself as a
“realist” in anticipating the bene-
fits from Q12 after years of effort.
While she hopes for less confu-
sion in regional adoption of ECs
and guidelines, she and others
acknowledge challenges in gain-
ing global alignment on change
management protocols based on
risk assessment to enhance access
to therapies.
REFERENCES 1. ICH, Q12, Technical and Regulatory
Considerations for Pharmaceutical
Product Lifecycle Management, Step
2 (ICH, Nov. 16, 2017), www.ich.org/
fileadmin/Public_Web_Site/ICH_
Products/Guidelines/Quality/Q12/
Q12_Draft_Guideline_
Step2_2017_1116.pdf.
2. CASSS, “The Future of Post-approval
Changes is Coming–Are You Ready
for ICH Q12?” Conference
(Gaithersburg, MD, July 2019). X
FDA Publishes Guidance on Rare Pediatric Disease Priority Review
On July 30, 2019, FDA issued draft guidance that answers
questions regarding priority review vouchers for certain
rare pediatric disease treatments that meet criteria of
the Food, Drug, & Cosmetic Act (FD&C Act). As part
of the FD&C Act, FDA may give special incentives to
companies for the development of treatments for rare
pediatric diseases. This draft guidance revises a previous
draft guidance and clarifies the qualifications and process
for requesting priority review vouchers.
Specifically, the guidance gives detailed answers to
questions regarding the definition of a rare pediatric disease,
eligibility requirements, a sponsor’s responsibilities after
approval of an application, designation information requests,
the submission process, marketing applications, and use and
transfer of a rare pediatric disease priority review voucher. The
guidance also discusses drug-drug combinations, previously
approved drugs, and orphan drug designation questions.
—The Editors of BioPharm International
FOR PERSONAL, NON-COMMERCIAL USE
2019 PDA Quality WeekMastering Risk Management for Organizational Success
pda.org/2019QualityWeek
DECEMBER 9-13 | WASHINGTON, DC
EXHIBITION: DEC. 9-11
RISK MANAGEMENT IN THE REGULATORY LANDSCAPE CONFERENCE: DEC. 9-10
BUILDING A FOUNDATION AND CULTURE FOR QUALITY RISK MANAGEMENT INTEGRATION WORKSHOP: DEC. 11
OPTIMIZING QUALITY RISK MANAGEMENT CONFERENCE: DEC. 12-13
#PDAQualityWeek
There’s something for everyone at the inaugural PDA Quality Week! The week
will combine three events to provide a comprehensive look at current thinking on
Quality Risk Management (QRM) and how you can help optimize a QRM program
in your own organization.
Other noted experts throughout the week include:
• H. Gregg Claycamp, PhD, Biologist, CVM, U.S. FDA
• Anne Greene, Professor, Lecturer, and Pharmaceutical Project Manager, TU Dublin, School of Chemical
and Pharmaceutical Sciences
• Anil Sawant, MSc, PhD, Senior Vice President, Global Quality Compliance, Merck & Co., Inc.
Register for two events and save 10% or register for all three and save 15%!
To learn more and register, visit pda.org/2019QualityWeek
Author Thomas Stanton and U.S. FDA’s Janet Woodcock, MD,
to Present Keynote Addresses!
Register by Oct. 25
and save up to $600!
FOR PERSONAL, NON-COMMERCIAL USE
12 BioPharm International www.biopharminternational.com September 2019
Perspectives on Outsourcing
Do
n F
arr
all/G
ett
y I
ma
ge
s
The growth of the biologics indus-
try has created expansion in the con-
tract development and manufacturing
(CDMO) space. Liza M. Rivera, senior direc-
tor, global marketing, at Fujifilm Diosynth
Biotechnologies (FDB), says biologics have seen
success especially in the treatment of cancer
and autoimmune diseases. The following high-
lights some of the latest news from CDMOs in
the biomanufacturing space.
NEW FACILITIES AND SERVICESCDMOs are adding facilities and services to
their portfolios in anticipation of the industry’s
continued growth. Fujifilm is one of the com-
panies making significant investments in their
biomanufacturing offerings. “In recent years,
we have prioritized the expansion of our pro-
duction facilities, principally 2000-L medium-
sized tanks, in response to the rapid increase in
production demand for biologics,” Rivera says.
“As outlined in our medium-term manage-
ment plan, VISION2019, with fiscal year ending
in March 2020, we set our sights on enhancing
the growth of our healthcare business. To meet
this goal, we have actively made capital invest-
ments in our bio-CDMO business, achieving
double-digit growth in sales, exceeding market
growth. Going forward, we intend to continue
to promote growth along these lines, expanding
the bio-CDMO business as the growth driver for
the healthcare area,” says Rivera.
In March 2019, Fujifilm acquired a large-scale
biologics manufacturing facility in Hillerød,
Denmark from Biogen as part of their goal
of expanding its global business. The facility
allows for the support of high-volume produc-
tion of biologics that requires large-scale culture
tanks and is equipped with six 15,000-L bio-
reactors. The facility also houses
an assembly, labeling, and packag-
ing facility; quality control laboratories; and
warehouses. “Most importantly, the nearly 800
women and men of the Hillerød facility will
contribute their world-class cGMP [current
good manufacturing practice] manufacturing
capabilities to FDB’s existing leadership bio-
CDMO, immediately strengthening our over-
arching goal to advance tomorrow’s medicines
and guarantee distribution of their lifesaving
properties to all who need them,” Rivera says.
HALIX, which specializes in clinical and
commercial proteins and viral products, com-
pleted its new cGMP manufacturing facility in
Leiden Bio Science Park in the Netherlands in
August. The 6700-sq-m facility will be used for
the development and production of biopharma-
ceutical drug substances. The facility contains a
manufacturing line for viral vaccines and viral
vectors in addition to a separate protein manu-
facturing area with a capacity of up to 1000-L
single-use bioreactors. Lab space is also avail-
able for process development, analytical devel-
opment, and quality control. All cleanroom
areas have a unidirectional process flow and are
designed to allow commercial manufacturing of
biopharmaceutical products (1).
“This new facility offers our current and
future clients’ capacity and flexibility for future
expansion and will allow for cGMP manufac-
turing solutions for viral products, proteins,
gene therapy, and client-specific new technolo-
gies,” said Roland Hecht, HALIX chief customer
officer, in a company press release.
Sartorius Stedim Biotech (SSB), a supplier
of biopharmaceutical manufacturing prod-
ucts and services, is now offering GMP mam-
malian cell bank manufacture, the company
announced on Aug. 8, 2019. The services will be
offered through its subsidiary, Sartorius Stedim
BioOutsource, a contract testing organization
based in Glasgow, United Kingdom, and in
Biologics Continue to Grow and Create Outsourcing OpportunitiesCDMOs are adding facilities and services to their portfolios in anticipation of the biologics industry’s continued growth.
Susan Haigney
FOR PERSONAL, NON-COMMERCIAL USE
An ever-changing journey needs an agile partnershipThe dynamic nature of drug development and your world, means you need an
adaptable partner. By joining forces with you, we provide a highly fl exible, expert
service covering contract development and manufacturing services for mAbs and viral
vectors, product characterization, biosafety testing and toxicology testing services.
So whatever direction your project needs to take, we’ll help guide you there.
The Life Science Business of
Merck KGaA, Darmstadt, Germany
operates as MilliporeSigma in the
US and Canada.
MilliporeSigma, the vibrant M and BioReliance
are trademarks of Merck KGaA, Darmstadt,
Germany or its affi liates. All other trademarks
are the property of their respective owners.
Detailed information on trademarks is available
via publicly accessible resources.
© 2019 Merck KGaA, Darmstadt, Germany
and/or its affi liates. All Rights Reserved.
FOR PERSONAL, NON-COMMERCIAL USE
14 BioPharm International www.biopharminternational.com September 2019
Perspectives on Outsourcing
Cambridge, MA, in the United
States (2).
The services will feature the
manufacture of GMP master and
working cell banks for mamma-
lian suspension cells, which will
be conducted in a 260-sq.-m. GMP
cleanroom dedicated to mam-
malian suspension cell lines. The
facility enables closed-system
manufacture of GMP-compliant
cell banks, from vial thaw to auto-
mated filling, as a qualified broth
technology platform. The company
expects this platform to maximize
process reliability and assurance of
sterility.
SSB offers its cell bank manu-
facturing in a package along with
cell bank characterization services,
making the company a single-
source provider from vial thaw to
released cell banks.
With these new services, the
company can offer combined
cell-line development, cell bank
manufacturing, and cell bank
characterization and provide bio-
manufacturing solutions from
DNA to released GMP cell bank
within a 10-month timeline.
MERGERS AND ACQUISITIONSIn August 2019, Eurofins Genomics
completed its acquisit ion of
Blue Heron Biotech, a Bothell,
WA-based gene synthesis company.
The deal bolsters Blue Heron’s pro-
duction capabilities while expand-
ing Eurof ins Genomics’ gene
portfolio into cloning and com-
plex gene constructs, according to
the company. The acquisition also
strengthens Eurofins Genomics’
product portfolio in the synthetic
biology market (3).
The companies share similar
main product segments includ-
ing oligonucleotides, sequenc-
ing, and synthetic genes. Eurofins
Genomics’ product of fer ings
include oligonucleotide synthesis,
Sanger sequencing, next-gener-
ation sequencing, and gene syn-
thesis. With the acquisition, the
company can now provide holistic
solutions to customers, including
regulatory coverage for its prod-
ucts—ISO 13485, ISO 9001, CLIA,
CAP, good laboratory practice, and
FDA compliance—for the manufac-
turing of cGMP oligonucleotides
used in analyte-specific reagent
and in-vitro diagnostic products for
the clinical industry.
REFERENCES 1. Halix, “New cGMP facility starting
operational production in Q4-2019,”
Press Release, Aug. 9, 2019.
2. Sartorius, “Sartorius Stedim Biotech
Launches New Services for Mammalian
Cell Bank Manufacturing,” Press
Release, Aug. 8, 2019.
3. Eurofins, “Eurofins Genomics US
Expands Gene Synthesis Capabilities
with Acquisition of Blue Heron Biotech,”
Press Release, Aug. 5, 2019. ◆
Call for Peer-Review Papers
BioPharm International accepts four types of peer-review papers
that are considered: standard data-driven, novel research; topical
literature or patent review; technical case studies/technical
application notes; and science-based opinion papers.
Manuscripts for peer-review papers are accepted on an ongoing
basis. Publication priority is given to papers in the order they are
accepted for publication.
Submitted papers are initially screened by the editors, then
submitted for formal review by a member of the editorial advisory
board, who will review the article for technical interest and content
in a double-blind review process. Article acceptance is conditioned
on the reviewer’s approval. Once accepted for publication, a paper
typically is published within three to five months.
Peer-review papers are published in the print and digital editions
of BioPharm International, and on www.BioPharmInternational.com.
Links to the online versions of peer-review papers also are featured
in e-newsletters distributed to the publication’s audience.
To learn more about the peer-review submission process, click the Submission Guidelines link on
www.BioPharmInternational.com.
B
t
l
a
b
a
s
b
i
o
t
o
L
i
22 BioPharm International September 2018 www.biopharminternational.com
scie
nce
ph
oto
/Sh
utt
ers
tock
.co
m
A risk-based approach based on a pharmacological and toxico-logical evaluation is becoming perceived in the industy as a sci-
ence-based approach that ensures safety of pharmaceuticals. Since the publication of International Council for Harmonization (ICH) Q9 Quality Risk Management, the application of this approach to the quality management of pharmaceuticals has been considered essential, and its application has also been extended to the cleaning validation of pharmaceutical manufactur-ing equipment. Limits such as 1/1000, 1/10,000, and 10 ppm were convention-
ally used in cleaning validation, but these limits can not be scientif ically justif ied and are arbitrary. In September 2010, the International Society for Pharmaceutical Engineering (ISPE) published a new base-line guide called Risk-Based Manufacture of Pharmaceutical Products (Risk-MaPP). Risk-MaPP provides a scientific and risk-based approach, based on ICH Q9 Quality Risk Management principles, to manage the risk of cross-contamination to achieve and maintain an appropriate balance between product quality and operator safety (1). The basic concept of Risk-MaPP requires a consistent and science-based approach
Takashi Kaminagayoshi, is director and head of
manufacturing operations;
Kosuke Takenaka, Tetsuya Ohta, Tomohiro Doi, and
Makoto Sadamitsu are
principal scientists; Shunsuke Omori is scientist; and Shinji Tsuji and Yoshiaki Miko are
associate directors; all are at
Biopharmaceuticals Process
and Product Development,
Pharmaceutical Sciences,
Takeda Pharmaceutical.
Osamu Shirokizawa is director
and senior consultant, Life
Scientia, and Andrew Walsh
is president, Center for
Pharmaceutical Cleaning
Innovation.
PEER-REVIEWED
Submitted: Dec. 8, 2017 Accepted: Apr. 11, 2018.
ABSTRACTCurrently, risk management based on a scientific approach is becoming required in the establishment of cleaning validation limits for pharmaceutical manufacturing equipment, as the acceptable daily exposure (ADE), which is set based on pharmacological and toxicological evaluation, is increasingly applied. At the early stage of development, ADE values may be set using the threshold of toxicological concern (TTC) approach due to lack of human data on toxicity. However, TTC values are estimates, so their application requires careful consideration. Especially in biopharmaceuticals (mainly proteins), whether or not the target product item is inactivated and degraded after cleaning is an important issue in evaluating the cleaning process. Therefore, a study was conducted by carrying out “CIP (clean in place) + SIP (steam in place)” and “CI (caustic immersion: alkaline treatment over a certain period of time)”, which are usually processes used in the cleaning of antibody drug manufacturing equipment. The inactivation and degradation of antibody drug was evaluated from the molecular structure and physiological activity point of view, using sodium dodecyl sulfate–polyacrylamide gel electrophoresis and surface plasmon resonance. This study was successful in establishing a reliable and effective method for evaluating cleaning processes based on risk.
TAKASHI KAMINAGAYOSHI, KOSUKE TAKENAKA, TETSUYA OHTA, TOMOHIRO DOI, SHUNSUKE OMORI, MAKOTO SADAMITSU, SHINJI TSUJI, YOSHIAKI MIKO,
OSAMU SHIROKIZAWA, AND ANDREW WALSH
Study on an Inactivation Evaluation Method of Cleaning Processes for
Biopharmaceuticals
Peer-Reviewed
FOR PERSONAL, NON-COMMERCIAL USE
We offer a diverse portfolio of advanced cell culture media solutions including media
products, services, and technologies for bioprocessing targeted to meet the evolving
demands of the biopharmaceutical, vaccine, and gene therapy industries.
Nimble, extremely responsive, and deeply collaborative, we work with each of our
customers at every stage—from early research through commercial production—
to develop personalized solutions that exceed expectations. With an unwavering
commitment to full-spectrum partnership, we dedicate our resources and expertise to
helping you expedite therapies to the patients who need them most.
Bring more therapies to life with our support.
www.irvinesci.com
© 2019 FUJIFILM Irvine Scientifi c. FUJIFILM Irvine Scientifi c and its logo are registered trademarks of FUJIFILM Irvine Scientifi c in various jurisdictions.
Industry Expertise. Partnership. Service.
We help to bring your therapies to life by delivering
unparalleled support at every step.
FOR PERSONAL, NON-COMMERCIAL USE
16 BioPharm International September 2019 www.biopharminternational.com
Stability Testing
Putting Biopharma Stability Testing Under the Microscope
Stability testing for biologics is more complex than for small-molecule drugs, so companies should be aware of the potentially serious
issues that can be costly and jeopardize drug development.
FELICITY THOMAS
Stability testing is an essential part of drug develop-
ment and approval processes for both small- and
large-molecule drugs, and enables regulators and
companies to discern an appropriate shelf-life of a prod-
uct so that drug efficacy is ensured and patient safety is
not at risk. The global pharmaceutical stability testing
market has been predicted to experience robust growth,
partly as a result of the continuous rise of biologics (1).
However, stability testing of biologics is a much more
complex affair than that for small-molecule drugs.
“Unlike small-molecule drugs that tend to have lim-
ited structural conformations, biologics are significantly
larger and, therefore, more complex with greater degrees
of conformational freedom,” explains Phil Kuhlman,
laboratory manager—biologics at RSSL. “In addition,
tertiary and quaternary structure is maintained by multi-
ple forces, which may be disrupted leading to conforma-
tional changes. These changes lead to reduced potency,
aggregation, and increased risk profile to the patient due
to enhanced immunogenicity. It is not that small mole-
cules don’t degrade, more that large molecules have more
options for reaching a state of reduced potency.”
A STABILITY-INDICATING PROFILEAs a result of the complexity of biologics giving rise to
potentially multiple degradation pathways, a sole sta-
bility indicating assay is not sufficient to evaluate all
critical quality attributes, emphasizes Alex Perieteanu,
director, biopharmaceutical services at SGS Agriculture,
Food and Life. “Manufacturers are, therefore, required to
propose a stability-indicating profile that provides assur-
ance that changes in the product potency, identity, or
purity are detectable,” he says.
However, Perieteanu continues, there is not a one-
size-fits-all approach for biologics. “Most people think
about shelf-life stability and lot commitment when the
topic of stability testing comes up,” he adds. “Although
these are a good proportion of what is required in evalu-
ations, there are also other types of stability studies that
are critical and required.” kko
loso
v -
Sto
ck.A
do
be
.co
m
FOR PERSONAL, NON-COMMERCIAL USE
Supercharge your biologics development
with our newest additions
For Research Use or Manufacturing of Cell, Gene, or Tissue-Based Products. Caution: Not intended for direct
administration into humans or animals. © 2019 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the
property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified. DIFCO and the DIFCO logo are trademarks
of Becton, Dickinson and Company and are used under license. COL23385 0719
Explore the portfolio now at thermofisher.com/advbio
For over 50 years, high-quality Gibco™ cell culture products have been the most trusted in the
industry. Now with the addition of premium Bacto™ and Difco™ supplements, the Gibco™ product
portfolio provides a wider range of solutions for biotechnology, biopharmaceutical, and animal and
human vaccine developers who rely on mammalian, insect, and microbial cultures. The expanded
portfolio features more than 250 added products to help solve your unique bioprocessing needs.
• Peptones
• Supplements and feeds
• Media
• Bioproduction services
Bacto and Difco premium supplements are now part of the Gibco portfolio
FOR PERSONAL, NON-COMMERCIAL USE
18 BioPharm International September 2019 www.biopharminternational.com
Stability Testing
Naming a few, Perieteanu states
some studies of note include in-
use stability, photostability, ship-
ping studies, and forced degradation.
These studies are intended to sub-
ject the drug product to conditions
it will encounter, whether during
manufacture, shipment, storage, or
in the clinic. “Of important consid-
eration,” he says, “are the types of
conditions, and stability-indicating
methodologies that form the stabil-
ity-indicating profile.”
AVAILABLE TOOLS AND GENERAL PRACTICESAlthough many of the same tools used
in stability testing of small-molecule
drugs, such as osmolality, pH, appear-
ance, and mass, find use in biolog-
ics, the more complex large molecules
also require additional analytical tools
to help in the detection of confor-
mational changes that can occur and
which often lead to aggregation, states
Kuhlman. Additional tools such as
size-exclusion chromatography (SEC)
using multi-angled laser light scatter-
ing (MALS) detection, or analytical
ultracentrifugation (AUC), or field-
flow fractionation (FFF) can be used
to aid in biologics testing.
“Larger molecules also undergo
post-translational modifications or
exist as closely related isomers, both
of which can lead to slight variances
in isoelectric potentials,” Kuhlman
continues. “The separation of these
isoelectr ic var iants by capil lar y
electrophoresis is often used when
characterizing and monitoring the
proportions of these populations of
molecules.”
“F irs t and foremost , ” asser ts
Perieteanu, “the analytics employed
should be validated and should be
shown to be stability indicating. In
general, these methodologies should
be able to detect changes in the prod-
ucts potency, identity, and purity.”
Potency is particularly product spe-
cific, he explains, and can be depen-
dent upon the known mechanism of
action. “Methodologies such as cell-
based functional assays, enzyme assays,
or binding assays are critical (and
commonly employed) as they provide
practical in-vitro solutions to monitor
potency,” Perieteanu says.
For biological products, ‘abso-
lute’ purity is difficult to determine,
Perieteanu continues. As a result of
the difficulties encountered, it is com-
mon for many methods to be used
so that multiple quality attributes
relating to purity can be assessed.
“Techniques such as SEC are often
used to detect soluble aggregation and
fragmentation,” he states. “Sodium
dodecyl sulfate-polyacrylamide gel
electrophoresis/capillary gel electro-
phoresis (SDS-PAGE/CGE) can
differentiate between covalent aggre-
gates, fragments, and in some cases
glycosylation. Hydrophobic interac-
tion chromatography, ion exchange
chromatography, or isoelectric focus-
ing can look at charge distribution as
an indication of deamidation/oxida-
tion events, and peptide mapping can
be used to provide a higher resolu-
tion understanding of such changes.
In cases of (relatively) small biolog-
ics, traditional reverse-phase high-
performance liquid chromatography
(HPLC) with high pore size can be
utilized to monitor degradation prod-
ucts as well.”
Further to the key purity and
potency tests, Perieteanu highlights
that other product characteristics,
including appearance, visible and sub-
visible particulates, pH, moisture lev-
els, reconstitution time, sterility, or
alternative, are commonly assessed.
“Additives or excipients may degrade
and adversely affect the quality of the
drug product, and as such may also
need to be monitored,” he notes.
PRESENCE OF PARTICULATES AND AGGREGATE FORMATIONA notable challenge affecting the
stability of biologics is the potential
presence of particulates. This issue is
of particular concern for injectables
as particulates can induce an immune
response within the patient, which is
extremely undesirable as it can lead
to adverse reactions and reduced drug
efficacy, explains Perieteanu.
Adding to Per ie teanu’s com-
ments further, Kuhlman confirms
that special considerations on the
container material for biologics are
necessary. “The extraction of leach-
able compounds leads to contami-
nation of small molecules, whereas
within high concentration biologic
samples, extraction of leachable
compounds can lead to a catalytic
formation of large-scale aggregates,”
he says. “This stability question
will be further complicated by the
route of administration, for example
the use of intravenous saline bags
as a transport medium for a drug.
Compatibility testing would need to
be performed as part of the stability
study to ensure that no adverse reac-
tions occur.”
As a result of the complex nature
of biologics and the further com-
plications that can occur due to the
route of administration, Perieteanu
adds that particulates are not an
uncommon occurrence and, as such,
significant formulation development
is required to prevent particulate
development. “A comprehensive test
paradigm is often employed during
development and stability to monitor
particulates and aggregate formation,”
he reveals.
“When a protein undergoes con-
formational changes, hydrophobic
amino acids, usually held in the core
of the folded protein structure, are
exposed and may coalesce with other
protein molecules in a similar state,”
asserts Kuhlman. “This process can
be catalytic, leading to the formation
of aggregates, or can be promoted by
extractables and leachables from con-
tainers, such as silicone used to coat
the vial stopper.”
FOR PERSONAL, NON-COMMERCIAL USE
Robust Hydrophobic Interaction
Chromatography of Intact Native Proteins
Now you can use hydrophobic interaction chromatography (HIC) instead of reversed-
phase chromatography to resolve CQAs from parent molecules with a small difference
in hydrophobicity.
Agilent AdvanceBio HIC columns address particularly challenging molecules, such
as monoclonal antibodies (mAbs), antibody drug conjugates (ADCs), and other
recombinant proteins.
These single-chemistry columns allow you to perform multiple applications with better
peak shape and lower backpressures. You can also count on robust performance
and batch-to-batch consistency. What’s more, their shorter column length reduces
your analysis time—so you can develop methods faster, and increase throughput for
greater productivity.
For Research Use Only. Not for use in diagnostic procedures.
© Agilent Technologies, Inc. 2018
Ready to enhance the accuracy
and speed of your biomolecule
characterization?
Visit www.agilent.com/chem/
advancebio-hic
FOR PERSONAL, NON-COMMERCIAL USE
20 BioPharm International September 2019 www.biopharminternational.com
Stability Testing
Formation of aggregates is gen-
erally triggered by a change in the
local (atomic) environment of a
molecule, ultimately causing desta-
bilization of the native structure
of the molecule, adds Perieteanu.
“Destabilized structures are often
unfavorable energetically, and as
such a ‘stabilizing’ cascade of events
occur that ultimately culminate in
the formation of visible particulates,
which are energetically stable, but
unwanted,” he says. “The testing
panel employed (stability indicat-
ing profile) often focuses on detec-
tion various stages of these cascade
events.”
These aggregates can then cause
mechanical issues when using the
syringe for administration, notes
Kuhlman, and may, therefore, exhibit
an increased immunological r isk
profile. “Protein aggregates tend
to have increased immunogenicity,
which ultimately reduces the effi-
cacy of the biologic,” he explains.
“Circulating patient-derived anti-
bodies to the drug leads to increased
c learance and thereby reduced
potency and can ultimately lead
to the need for that patient to be
switched to a different medication.”
NOT ALL SMOOTH SAILINGPotential ly the most significant
issue that can arise for a company
developing a biological product is
finding out the product is not stable
under the respective stability con-
ditions, states Perieteanu. “Finding
this out during preclinical/clinical
phases may trigger a requirement to
manufacture multiple costly batches,
additional formulation studies, or
worse, may jeopardize the study,” he
cautions.
Performing a suitable formula-
tion study will help to prevent com-
mencement of a stability program
too early and finding that the bio-
logic will not last the duration of
the study, adds Kuhlman. “However,
it is also important to note that the
information gained during the sta-
bility study is only as good as the
assays being performed,” he says.
“If the CQAs have not been fully
defined using an appropriate forced-
degradation study, then the amount
of useful data may be reduced or
a critical attribute may be missed,
risking patient safety further down
the development path. Detecting
this kind of issue later in the devel-
opment cycle could also lead to the
need to repeat the study.”
Despite stability normally being
established or understood after for-
mulation development and around
the time prec linical batches are
being prepared, there are many fac-
tors that can change in the tran-
sition from bench-scale to larger
batch sizes, warns Perieteanu. “If
the process is not robust, there is
an increased risk of product insta-
bility,” he adds. “Most common
product-related failure modes in
our experience are covered under
aggrega t ion and ox ida t ion , o r
deamidation events.”
Dealing with particulates or aggregates in biologics
Particulates or aggregates can have a detrimental
effect on the efficacy and safety of a biological drug
in a number of ways. Aggregation, for example, can
lead to, or be a consequence of, misfolded proteins
in an inactive state, explains Alex Perieteanu, director,
biopharmaceutical services at SGS Agriculture, Food and
Life. “This effectively reduces the amount of soluble,
active molecule able to perform its intended function,”
he says. “Alternatively, even if the molecule remains
active, an immune response can result in antibody-
mediated neutralization of the protein’s activity or in its
bioavailability.”
Cer tain methods can be employed to identify
particulates or aggregates in a biological formulation.
Perieteanu states that for insoluble aggregates, it is
possible to simply use visual appearance for detection
when larger particles have formed. “Light obscuration
is employed to determine particle counts in the >2 μm,
>5 μm, >10 μm, >25 μm range, and to ensure that
requirements for injectables, or ophthalmics are met per
United States Pharmacopeia (USP ) <787>, USP, <788>, or
USP <789>,” he adds.
In instances where light obscuration is not feasible
due to the extensive formation of bubbles or color, it is
more suitable to use microscopic evaluation of sub-visible
particles, although, this technique is more labor intensive,
Perietenau notes. “Additionally, microflow imaging can
look at a similar range of particulate sizes to get more
detailed understanding of morphology and distribution,”
he says.
If the particulates or aggregates are soluble, it is
common practice to use techniques such as sodium
dodecyl sulfate-polyacrylamide gel electrophoresis/
capillary gel electrophoresis (SDS-PAGE/CGE), size-
exclusion chromatography (SEC) using multi-angled light
scattering (MALS), and analytical ultracentrifugation,
Perieteanu asserts.
—Felicity Thomas
FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 21
Stability Testing
“There is a need to ensure that sta-
bility studies run smoothly, other-
wise the overall timelines for a drug’s
development will be perturbed,”
asserts Kuhlman. As there is a pos-
sibility that an unexpected result is
detected during stability tests—such
as unexpected development of a new
species in an assay—then there is a
regulatory requirement to be able to
investigate these occurrences, identify
the new product, and evaluate the
significance it may have in the final
drug product, he explains.
“Product-related impurities may
have little effect on the potency of the
drug,” Kuhlman adds. “Alternatively,
they may be immunogenic leading
to the need for formulation changes.
Either way, being able to rapidly
respond with a suitable investigation
is essential.”
Highlighting the example of the
FDA, Perieteanu specifies that if any
quality defects in a distributed drug
product that may potentially risk
patient safety are identified, submis-
sion of a field alert report is required.
“This includes reporting of any sig-
nificant chemical, physical, or other
change or deterioration in the distrib-
uted drug product,” he says.
However, Perieteanu underlines
that there are a number of critical
aspects that can facilitate a rapid reso-
lution of quality defects in a product.
“First, have a strong understanding of
analytical performance characteristics,”
he confirms. “Second, have a good
understanding of the mechanism of
degradation, the stability indicating
profile, and how various degradation
pathways manifest themselves. Third,
armed with the information in the
first two points, an experienced team
of technical and quality investigators
can investigate product failures within
a GMP quality system.”
BEST PRACTICESAn understanding of a molecule’s
d eg r ada t i on pa thway i s c r i t i -
cal, asserts Perieteanu, and can be
achieved ear ly on using limited
degradation studies. “These stud-
ies can almost immediately shed
light on any potential stability con-
cerns prior to them becoming a risk
to patient,” he says. “Furthermore,
t h e s t u d i e s w i l l p r o v i d e a n
understanding of how stabi l i t y
issues manifest themselves, enabling
r a p i d r e s o l u t i o n w h e n i s s u e s
potentially arise.”
For Kuhlman, an essential pre-
requisite for any company look-
ing to enter stability studies is the
performance of a suitable forced
degradation study to identify the
appropriate CQAs. “Having suitable
assays both in terms of what needs
to be detected as well as sensitivity
is essential to generate the best out-
come of a stability study,” he stresses.
“Considering the length of time of a
typical stability study (three years)
and the associated costs, every effort
should be made to optimize the
success rate.”
One way of increasing experience
level and reducing costs incurred is
to use an outsourcing partner. “The
primary benefits of outsourcing
come from access to facilities and
infrastructure, experts, and capac-
ity, at a comparatively low cost,”
s u m m a r i z e s Pe r i e t e a n u . “ T h e
right contract organizations have
an economy of scale that many
sponsors cannot achieve internally.
Additionally, outsourced partners
often have experienced experts who
have worked on stability programs
for dozens of molecular entities.
It ’s critical that the entire panel of
stability tests be performed within
their respective test window. Thus,
expert capacity is paramount.”
REFERENCE1. Frost & Sullivan, “Global
Pharmaceutical Stability Testing Market Trends, Opportunities, and Future,” Market Report, store.
frost.com, Jan. 13, 2017. ◆
Modular system layout
Matching detectors
for your target
Easy scale-up to 1 000 ml/min
Various columns
for your application
FPLC & Prep LCFlexible purification solutions
Made in Germany
Phone +49 30 809727-0
Define your AZURA® system:
www.knauer.net
FOR PERSONAL, NON-COMMERCIAL USE
22 BioPharm International September 2019 www.biopharminternational.com
Upstream Processing
Cell-Culture Advances Test Bioreactor Performance Models
The evolution of cell-culture technology is driving the need for improvements in modeling solutions.
CYNTHIA A. CHALLENER
Modeling and simulation are recognized to provide
assistance in predicting bioreactor performance,
both for initial laboratory runs and when scaling to
the pilot plant and commercial manufacturing. “Bioreactor
performance has consistently improved in biomanufacturing
due to a greater understanding of the engineering and biol-
ogy of cellular systems. To continue to drive efficiency and
reduce cost of manufacturing while maintaining or improv-
ing quality, reducing bioreactor variation will be required,
and predictive models can enable these variation reductions,”
asserts Tom Mistretta, director of data sciences at Amgen.
The continual development of higher-producing cell lines,
the switch to chemically defined media, and other advances
in cell-culture technology are, however, challenging develop-
ers of modeling and simulation software.
TRADITIONAL, RELIABLE METHODTypically, bench-top bioreactors are operated in the perfor-
mance design space of larger bioreactors to model scale-up
performance, according to Parrish M. Galliher, chief tech-
nical officer for upstream and founder of Xcellerex, a GE
Healthcare Life Sciences business. “Successful modeling
of bioreactors can reduce costs associated with engineer-
ing testing and engineering runs, accelerating pathways
through preclinical and early clinical phases,” adds Mark
T. Smith, staff engineer for single-use technologies in the
BioProduction Division of Thermo Fisher Scientific.
In particular, the inexpensive computing power and excel-
lent computational talent entering the biopharma industry,
combined with improvements in computational fluid dynam-
ics (CFD) and metabolic modeling software, are promising
to open new doors for more complete cell culture models,
according to Smith. “I predict that as modeling becomes
more robust, it may be possible to entirely eliminate tradi-
tionally performed engineering runs, which in fact is already
being done to some extent because in many cases companies
and engineers simply ‘get to know’ their bioreactor networks
empirically and heuristically, without the need for complex
physical modeling in silico,” he asserts.
me
tam
orw
ork
s -
Sto
ck.A
do
be
.co
m
CYNTHIA A. CHALLENER, PhD, is a contributing editor to
BioPharm International.
FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 23
Upstream Processing
The key to successful modeling for
the prediction of bioreactor perfor-
mance, stresses Galliher, is to first calcu-
late the performance design space of the
bioreactor at all relevant scales. “Once
these design spaces are understood, the
scientist can operate any scale bioreac-
tor within the design space of any other
bioreactor scale and model any bioreac-
tor of any scale using a bioreactor of any
other scale,” Galliher says. He adds that
this approach has been used effectively
for decades.
The process of modeling has, in fact,
advanced due to the increased capability
to aggregate various sources of data (sen-
sor measurements, batch record entries,
product quality measurements, main-
tenance records, etc.) needed to model
bioreactor performance, according to
Mistretta. “The industry has become
more efficient due to the significant
improvements in technology for central-
ized access to various data sources via
data lakes,” he observes. In addition, the
information systems technology used has
been validated and demonstrated to be
cost effective, secure, compliant, and scal-
able with the volume of data generated
from manufacturing processes.
CONTINUOUS CONSIDERATIONSIn the past, continuous processing in
perfusion mode was generally limited to
cell-culture processes involving sensitive
products that degrade under conven-
tional batch conditions. Today, there is
increasing use of perfusion cell culture
to realize other cost, efficiency, and pro-
ductivity advantages.
Some of the challenges with perfu-
sion processes include sensor insta-
bility and fouling over the course of
the culture, which impacts the abil-
ity to effectively monitor and control
these processes, according to Galliher.
Perfusion mode can also create addi-
tional risks of contamination due to
the continuous removal of depleted
media and introduction of fresh
media, and these processes involve a
significant increase in the media vol-
umes required, which has logistical and
cost implications for a manufacturing
facility, adds Mistretta.
Overall, perfusion mode generally
places higher performance demands
on the reactor, according to Smith.
He points to the higher cell densi-
ties in perfusion mode, which result in
increased oxygen demand in a higher
viscosity solution with potentially more
cell-free biopolymers and lipids than a
fed-batch culture. “Viscosity and solu-
tion property changes can fundamen-
tally change mass-transfer mechanisms
by impacting bubble size, bubble coales-
cence, mixing times, shear rates, and
other parameters,” he explains.
As a result, in-silico modeling of sys-
tems must be adjusted for such param-
eters in a meaningful way. There is,
however, a limited understanding in
how to model such high cell densities
due to the relative newness of these
operating regimes, according to Smith.
Computational models of perfusion
processes additionally require consider-
ation of filter effects such as fouling and
sieving, Mistretta notes.
SHEAR ISSUES IN SINGLE-USE BIOREACTORSThe shift to single-use technologies
has also introduced a wider diversity
of bioreactor designs, particularly with
respect to spargers, baffles, and impeller
configurations. “Whereas stainless-steel
reactors could be made with relatively
similar configurations within and across
bioreactor networks, having multiple
vendors represented in single-use bio-
reactor networks increases the level of
data and modeling required to success-
fully predict behavior,” Smith explains.
In addition, Smith notes there is
a need for improved mass trans-
fer performance with reduced shear
in single-use bioreactors. “As cultures
become more intensified, the need
for oxygen transfer increases and is
generally accommodated by increas-
ing the oxygen gas passing through
the micro-sparger. In many cases, the
increased flow through the micro-
sparger leads to shear-associated cell
damage, likely related to increasing
shear at the gas-liquid interface,” he
explains.
To address this problem, oxygen
delivery must be achieved through
efficient spargers with lower gas-liq-
uid shear rates. “While some vendors
already offer such sparger technolo-
gies, the industry has been slow to
update to these sparger technologies,
likely due to the revalidation burden
of changes to established bioprocesses,”
Smith comments.
Mistretta agrees that variability of
single-use systems does impact cell cul-
ture, but Amgen has been able to rap-
idly detect and determine the root cause
for this cell culture variation through
the accessibility of process data, material
lot data, and process performance mod-
els. “These models also support data-
driven decision making for impacted
lots, and we continue to develop moni-
toring strategies through predictive
models, near-real-time monitoring, and
material-control strategies to mitigate
unintended variation in performance,”
he states.
More advanced use of hybrid models
such as CFD combined with first prin-
ciples kinetic models are also effective
to assess the impact of bioreactor design
on performance, according to Mistretta.
“Use of CFD models to determine kLa
[mass transfer coefficients], mixing time,
and shear effect have become pretty
standard applications for technology
transfer, scale-up, process optimiza-
tion, and troubleshooting activities at
Amgen,” he says.
In addition, Amgen has demon-
strated the utility of finite element
models for studying operational risk
factors for single-use bioreactor sys-
tems. For instance, models were devel-
oped to predict how material science
aspects of the single-use bioreactors
impact pressurization and other oper-
ational risks, according to Mistretta.
FOR PERSONAL, NON-COMMERCIAL USE
24 BioPharm International September 2019 www.biopharminternational.com
Upstream Processing
Amgen has also observed more
collaboration with single-use bioreac-
tor suppliers with respect to exchang-
ing data and developing models that
enable more reliable operations.
ULTIMATE GOAL:MODELING COMPLETE BIOREACTOR PERFORMANCEModeling of the performance of the
whole bioreactor including predicting
full cell-culture performance seems to
be the holy grail, but according to Smith,
broad application of complete models
has yet to be achieved due to to the
complexities of the variables required for
accuracy, including the oxygen transfer
rate, oxygen uptake rate, carbon diox-
ide evolution, carbon dioxide stripping,
metabolism, cell-line traits, etc.
In addition, Smith notes that
improvements in understanding of cell
biology have led to dramatic changes
in what a “typical” cell line is capable
of producing, with improvements com-
ing from cell-line traits such as gene
promoter strength, gene integration site,
integration stability, modified metabolic
pathways, etc. Furthermore, aspects of
bioprocess engineering have shifted,
for example from natural to chemically
defined media and from batch to fed-
batch (and toward continuous) modes.
“In short,” Smith concludes, “model-
ing the ‘complete’ bioreactor cell-culture
performance for universal application
may be not yet be in sight.” He does
comment that there appears to be a push
among large biopharma toward the use
of complete models for the prediction
of bioreactor performance in their given
networks. However, in any published
literature regarding these efforts, there
is rarely sufficient detail provided to
enable easy reproduction of the models
used, and almost never is source code
made public for direct application. “In
this sense, trade secrecy and intellectual
property concerns may be stymying the
potential rapid industry-wide advances
in performance prediction,” Smith
observes.
“Even simpler aspects of bioreactor
performance are generally still poorly
modeled.” He points to the modeling
of mass transfer coefficients, which dic-
tate whether a reactor can provide suf-
ficient oxygen to maintain viable cell
mass, as an example. “In the past three
years, there have been several hundred
publications on CFD-based prediction
of kLa in bioreactors. While this quan-
tity suggests great interest in the area,
they frequently describe the resulting
models as ‘adequate,’ ‘sufficient,’ or simi-
larly hesitant verbiage, suggesting in fact
there is still space to improve in our
performance prediction as an industry,”
Smith explains.
Potentially because of this remaining
gap in the predictive power of CFD,
many of the product development/
pilot-scale models used today, accord-
ing to Smith, are driven primarily by
empirical data leveraging fairly tra-
ditional correlations. “This approach
seems to be able to provide a similar
predictive power to that of CFD with-
out the additional computational effort
and resources,” he comments.
ROLE OF PROCESS ANALYTICAL TECHNOLOGYUseful models must be robustly vali-
dated with real data. The greater the
amount of good data incorporated into
a model, the more insight the model
can provide. Traditional off-line sam-
pling once or twice daily of key parame-
ters (e.g., viable cell density, glucose, key
amino acids, titer, etc.) will not provide
the robust data set needed to robustly
predict performance on a moment-by-
moment basis, according to Smith.
That is where process analytical
technology (PAT) comes in. “Relatively
recent application of PAT, such as
Raman spectroscopy and biomass
probes for inline sensing, are now pro-
viding more complete data on cell-cul-
ture performance and enabling better,
more timely control of reactor automa-
tion,” he observes. Advances in sensor
technologies have also contributed to
enhanced real-time performance pre-
dictions of bioreactor performance and
enable approaches such as model pre-
dictive control-based models, according
to Mistretta. It is, in fact, improvement
of automation control strategies within
the existing capabilities of the bioreac-
tor—not sampling and sensing alone—
that is essential to improving bioreactor
performance, stresses Smith.
Further advances in PAT are still
needed, however, to enable them to
really contribute to model develop-
ment, according to Galliher. As an
example, he notes that while infrared
sensors have been touted as being able
to measure relevant bioreactor param-
eters and generate predictive models,
they require large computing power
and algorithms to cancel out interfer-
ence from cells, gas bubbles, and media
components, all of which change over
the course of the run.
POTENTIAL FOR ARTIFICIAL INTELLIGENCE?The availability of data (particularly
genomic and proteomic data on cel-
lular systems) and the capability to
efficiently capture, store, and contex-
tualize the process data needed for
modeling have been the most notable
advances in predictive bioreactor per-
formance, according to Mistretta. The
decreasing cost of the infrastructure
needed to run computational models
has, he adds, also made it faster to pro-
totype and deploy predictive models
for bioreactors.
One area of rapid development
involves the potential application of
artificial intelligence (AI) and machine
learning (ML) to bioreactor perfor-
mance modeling. Bioengineers are
beginning to discuss how to apply
machine learning and digital-twin
algorithms to the modeling of bioreac-
tor performance, coupled with CFD
modeling of multiphase (liquid and
gas) solutions, according to Galliher.
He does note, though, that these
approaches are in conceptual stage.
FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 25
Upstream Processing
In fact, the capability to design, develop, and implement
machine learning algorithms more efficiently has also allowed
modeling to be done in a more systematic way, according to
Mistretta. “Machine learning models based on the ability to
leverage larger datasets have enabled automated data-driven
models of bioreactor performance and offer the potential to
help determine fitted parameters in first principles models of
bioreactor performance,” he remarks.
One possible challenge to leveraging AI/ML could be the
need for massive data sets in order to avoid overfitting issues.
“Considering that biopharma companies are generally trying
to minimize the number of culture runs for any given product
and that even processes for blockbuster products may only be
run 12–20 times per year, there is a relative dearth of informa-
tion for most cell-line cultures with respect to typical ML
data sets,” Smith explains. While each run produces thousands
of data points (e.g., second-by-second pH, dissolved oxygen,
viable cell density, etc.), these variables are inextricably linked
to the chronology of the culture and could lead to further bias,
he adds.
Smith stresses, though, that although AI and ML
pose unique challenges to bioengineers, it is possible that
experts well-versed in how and when to apply AI may
develop creative solutions for deconvoluting and dealing
with these types of challenges in the near future, to success-
fully enable the utilization of these technologies within the
bioprocess industry.
EXPECT MORE ADVANCES SOONToday, most of the measures of bioreactor performance are at a
macro level in commercial facilities, according to Mistretta. To
get to highly accurate predictions of bioreactor outputs, addi-
tional measurements and a framework for extensible model-
ing that describes the physiology, chemistry, and mechanics
of a bioprocess must be developed, he says. “Genomics and
metabolomics-level understanding of bioreactor performance
supplemented by real-time advanced sensors to measure
post-translational modifications are necessary, and we predict
to see these types of advances in the next three to five years,”
Mistretta asserts. ◆
Samsung Demonstrates Commerical-Scale ATF Perfusion
Samsung BioLogics has demonstrated the viability of using
alternating tangential flow (ATF) technology in a perfusion
reactor at commercial scale at its in Songdo, South Korea site.
The system allows for a 10-fold improvement in cell culture
densities while retaining cell viabilities of over 98% at the
seed stage, enabling inoculation within 15,000-L bioreactors
at higher cell densities; peak cell densities can be achieved
within shorter culture durations, the company reported in a
press statement (1). Samsung worked with Repligen to design
the stainless-steel-housed system. Validation, including ATF
system water and media tests as well as autoclave cycle
development and sterility performance testing, was completed
within six months, the company reported.
Reference1. Samsung, “Samsung BioLogics Implements Large Scale N-1
Perfusion for Commercial Application,” Press Release, Aug. 12, 2019.
—The editors of BioPharm International
,62�����������&HUWL¿HG����ZZZ�SHQGRWHFK�FRP
3ULQFHWRQ��1-�86$
PendoTECH® Sensors for Use
With BioProcess Containers
�6HQVRU�HDVLO\�LQVWDOOV�LQWR�D�FXVWRP�SRUW�SODWH� ��UHFHSWDFOH�VHDOHG�WR�D�ÀH[LEOH�ELRSURFHVV�FRQWDLQHU
�)HDWXUHV�D�GRXEOH�R�ULQJ�VHDO�DQG�D�VWRS�WR� ��HQVXUH��WKH�VHQVRU�LV�IXOO\�LQVHUWHG
�1R�FDOLEUDWLRQ�UHTXLUHG�
�3RO\HWK\OHQH�SRUW�SODWH�ZLWK�VHQVRU�UHFHSWDFOH� ��VHDOV�WR�WKH�¿OP�GXULQJ�WKH�PDQXIDFWXULQJ�SURFHVV�RI�WKH�FRQWDLQHU�
�$IWHU�PDQXIDFWXUH�RI�WKH�FRQWDLQHU��WKH�VHQVRU�LV�LQVHUWHG� ��LQWR�WKH�SRUW�SODWH�UHFHSWDFOH
�/RFNLQJ�FROODU�KROGV�VHQVRU�VHFXUHO\�LQ�SODFH�
�&RQGXFWLYLW\�SRUW�SODWH�IHDWXUHV�D�JXDUG�WR�SURWHFW�FRQWDLQHU� ��IURP�HOHFWURGHV
Features:
Pressure
Sensor
Conductivity
Sensor
Final Assembly
(Conductivity Shown)
FOR PERSONAL, NON-COMMERCIAL USE
26 BioPharm International September 2019 www.biopharminternational.com
Cell and Gene Therapies
Seeking Solutions for Large-Scale GMP Viral Vector Manufacturing
Innovation in manufacturing technologies must occur to ensure the availability of gene and cell therapies.
CYNTHIA A. CHALLENER
The rapid advance of gene and modified cell therapies
and growing interest in viral vaccine therapies are creat-
ing significant demand for large-scale viral-vector man-
ufacturing capabilities. Biopharma companies and contract
manufacturers alike face a host of challenges as they work
to meet this crucial market need, from a limited availability
of technology to a lack of standardization to complex and
evolving regulatory pathways.
MANY SIGNIFICANT CHALLENGESThere are numerous challenges to sourcing effective large-
scale manufacturing solutions for viral vector production.
Based on conversations with customers over the past several
years, Univercells has identified the major hurdles in large-
scale virus manufacture, which include expensive manufactur-
ing facilities, lack of expertise, limitations in the number of
scalable manufacturing technologies available in the market,
and the high cost of good manufacturing practice (GMP)-
grade reagents including transfection mix, plasmids, and
bovine serum, according to Thomas Theelen, business devel-
opment manager at the company.
“Equipment and facility setup using the technology that is
available, most of which has been adapted from other thera-
peutic areas, is very expensive and often does not support prod-
uct manufacture through different maturity stages including
process development, clinical trials, and commercialization. In
addition, the level of expertise around developing large-scale
manufacturing processes for gene therapies is limited, and the
use of flatware for cell culture and sub-optimal downstream
processing protocols result in low yields; both factors also influ-
ence the overall cost of goods sold (COGS),” Theelen explains.
“Existing manufacturing processes are often complex with
hard-to-control unit operations and unfavorable COGS pro-
files,” agrees Xin Swanson, head of commercial development
for viral vector gene therapy, Lonza Pharma & Biotech. As an
example, she points to the widely used transient transfection
process for associated adeno virus and lentivirus (AAV and LV,
respectively) production, which mainly uses adherent cells and
lacks scalability and lot-to-lot consistency due to variability in
vecto
rfu
sio
nart
- S
tock
.Ad
ob
e.c
om
CYNTHIA A. CHALLENER, PHD, is a contributing editor to
BioPharm International.
FOR PERSONAL, NON-COMMERCIAL USE
Biopharmaceutical ServicesFrom concept to market
For further details contact customer services on:
Tel: +44 (0)118 918 4076 Email: [email protected] Web: www.rssl.com
Ensuring the identity, purity,
safety and quality of your
biopharmaceutical at
every stage.
Your trusted partner for:
�y Raw materials testing
�y Biopharmaceutical
characterisation
�y Cell-based assays
�y Safety testing
�y ICH stability testing
�y Release testing
�y Troubleshooting and
contaminant identification
...whenever you need us.
Outstanding quality, scientific
excellence and customer satisfaction
NEW
FOR PERSONAL, NON-COMMERCIAL USE
28 BioPharm International September 2019 www.biopharminternational.com
Cell and Gene Therapies
transfection efficiencies. In addition, she
notes that many downstream processes
for early-stage clinical production often
employ gradient centrifugation steps that
lack the ability to be furthered scaled.
“Overall the volumetric productivity
of virus particles per cell from culture
systems and complete virus recovery
rates through downstream processing
are sub-optimal among existing pro-
duction systems, both of which nega-
tively impacts COGS. As a result,
the lack of standardized production
platforms that support industrialized
scale processes is the leading challenge,”
Swanson concludes.
Further complicating the situation is a
lack of standardized and advanced analyt-
ical methods for vector characterization
and release testing (including in-process
samples), which makes it difficult to have
well-understood manufacturing processes
before incorporating process improve-
ment steps, according to Swanson. Other
challenges include a lack of automation
in key steps of the manufacturing process;
immature supply chains, which creates
risk and leads to a lack of standardization/
innovation of critical raw materials; and
rapidly advancing regulatory pathways
that are complex to manage among dif-
ferent jurisdictions.
INCREASING URGENCYMany of these challenges have existed
for several years, with some develop-
ments occurring along the way. For
instance, Theelen observes that novel
scalable bioreactor systems, the imple-
mentation of continuous bioprocess-
ing, and the introduction of new resins
for viral vector purification are hav-
ing an impact. “Several companies are
developing suspension-based processes
and implementing stable producer cell
lines,” he notes. However, he adds that
even though stable cell lines have the
potential to significantly reduce COGS,
developing robust processes using
these stable cell lines is still a challenge.
The same is true for suspension-based
processes, which currently require sig-
nificant investments in process develop-
ment and extend the time to market.
What has largely changed, according
to Swanson, is the timeline for over-
coming these challenges. “It is critical
to meet the clinical and commercial
manufacturing needs for these curative
therapies, and the need is becoming
more urgent due to the rapid advance
of clinical progress. The lack of manu-
facturing scalability has created a vector
shortage, and the collection of suffi-
cient vector chemistry, manufacturing,
and controls (CMC) information has
become a bottleneck during the product
development lifecycle,” she asserts.
Theelen adds that to ensure that
more gene and other next-generation
therapies reach patients, reducing
COGS is necessary to increase avail-
ability, facilitate reimbursement, allevi-
ate the burden on healthcare budgets,
and ensure that innovator companies
can offer their products at an afford-
able price while maintaining sustainable
gross margins. “Scalable and reliable
technologies for cost-effective cell and
gene therapy manufacture will reduce
the reliance of biopharmaceutical com-
panies on hard-to-acquire expertise
and dependence on contract develop-
ment and manufacturing organizations
(CDMOs),” he says.
Additionally, Theelen notes that
developing technologies that facilitate
process and product development will
shorten the time-to-market and reduce
development costs, while increasing the
number of technology candidates will
intensify competition and finally drive
down materials and equipment costs.
INNOVATION IS A PRIORITYTechnology innovation is key to
addressing the challenges associ-
ated with large-scale GMP viral vec-
tor manufacturing, agrees Tania Pereira
Chilima, NevoLine product manager at
Univercells. “Solutions that are tailored
for gene therapy manufacture and com-
bine a low capital investment, scalability,
ease-of-operation, and robustness while
maintaining product quality are needed,”
she comments.
It is also important that these tech-
nologies also are able to accommodate
the manufacture of gene therapy prod-
ucts with low and high annual demands
in order to ease the development and
commercialization of personalized gene
therapies and viral vector-based vaccines.
Lowering the capital investment is also
necessary for reducing the entry barriers
for gene therapy start-up companies.
Swanson adds that all of the major
challenges must be tackled concurrently
in order to address the manufactur-
ing challenges. “The optimal goal is to
deliver products that will meet target
product profiles with defined quality
attributes while realizing the need to
increase process productivity and reduce
COGS,” she says.
ROLE OF CDMOsCDMOs have a vital role to play when it
comes to manufacturing innovation for
viral vector production. “Given the fast
pace of clinical development timelines
and the unconventional demand curve
of curative therapies, CDMOs offer
competitive advantages not only from a
manufacturing technology advancement
perspective, but also from a cost perspec-
tive with respect to optimizing capital
expenditures and better managing oper-
ating expenses,” Swanson states.
Pereira Chilima agrees that CDMOs
are a major gateway for the adoption
Complicated
processes and
sub-optimal
yields impact the
COGS for large-
scale viral vector
manufacturing.FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 29
Cell and Gene Therapies
of new technologies. “Many estab-
lished gene-therapy developers rely on
CDMOs throughout all stages of prod-
uct development and even once they
reach the commercialization stage. The
expertise of CDMOs in large-scale pro-
duction helps cell therapy developers
evaluate different avenues for cell therapy
manufacture and select the technologies
to be used once they decide to internalize
product production,” she explains.
CDMOs are also in the unique
position of developing and providing
manufacturing platform processes that
will allow drug developers to focus on
product innovation and significantly
shorten the gene-to-product develop-
ment timeline, according to Swanson.
ACHIEVING SOME PROGRESSOne of the most important devel-
opments highlighted by Swanson has
been the transitioning of cell-culture
processes from an adherent format to a
suspensions format via cell-line adapta-
tion, which is enabling better scalability.
Development of stable producer cell lines
is also reducing process variability and
enabling the adoption of intensified pro-
cessing solutions. A better understanding
of the important qualities of critical raw
materials, such as animal serum, plasmids,
non-chemically-defined media, and the
extractables/leachables associated with
single-use technologies has also helped to
address some manufacturing challenges.
Incorporating design-of-experiment
study principles and use of improved bio-
process control and data analysis software
are allowing process development/opti-
mization to be conducted at the mul-
tiparameter level, while new analytical
methods, such as more accurate viral vec-
tor quantitation techniques, provide a
better understanding of impurity profiles
and allow for better process monitor-
ing. In downstream processing, density-
gradient centrifugation is being replaced
with chromatography methods for more
consistent and efficient operations.
Collaboration between the different
stakeholders in the industry is neces-
sary to build on preexisting expertise
and capitalize on academic innovation
to help guide technology developers on
the gaps that must be addressed in the
industry, according to Pereira Chilima.
Adds Swanson, “Col laborat ion
between members of the value chain,
ranging from innovators, manufactur-
ers, and reagent and equipment sup-
pliers to regulators, as well as close
collaboration between academic and
industry partners, is critical in driving
solution development.”
Pereira Chilima also notes that
involving the regulatory bodies and
payers early on is needed to reduce
regulatory barriers and ensure adequate
reimbursement.
These types of collaborative efforts
are ongoing, she says. Good examples
include the efforts made by the Cell
and Gene Therapy Catapult and Cobra
Biologics to investigate continuous man-
ufacturing. Univercells is also actively dis-
cussing promising collaborations with
established gene therapy companies
with the aim of combing its expertise to
develop manufacturing solutions for end-
to-end viral vector production for gene
therapy applications.
PLATFORM DEVELOPMENT Lonza has invested substantial internal
research and development efforts in plat-
form development, particularly in the
area of AAV and LV production. Specific
focus areas include scalable suspension-
based transient transfection processes
and stable producer cell-line technolo-
gies, according to Swanson. Concurrently,
the company is investing in the develop-
ment of novel analytical methods and
new media formulations with the aim to
provide turn-key solutions.
Separately, Lonza has invested heav-
ily in a manufacturing capacity expan-
sion with the opening of its dedicated,
300,000-sq.-ft. cell- and gene-therapy
facility in Houston in 2018. The facil-
ity uses an extensive modular design
concept and employs single-use tech-
nologies to allow clients quick access to
scaled-up production capacity based on
project needs.
Univercells, meanwhile, has devel-
oped the NevoLine platform, a modular
and automated manufacturing system
delivering affordable viral products such
as vaccines and gene therapy vectors.
This design of the NevoLine platform
relies on a modular approach, allow-
ing for a variety of configurations that
provide tailored solutions for a range of
products, according to Pereira Chilima.
Viral-vector-specific NevoLine plat-
forms can be designed for enabling
AAV or LV manufacture for small- and
large-scale applications.
At the core of the NevoLine platform
lies the scale-X fixed-bed bioreactor
coupled with in-line product concentra-
tion to intensify upstream processing and
deliver large product quantities within a
reduced footprint. “Intensification of each
unit steps allows for drastic footprint
reduction, enabling the entire process to
be placed in self-contained modules such
as isolators or biosafety cabinets,” Pereira
Chilima explains. “The platform aims to
minimize the capital investment for gene
therapy manufacturers while delivering
the low COGS and flexibility required
to support the development and com-
mercialization of gene therapy products,
eventually ensuring their availability to
patients,” she says. ◆
Collaborative
efforts between
innovators,
academia,
regulators, and
suppliers are
essential to
drive solutions.
FOR PERSONAL, NON-COMMERCIAL USE
30 BioPharm International September 2019 www.biopharminternational.com
Quality
Best Practices for Studying Stability in Biologics
Industry experts discuss the challenges and regulations of setting up a CGMP-compliant stability testing program.
SUSAN HAIGNEY
BioPharm International spoke with Bhroma Patel, head
of product stability, and Baldev Jogi, lead scientist,
both at Lonza; and Will Hatcher, senior manager, QC,
and Rekha Patel, director, biologics analytical solutions, both
at Catalent, about what steps companies need to take when
setting up a current good manufacturing practice (CGMP)-
compliant stability testing program for biologics.
BEST PRACTICES IN STABILITYBioPharm: What are the first steps for setting up a CGMP-
compliant stability program for biologics?
Hatcher (Catalent): The first step in setting up a CGMP-
compliant stability program is to determine the analytical assays
that are stability-indicating and to verify that the method qualifi-
cation/validation has been performed appropriately to prove that
these assays are indeed stability-indicating. After the analytical
assays are determined, the next step is to set up the stability strat-
egy, which will include long-term stability at the determined stor-
age condition, short-term stability (accelerated and stressed), and
possibly photostability or freeze/thaw studies. It is very important
to be conservative with regards to timepoints within a stabil-
ity study. If the appropriate amount of data [are] not gathered
at the appropriate conditions, then it is possible that an entire
study would need to be repeated, which becomes extremely time-
consuming and costly, and could be detrimental to a regulatory
filing timeline.
Bhroma Patel and Jogi (Lonza): An amendment
agreement is required between the clients and outsourcing
company to see what stages of work [are] required from start
to end. This will include objective, activities (e.g., timepoints,
temperatures, and intended storage temperature), test meth-
ods, and delivery of reports. In addition to this, methods and
equipment require validation and specifications put in place
prior to starting the stability study.
BioPharm: What challenges should companies be aware of
when setting up a CGMP stability program for biologics?
Bhroma Patel and Jogi (Lonza): The challenges com-
panies must be aware of when setting up the GMP stability
programs are that regulatory requirements, such as the ICH
[International Council for Harmonization] guideline, are fol-
lowed throughout the stability program, from pilot stability
studies to drug product studies. Companies may require large Orl
an
do
Flo
rin R
osu
- S
tock
.Ad
ob
e.c
om
FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 31
Quality
facilities for laboratory capacity, storage, as
well as stability chambers under different
climatic conditions and relative humidity
and freezers. In addition, companies are
required to develop, validate, and evaluate
testing methods and equipment to per-
form stability studies.
Rek ha Pa te l (C a t a len t ) :
Companies should ensure that they have
redundancies in power, water, and air han-
dling systems as well as appropriate alarm
notification systems, to safeguard against
possible impacts to the study. To ensure
integrity of the study, sample traceabil-
ity and inventory systems should also be
in place. Having a sufficient volume of
materials should not be overlooked. Study
coordinators should ensure that they have
enough materials to progress through
the study as well as any investigations or
extensions. If special studies are needed,
such as freeze/thaw, in-use, forced degra-
dation studies, photostability, etc., proper
material amounts should be ensured as
volume is often a challenge.
Study coordinators should ensure that
methods are proven to be stability-indi-
cating during qualification/validation, are
appropriately set up beforehand, and that
orthogonal methods are available where
appropriate. Analytical methods may
change going from early to late phase (e.g.,
moving from ELISA [enzyme-linked
immunosorbent assay]-based to cell-
based), and investigators should plan for
any bridging activities that may be needed.
Appropriate planning also includes a thor-
ough understanding of the study matrix
and any special handling required. The
timing of the study should be laid out
to meet any critical regulatory filings. If
planning to file globally, consider testing
conditions specific to different regions in
the same study, as this will provide suf-
ficient data without the time and cost
needed to conduct a separate study.
REGULATORY EXPECTATIONSBioPharm: What are the specific
regulatory requirements for a CGMP-
compliant stability program?
Bhroma Patel and Jogi (Lonza):
The specific regulatory requirement
for stability programs for biologics are
defined in ICH guidelines with ref-
erence to ICH Q1A (R2), Stability
Testing of New Drug Substances and
Products, ICH Q5C, Stability Testing for
New Dosage Forms, and EMA/CHMP/
BWP/534898/2008 rev. 1 corrigendum,
Guideline on the Requirements for Quality
Documentation Concerning Biological
Investigational Medicinal Products in
Clinical Trials. For recommendations
on how to establish shelf life or retest
period based on stability studies, ICH
Q1E, Evaluation of Stability Data, is
followed. In total there are six ICH
basic guidelines for stability studies,
Q1A to Q1F.
Hatcher (Catalent): The regula-
tory requirements for CGMP stabil-
ity programs mainly come from ICH
guidelines, specifically: Q7 11.5, Q1A
(R2), Q1B, Q1C, Q1D, Q1E, Q5C.
There are also regulations from the
FDA (21 Code of Federal Regulations
211.166) and European Medicines
Agency (EMA) (Guideline 3AB5a)
that govern what should be contained
in a stability strategy. In addition to
these regulations, FDA provides guid-
ance that can help determine an appro-
priate stability study strategy.
With this bolus of information, it can
be challenging to determine a clear sta-
bility strategy. However, as long as the
assays performed are stability-indicating
and the stability strategy includes long-
term at storage condition, accelerated
and stress stability studies, in most cases
this can be enough for an initial filing.
As a product moves through the clini-
cal lifecycle, photostability and freeze/
thaw studies will need to be performed.
Additionally, depending on the proper-
ties of the product and the results of the
stability studies, additional studies may
be warranted.
BioPharm: Can you provide an
example of how a company can ensure
their stability program is following reg-
ulations?
Bhroma Patel and Jogi (Lonza):
Companies can ensure [the] stability pro-
gram is following regulations by [creating]
standard operating procedures (SOPs) to
help set up stability studies and protocol
in compliance with regulatory expecta-
tions.
[A] stability program should be
described in the protocol to support
the shelf life and storage condition and
include:
• Objective/scope of the study (e.g.,
the stability study results may form
part of submissions to the regulatory
authorities to support the use of the
product in toxicological studies and
clinical trials).
• Storage conditions (e.g., intended,
accelerated, and stress storage
conditions)
• Sampling plan (e.g., samples to be
tested at 0, 3, 6, 9, 12, 18, 24, and 36
months)
• Stability indicating parameters for
testing of product characteristics,
identity, potency, purity, and safety,
which have been developed and
validated
• Stability test methods (e.g., capillary
electrophorsis sodium dodecyl sulfate
[CE SDS], image capillary isoelectric
focusing [icIEF], gel permeation
chromatography [GPC], ELISA),
which have been qualified for usage
• Acceptance criteria (e.g., limits for the
test results)
• Reference standard to compare the
sample against
• Approval process (e.g., approved by
quality assurance [QA])
• Stability chambers are serviced,
inspected, calibrated, and qualified
regularly
• Out of specification and out of trend
SOPs
• QA regulated
• Evaluation of the acquired data to
provide a shelf life
• Trained operators, which includes
GMP training and data integrity
training annual.
FOR PERSONAL, NON-COMMERCIAL USE
32 BioPharm International September 2019 www.biopharminternational.com
Quality
BioPharm: Can you provide any
examples of mistakes companies have
made when preparing stability stud-
ies for investigational new drug (IND)
submissions?
Bhroma Patel and Jogi (Lonza):
As a CDMO [contract development and
manufacturing organization], the biggest
issue we encounter is often around data.
For example, companies provide insuf-
ficient data and information to support
stability of drug substance or informa-
tion is erroneous due to lack of time to
prepare for IND submission. Failure to
follow FDA guidance or to summit all
the information required from the IND
submission checklist is another potential
oversight.
Hatcher (Catalent): The main mis-
take that companies make when setting
up their stability strategy is not perform-
ing accelerated, stressed, photostability,
or freeze/thaw stability studies. Often, a
process will change throughout the clini-
cal development of a product, and with
these changes comes the need to repeat
stability studies. I have seen a trend where
companies will not repeat the accelerated
or stressed stability; however, they will
repeat standard stability at the storage
condition for the product. This is a very
risky strategy, as regulators will want data
to show that the change in the process
did not impact the stability of the prod-
uct, including stressed and accelerated
stability studies.
OUTSOURCING STABILITYBioPharm: What are the benefits of
outsourcing CGMP stability studies for
biologics?
Bhroma Patel and Jogi (Lonza):
Companies have access to regula-
tory experts and can meet the most
up-to-date regulatory requirements.
Companies can meet their needs and
requirements (planning and designing
stability studies). [There is] cost sav-
ing, as large amount of capital is not
required on resources, such as on analyt-
ical equipment and stability chambers.
[They can] gain scientific and analytical
knowledge for data generation, inter-
pretation, and reporting. [Outsourcing]
enables companies to focus internal
resources on new drug discovery and
development.
Hatcher (Catalent): The main
benefit of outsourcing CGMP stability
studies for biologics is that CMOs are
exposed to many different strategies
from sponsors and, therefore, have a
good handle on trends in the industry.
This level of expertise can be very ben-
eficial for the sponsor and will ensure
that the stability program is compliant
and up to date with trends in the indus-
try. Another benefit is the analytical
expertise that CMOs possess because
the analysts in a QC [quality control]
CMO laboratory are familiar with sev-
eral types of analytical methods, which
means CMOs are well placed to help
the sponsor troubleshoot methods to
make improvements when there are
issues.
Outsource facilities also typically have
significant storage space and analytical
instrumentation. This helps the sponsor
know that there will not be equipment
or space constraints that could negatively
impact their stability program.
BioPharm: What are the challenges
of outsourcing CGMP stability studies
for biologics?
Hatcher (Catalent): The main chal-
lenge from a CDMO perspective is when
a sponsor changes the stability strategy
late in the game. This can be detrimental
to the timeline and ultimately could delay
approval. Another challenge is balancing
cost-savings versus performing stabil-
ity using a conservative approach. There
are times when a sponsor is focused on
cost-savings and then limits the stability
program, only to have to come back later
and perform the study again. This is why
it is very important to perform the study
in a conservative manner, to avoid having
to repeat.
Bhroma Patel and Jogi (Lonza):
Finding a trusted outsourcing partner
with the right level of expertise and
process knowledge, as well as the right
assets and technology is key. Without
this, delivery may be late or below expec-
tations, leading to a delay in progress-
ing drug production to the next level.
Confidentiality and security are essential
to avoid breaches of proprietary informa-
tion in a multi-customer facility.
Lastly, a strong track record of qual-
ity compliance and experience working
with regulatory bodies in different juris-
dictions is also paramount.
BioPharm: How can a sponsor
company ensure their outsourcing facil-
ity is following CGMPs?
Bhroma Patel and Jogi (Lonza):
Companies should conduct site audits
to verify outsourcing best practices
and standards of GMP. Also, to check
validated systems and processes, and
that staff are experienced and properly
trained. Checking the FDA, MHRA
[Medicines and Healthcare products
Regulatory Agency], etc., history of
an outsourcing partner as well as the
QA procedures in place ensures that an
established culture of regulatory com-
pliance and high standards exists.
Hatcher and Patel (Catalent):
When outsourcing stability studies, it
is important to ensure that the contract
provider can meet regulatory require-
ments. One way in which our company
helps reassure clients about CGMP
compliance is through on-site customer
audits, where auditors can dig into the
procedures and processes and verify that
appropriate regulations are followed.
Having the outsourcing facility provide
raw data to the client is also an excellent
way to provide transparency and confi-
dence in CGMP compliance.
When working with an outsourc-
ing facility, on-site audits should be
performed prior to setting down
any studies. In addition, the sponsor
should ensure that the stability cham-
bers to be used for the study are on
site at the provider location. Lastly,
the site’s regulatory history should be
reviewed to confirm that the site has
received approval from all relevant
regulatory agencies. X
FOR PERSONAL, NON-COMMERCIAL USE
LIVE WEBCAST: Monday, September 16, 2019 at 9am EDT | 2pm BST | 3pm CEST
Register for this free webcast at: http://www.biopharminternational.com/bp_p/bioreactorsAll attendees will receive a free executive summary of the webcast!
EVENT OVERVIEWStirred-tank bioreactors are gaining more and more importance in the industrial production of pharmaceutical products, biofuels and food. When compared with 2D-cultivation systems, bioreactors are easy to handle, and multiple bioreactors can be controlled in parallel without a considerable increase of workload. In stirred-tank bioreactors cells can be cultivated as free cells in solution, cell aggregates or on microcarriers in batch, fed-batch or continuous cultivation modes.
8LI�ƼVWX�TEVX�SJ�XLMW�[IFGEWX�[MPP�JIEXYVI�E�VIZMI[�SJ�XLI�FEWMG�TVMRGMTPIW� of stirred-tank bioreactors. Ankita Desai of Eppendorf North America will explain factors that must be considered before and during the process, how to set up perfect conditions for cells, and how the WLETI�SJ�XLI�MQTIPPIV�MRƽYIRGIW�XLI�WXIQ�GIPP�GYPXYVI�
Within the second part, Arie Reijerkerk and Farbod Famili from Ncardia, a stem cell drug discovery and development company, will provide insight into how the advent of human-induced pluripotent stem cell (hiPSC) technology has substantially expanded the availability of human cells for drug discovery. The availability of these cells helps researchers to uncover the potential for better translation to the clinic and reduction of late-stage drug attrition.
Ncardia will present a case study of large-scale manufacturing development and their hiPSC-based drug screening platform, DiscoverHIT, including results from the generation of disease- relevant human stem cell-derived models and the development of predictive, phenotypic assays to enable high-throughput screening.
KEY LEARNING OBJECTIVES• �-)���*0/�/# ��#�'' )" .��)��� ) �/.�
of stirred-tank bioreactors
• � � $1 �$).$"#/.�*)�/# ��$Ȃ - )/�$(+ '' -�/4+ .�
�)��/# $-�" *( /-4�*)�� ''�"-*2/#
• �-)���*0/�/# �� ) �/.��)���#�'' )" .�*!�
0+ѣ.��'$)"����$*- ��/*-�+-*� ..
• �-)���*0/�/# ��++'$��/$*)�*!��*)/-*'' ���$*- ��/*-�
+-*� .. .�/*��-0"��$.�*1 -4��)��� 1 '*+( )/
• � /�/# ��#�)� �/*�$)/ -��/�2$/#� 3+ -/.�$)���'$1 ��С��. ..$*)
Who Should Attend?
• ��$ )/$./.�$)�./ (�� ''�
�$*+-*� ..$)"��)��� ''�/# -�+4
• �-0"��$.�*1 -4�.�$ )/$./.
Presenters
Ankita Desai
Bioprocess Field Application Specialist
Eppendorf, North America
Dr. Arie Reijerkerk
Head of Services and Innovation
Ncardia
Dr. Farbod Famili
Project Leader
Assay Development and High Through-put Screening
Ncardia
Jennifer Markarian
Manufacturing Editor
BioPharm International
Presented bySponsored bySponsored by
From Small-Scale Stem Cell Production to Large-Scale hiPSC-Based Drug Development: The Flexibility of Stirred-Tank Bioreactors
FOR PERSONAL, NON-COMMERCIAL USE
34 BioPharm International September 2019 www.biopharminternational.com
Biosimilars
Methods Accelerate Biosimilar Analysis
Effective application of mass-spectrometry tools can optimize biosimilar analysis, reducing development time and cost.
MARIO DIPAOLA AND INDU JAVERI
The backbone of biosimilar development is the ana-
lytical characterization performed on the innova-
tor—or originator or reference—product, initially
to define innovator product attributes and subsequently
on the biosimilar in development along with the innova-
tor product in order to demonstrate similarity. In May
2019, FDA published a draft guidance on the analytical
assessment and other quality-related considerations for
biosimilars, clarifying regulatory requirements and expec-
tations for demonstration of biosimilarity in support of a
marketing application (1).
As the foundation in the development of biosimilars is
the analytical strategy, this paper reviews effective analyti-
cal methodologies available to perform in-depth character-
ization of both innovator and biosimilar products. Focus is
placed mainly on high-resolution mass spectrometry (HR-
MS) for primary structural analysis and characterization
of post-translational modifications and various biophysical
techniques for higher-order structural analysis, while con-
sidering the FDA draft guidance.
US BIOSIMILAR APPROVAL ROADBLOCKSAs of Aug. 1, 2019, FDA has approved 21 biosimilars; of
these, only five are currently commercially available. Of the
approved drugs, five are biosimilars of trastuzumab; three
are biosimilars each of infliximab and adalimumab; two are
biosimilars each of filgrastim, pegfilgrastim, etanercept, and
bevacizumab, respectively; and one is a biosimilar each of
rituximab and epoetin.
Currently, the development of biosimilars is lengthy,
taking up to seven years to gain approval; the effort is
relatively expensive, costing between $150–$200 million
per biosimilar product. Identifying analytical method-
Bill
ion
Ph
oto
s.co
m -
Sto
ck.A
do
be
.co
m
MARIO DIPAOLA is head of operation, and INDU JAVERI is president and CEO, both with CuriRx, Inc., Wilmington, MA.
FOR PERSONAL, NON-COMMERCIAL USE
Register for this free webcast at: http://www.chromatographyonline.com/lcgc_p/data_system
Event Overview
Bioanalytical studies performed with LC-MS are a fundamental part of the drug-development process; ĉŠŖƓĶŖƙìŎŎƺ�ĖƳŠŎƳĶŖĬ�ƃĖĬƙŎìƓŠƃƺ�ĬƙĶďĖŎĶŖĖƊ�ìŖď�ĶŖƓĖŖƊĶǟĖď�
demands on data integrity mean that traceability, accuracy, and integrity of any associated data is vital to ensure the safety of therapeutic products.
In this webcast, you will learn how seamless integration of chromatography, mass spectrometry (both Quadrupole and High Resolution), chromatography data system (CDS) software and your laboratory information management system (LIMS) create a compliant, secure, scalable, and reliable solution for bioanalysis studies whilst increasing
ŎìĈŠƃìƓŠƃƺ�ĖǜĉĶĖŖĉƺ�ìŖď�ƓIJƃŠƙĬIJƀƙƓɐ
Key Learning Objectives
• DĶŖď�ŠƙƓ�IJŠƴ�ì�ƊŠīƓƴìƃĖ�ƴŠƃŋǠŠƴ�ďĖƊĶĬŖĖď�ƓŠ�ŕĖĖƓ�ƓIJĖ�
needs of bioanalysis can streamline your processes
• Learn how a CDS can expand the potential for quadrupole and high-resolution mass spectrometry within your laboratory
• Discover how the use of a single-software platform ĉìŖ�ĶŖĉƃĖìƊĖ�ƀƃŠďƙĉƓĶƳĶƓƺ�ìŖď�ŠƀƓĶŕĶǃĖ�ĖǜĉĶĖŖĉƺ� using compliance tools, networking capabilities,
data processing, and more
For questions or concerns, email
Solving Problems When Using FT-IR
LIVE WEBCAST: Thursday, Sept. 26, 2019 at 9am EDT | 2pm BST | 3pm CEST
Sponsored by
Presented by
Expanded Capabilities for
Bioanalysis Leveraging a
Chromatography Data System
¡ƓƃĖìŕŎĶŖĖ�ÑŠƙƃ�d!ɥl¡�ËŠƃŋǠŠƴƊ
Presenters
Peter Zipfell
Product Marketing Manager
ªIJĖƃŕŠ�DĶƊIJĖƃ�¡ĉĶĖŖƓĶǟĉ
Kaylynn Chiarello-Ebner
Managing Editor
Special Projects
Who Should Attend:
• Laboratory Technicians / Operators
• Laboratory Managers /
Supervisors / Directors
• Quality Assurance Managers
• Pharmaceutical Quality Control
Analytical Scientists
FOR PERSONAL, NON-COMMERCIAL USE
36 BioPharm International September 2019 www.biopharminternational.com
Biosimilars
ologies that provide the necessary
characterization and product com-
parability data in a shorter time can
reduce the overall product develop-
ment cycle time and, consequently,
development costs. Various analyti-
cal approaches can fit the goal of
reducing development time and cost
for biosimilars.
MASS SPECTROMETRY TOOLSMass spectrometry has been a key
technology for the characteriza-
tion of the originators’ products and
to perform comparability studies
between innovator product and bio-
similar molecules. The new genera-
tion of mass spectrometers, including
time-of-flight (ToF) instruments,
as well as hybrid systems such as
quadrupole (Q)–ToF, ion trap–ToF
or ToF–ToF, and orbital ion trap
mass spectrometers offer high mass
resolution and mass accuracy. Using
this new generation of equipment
introduced in the past five years, it
is possible to extract several product
attributes by simply determining the
intact mass of the molecule. The data
provided in Table I and illustrated in
Figures 1 and 2 demonstrate prod-
uct characteristics that can be quickly
derived from the determined intact
mass profile by a Q-ToF HR-MS.
From the mass profiles presented in
the figures, it can be concluded that
both innovator and biosimilar prod-
ucts contain similar proteoforms; of
these, the most abundant is the G0F
glycoform. While similar species are
Table I. Summary of proteoforms identified based on intact mass analysis data.
Intact mass analysis by liquid chromatography/mass spectrometry
(electrospray ionization-quadropole time of flight)
Peak#
ProteoformsTheoretical
average mass (Da)
Observed average masses (Da) for
innovator product
Observed average masses (Da) for
biosimilar product
1 unsubstituted 146637.7 146637.7 146636.8
2 G0F-GlcNAc 147879.9 147879.2 147878.8
3 G0F 148083.1 148083.1 148083.0
4 G0F+1 Lys 148210.2 148209.1 148209.0
5 G1F 148244.3 148243.6 148244.0
6 G0F + 2 Lys 148339.4 148338.4 148340.1
7 G1F + 1 Lys 148372.4 148372.3 148371.2
8 G2F 148406.3 148406.1 148405.8
Amgen Wins Enbrel Patent Case, Sandoz to Appeal
The United States District Court for the District of New
Jersey ruled in Amgen’s favor on the validity of two
patents that describe and claim Enbrel (etanercept), the
company’s anti-inflammatory biologic, and methods for
making it, Amgen announced in an Aug. 9, 2019 press
release (1).
Amgen af f i l iates Immunex Corp. and Amgen
Manufacturing, Ltd, along with the owner and licensor
of the two patents, Hoffmann-La Roche Inc., brought
the patent infringement action in Federal Court against
Sandoz Inc., Sandoz International GmbH, and Sandoz
GmbH (together, Sandoz). Before trial, Sandoz, a division
of Novartis, acknowledged that its biosimilar etanercept
infringes seven patent claims in US Patent Nos. 8,063,182,
“Human TNF receptor fusion protein,”and 8,163,522,
“Human TNF receptor”. Trial proceeded only on Sandoz’s
challenges to the validity of those claims. The Court found
that Sandoz had not met its burden to prove all seven
asserted claims invalid.
Immunex/Amgen and Sandoz have entered into an
agreement with respect to a preliminary injunction
regarding Sandoz’s etanercept as set out in the Court’s
order of June 7, 2018.
Responding to the ruling, Sandoz has said it will
appeal to the US Court of Appeals for the Federal Circuit,
according to an Aug. 9, 2019 press release issued by
the company (2).
Sandoz is the first biosimilar company to receive FDA
approval for a biosimilar etanercept, Erelzi (etanercept-
szzs), which has been approved for nearly three years,
the company stated. However, the company has been
unable to launch the medicine because of the ongoing
patent litigation from Amgen. FDA approved Erelzi on
Aug. 30, 2016 for all indications included in Enbrel’s
product label.
References1. Amgen, “Amgen Wins Patent Case on Enbrel (etanercept),”
Press Release, Aug. 9, 2019. 2. Novartis, “Sandoz Will Appeal District Court of New Jersey
Ruling in Biosimilar Erelzi (etanercept-szzs) US Patent Case,” Press Release, Aug. 9, 2019.
—The editors of BioPharm International
FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 37
Biosimilars
present in both the innovator prod-
uct and the biosimilar product, close
inspection of peak intensities shows
that the innovator product has greater
enrichement of the G0F-GlcNAc
species relative to the biosimilar. In
turn, the biosimilar product displays
a higher level of the G2F glycoform
relative to the innovator molecule.
Intact mass analysis by HR-MS
can provide an abundance of informa-
tion about the integrity of the mol-
ecule and glycoforms comprising the
protein product or the presence of
oxidation, truncation, or other poten-
tial product modification. For more
detailed and accurate quantification
of these modifications and to identify
the sites where these modifications
occur, however, it is necessary to per-
form peptide mapping by liquid chro-
matography (LC)-MS/MS.
Such a quantitative approach,
involving large-scale, targeted search
of peptide mapping data has been
referred previously as a multi-attri-
bute method (MAM) (2). Figure 3
shows the typical output from the
peptide mapping of the innovator and
biosimilar products of a monoclonal
antibody as analyzed with a Q-ToF
mass spectrometer. A snippet of the
extracted data from the peptide maps
is summarized in Table II.
Based on the peptide mapping data,
summarized in Table II, the methio-
nine residue at position 256 in the
AA253-AA278 peptide is partially
oxidized; from the abundance val-
ues, it is calculated that 14.9% of this
methionine is in the oxidized form.
Additionally, the asparigyl residue at
position 319 is partially deamidated
with approximately 14.1% having con-
verted to the aspartic/isoaspartic form.
Furthermore, from the relative mea-
sured abundances, it can be quickly
determined that, of the glycoforms as
summarized in Table II, 97.7% cor-
respond to G0F, 1.3% to G1F, and
1.1% to G2F. It is quite clear from
this example that multiple product
attributes can be readily extracted and
quantified from the intact mass analy-
sis and peptide mapping.
CHARACTERIZING HIGHER-ORDER STRUCTUREHigh-resolution tandem mass spec-
trometry has shown to be quite use-
Figure 1. Intact mass profile of innovator product.
140441.2 143045.5 146638.2
148082.9
150678.1 152135.5 153813.8 156601.0 159730.3
146638.2
148082.9
148243.7
12
3
4
5
6 7 8
142767.8 145674.8
148082.8
150818.5 154086.7 156598.1 159171.2
146636.7147880.0
148082.8
148243.9
149681.1
12
3
5
4 6 7 8
Figure 2. Intact mass profile of biosimilar product.
FIG
UR
ES
CO
UR
TE
SY
OF
TH
E A
UT
HO
RS
FOR PERSONAL, NON-COMMERCIAL USE
38 BioPharm International September 2019 www.biopharminternational.com
Biosimilars
6 16 26 36 46 56 66 76 86 96
A(2
16-2
24)
AspN
A(1-29)
A(405-416)
A(152-215)B
(185-1
94)
B(1
51-1
66)
B(1
95-2
14)
A(6
2-7
2)
A(4
34-4
50)
A(4
17-4
50)
A(2
53-2
68)o
x
A(3
80-4
02)
D
A
(26
9-2
83
)
A(4
03-4
16)
A(2
84-3
15)
gly
co
syla
tio
n
A(2
53-2
68)
A(3
80-4
02)
A(2
74-2
83)
B(7
0-8
1)
B(8
2-1
21)
A(3
60-3
79)
B(1
7-6
9)
A(3
0-5
8)
A(1
09-1
51)
A
(225-2
52)B(1
85-2
14)
B(1
-16)
A(4
17-4
33)
A(7
3-8
9)
A(3
16-3
59)
B(1
70-1
84)
A(1
22-1
50
B(1
7-8
1)
Figure 3. Mirror image of peptide maps of reduced/alkylated and endo-Lys C digested monoclonal antibody product lots
(Upper: Innovator product; Lower: Biosimilar product).
ful for the characterization of primary
structure and both enzymatic and non-
enzymatic post translational modi-
fications of biologics. Until recently,
higher-order structures, including sec-
ondary and tertiary structures, were
mostly evaluated by a combination
of biophysical techniques, includ-
ing intrinsic tryptophan fluores-
cence, as well extrinsic fluorescence,
far- and near-UV circular dichroism,
Fourier-transform infrared spectros-
copy (FTIR), differential scanning
calorimetry (DSC), among others.
Unfortunately, these methods are low
resolution and fail to provide structural
details that distinguish among subtle
differences in higher-order structures.
Table II. Partial summary of peptide mapping data (innovator product lot).
Peptide Peptide sequence ModificationPredicted
mass (Da)
Measured
mass (Da)
Mass
deltaAbundance
A(152-214)DYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK
6712.3072 6712.3190 1.76 1186377
A(218-222) KVEPK 599.3643 599.3643 -0.01 3115089
A(227-250) THTCPPCPAPELLGGPSVFLFPPK 2618.3025 2618.3039 0.51 8279074
A(253-278) DTLMISRTPEVTCVVVDVSHEDPEVK 2954.4365 2954.4395 1.00 7197104
A(253-278) DTLMISRTPEVTCVVVDVSHEDPEVK Oxidation 2970.4314 2970.4333 0.62 1259040
A(279-292) FNWYVDGVEVHNAK 1676.7947 1676.7948 0.03 3030949
A(293-321) TKPREEQYNSTYRVVSVLTVLHQDWLNGK 3459.7899 3459.7939 0.65 11536
A(293-321) TKPREEQYNSTYRVVSVLTVLHQDWLNGKG0F
Deamidation4905.3078 4905.3180 2.08 231089
A(293-321) TKPREEQYNSTYRVVSVLTVLHQDWLNGK G0F 4904.3238 4904.3264 0.54 1381426
A(293-321) TKPREEQYNSTYRVVSVLTVLHQDWLNGK G1F 5066.3766 5066.3836 1.38 21069
A(293-321) TKPREEQYNSTYRVVSVLTVLHQDWLNGK G2F 5228.4294 5228.4296 0.04 17590
FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 39
Biosimilars
It is possible to use multidimen-
sional nuclear magnetic resonance
(MD–NMR) or X-ray crystallography
to obtain detailed analysis of both sec-
ondary, tertiary, and—as applicable—
quaternary structures, but these latter
methods are very time consuming and
quite expensive to run and certainly
not suitable to be easily applied for
the analysis of multiple lots.
Mass spectrometry has also been
found to be quite useful in provid-
ing detailed higher-order structural
information in a very timely man-
ner. These methods, which include
native ion-mobility mass spectrom-
etry (nIM–MS), collision activated
ion-mobility mass spectrometry, and
hydrogen-deuterium exchange mass
spectrometry (HDX–MS), are sub-
stantially less time consuming than
MD-NMR or X-ray crystallography
and can be easily applied across mul-
tiple lots for comparability studies.
Furthermore, the output from these
MS techniques is substantially more
informative than the low-resolution
biophysical methodologies.
In a publication by Upton, et al.,
the authors, using the combination
of IM–MS, HDX–MS, and colli-
sion-activated IM–MS, were able to
detect some minute differences in
higher- order structures among lots
of innovator Herceptin (3). While
nIM-MS and, more so, collision-
activated IM-MS have gained trac-
tion in the past few years in their
applicability for analysis of higher
structures of biopharmaceutical mol-
ecules, HDX–MS has been avail-
able for quite some time and has
been used in several comparabil-
ity studies between innovator and
biosimilar products (4). With the
introduction of more advanced soft-
ware to analyze HDX–MS data,
such as Deuteros (5), it is expected
that HDX–MS will become a more
widely used tool in the analysis of
biosimilars for demonstrating com-
parability to their respective innova-
tor products.
It is worth noting that IM has
also been used for top-down analy-
sis of proteins, even when coupled
with medium-resolution mass spec-
trometers, yielding two-dimensional
spectra. By means of two new data
analysis programs, IMTBX (IM
Toolbox) and Grppr (Grouper), the
two-dimensional spectra have been
easily and automatically processed to
obtain not only full protein sequence
but also post-translational modifica-
tions (6).
CONCLUSIONThe biosimilar industry in the United
States has been evolving more slowly
than anticipated and drug competi-
tion that would have resulted in lower
costs for biologics has yet be real-
ized. One of the reasons for this slow
start in biosimilars commercialization
is partially due to patent litigation;
however, development time and over-
all costs for biosimilars have certainly
played a central role in the failure
of biosimilars to meet commercial
expectations.
Shor tening the deve lopment
time by using more efficient ana-
lytical technologies, as discussed in
this paper, not only will speed up
the introduction of these follow-
on biologics but will also decrease
the development costs. Shortening
the development cycle and reduc-
ing development costs should entice
more biopharmaceutical as well as
start-up companies to enter the bio-
similar space, resulting in increased
competition that should translate into
reduced costs for these biologics on
behalf of the consumers.
REFERENCES1. FDA, Draft Guidance to Industry;
Development of Therapeutic
Protein Biosimilars: Comparative
Analytical Assessment and Other
Quality-Related Considerations
(Rockville, MD, May 2019).
2. R. S Rogers, et al., Mabs, (5),
881-890 (2015).
3. R. Upton, et. al., Chem Sci., 10 (9),
2811-2820 (2019).
4. R.E. Iacob, et. al., LCGC, 35(6),
382-390 (2017).
5. A.M. Lau, et.al., Bioinformatics,
2019, 1-3 (Jan. 14, 2019).
6. D.M. Avtonomov, et. al, Anal.
Chem., 2018, 90(3), 2369-2375. ◆
Turning to Plant Cell Culture for Sustainability
In an effort to develop a sustainable means to manufacture a
therapeutically important molecule, Agenus Inc., a Lexington,
MA-based immuno-oncology company, is developing
a method to produce its proprietary QS-21 Stimulon, an
adjuvant used in the manufacture of vaccines, from a plant
cell-culture-based process. Currently, the molecule is derived
from a saponin extract of the Chilean soap bark tree and
purified into an extract. Earlier in 2019, however, the Bill &
Melinda Gates Foundation awarded the company a grant of
approximately $1 million to develop an alternative, plant cell
culture-based manufacturing process to ensure a continuous
future supply of the adjuvant, which boosts the immune
respons of vaccines through multiple mechanisms.
Jennifer Buell, PhD, chief operating officer at Agenus,
discussed the company’s work on developing this new
process with BioPharm International. To read the full article,
go to www.biopharminternational.com/agenus.
—Feliza Mirasol
FOR PERSONAL, NON-COMMERCIAL USE
40 BioPharm International September 2019 www.biopharminternational.com
Analytical Methods
Improving Oligonucleotide AnalysisOligonucleotides, which are classified as both small molecules and
biomolecules, pose unique analytical challenges. High-resolution mass spectrometry is becoming a method of choice for their development.
ANJALI ALVING
Oligonucleotides (polymeric sequences of RNA and
DNA) are becoming increasingly vital research tools
due to their ability to inhibit genes or to function as
aptamers to interact with protein targets. Over the next six
years, demand for oligonucleotides in areas that include gene
therapies is expected to grow by 20.6% per year to reach
US$3697 million by 2026 (1).
One of the ways in which oligonucleotides work is by
targeting RNA function at the cellular level, where specific
malfunctioning genes can be targeted, manipulated, and/or
modulated (2). Robust, accurate analytical characterization
of oligonucleotides is necessary in order to confirm their
identity, and to determine purity, quality, and strength. A
wide range of oligonucleotides are available for clinical and
research use, with specific tools ranging in size, chemical
modifications, and degree of conjugation.
The diversity of oligonucleotides has made their analysis
challenging, necessitating the development of new ana-
lytical techniques that can address the varied tasks in a
high-throughput environment. This article highlights mass
spectrometry (MS) techniques that are improving the analy-
sis of oligonucleotides and enabling high-throughput analysis.
Oligonucleotides are commonly produced through syn-
thetic solid-phase chemical synthesis, and precise analytical
characterization is required to confirm identity, determine
safety, and to identify and quantify contaminants. Numerous
impurities must be identified and removed, and post-syn-
thesis processing must be monitored. Due to the complexity
and diversity of oligonucleotides in clinical development,
for example, differences in identity, structure, biological
potency, and physiochemical properties, a range of analyti-
cal approaches has been developed. These methods include
liquid chromatography–mass spectrometry (LC–MS),
high-performance liquid chromatography (HPLC), nuclear
magnetic resonance (NMR), Fourier transform infrared
spectroscopy (FTIR), and polyacrylamide gel electrophoresis
(PAGE).
Oligonucleotide analysis is an essential part of drug devel-
opment, registration, and quality control (QC), so methods
that are capable of separating and identifying impurities must
be established.
zin
kevyc
h -
Sto
ck.A
do
be
.co
m
ANJALI ALVING, [email protected], is a senior scientist for pharmaceuticals and biopharmaceuticals at Bruker Daltonics.
FOR PERSONAL, NON-COMMERCIAL USE
Covering the science and business
of biopharmaceuticals• Quality/Analytics • Upstream Processing • Downstream Processing
• Peer-Reviewed Technical Notes • Product Spotlight • Perspectives on Outsourcing
Sign up for a FREE print or digital subscription today biopharminternational.com/subscribe
FOR PERSONAL, NON-COMMERCIAL USE
42 BioPharm International September 2019 www.biopharminternational.com
Analytical Methods
The limited accuracy and speed of
electrophoretic techniques such as
PAGE have led the industry towards
HPLC for the separation of oligonu-
cleotides for analysis. However, oli-
gonucleotides with similar molecular
weights present a challenge for HPLC,
particularly those with higher molecu-
lar weights, so development of robust
MS methods to characterize and quan-
titate oligonucleotides and synthesis
contaminants has become a key focus.
HPLC-MS is superior due to its com-
bination of high mass accuracy, high
throughput, reproducibility, robustness,
sensitivity and precision that the other
analytical techniques lack.
Determining molecular weight and
confirming the nucleotide sequence
of an oligonucleotide are fundamental
criteria for establishing the molecule’s
identity, which is a regulatory require-
ment. Oligonucleotide synthesis is
a complex process that requires more
than 100 sequential chemical reactions
to make a single 25-base sequence (3),
and the quality of each synthesized oli-
gonucleotide must be evaluated prior to
use to ensure that the correct sequence
was made and that purity meets regu-
latory standards.
Numerous methods can be applied
to obtain this information, and devel-
opments in high-resolution MS in
particular have provided a viable alter-
native to other methods such as PAGE,
offering significantly better accuracy
for the determination of both mass and
sequence of oligonucleotides. PAGE
is a subjective method of analysis and
can only give average mass informa-
tion whereas MS is a high resolution
technique and high resolution accurate
mass (HRAM) mass spectrometers can
provide monoisotopic mass information
of the oligonucleotides.
Oligonucleotides are considered
neither small nor large molecules,
leading to many regulatory challenges
and a lack of guidance. The variety in
their structure (i.e., whether they are
single or double-stranded), molecular
weight, molecular size, and number of
negative charges all affect the molec-
ular interaction with targeted tissue.
These factors have led to disagreement
between regulatory agencies, such
as the European Medicine Agency
(EMA) and the US FDA, in how to
classify these species. Specifically, FDA
considers oligonucleotides as small
molecules, but the EMA uses a cen-
tralized procedure required for drug
products manufactured using biotech-
nology processes (4). Consequently,
there is no official FDA guidance for
QC expectations. However, the agency
has issued some guidance on the anal-
ysis of oligonucleotides with respect to
identity, purity, quality, and strength,
as part of the chemistry, manufactur-
ing, and controls (CMC) regulatory
process (5).
In addition to their regulatory ambi-
guities, oligonucleotides can be chal-
lenging to use in gene therapies
because their diverse modes of action
can complicate their delivery in vivo.
For one thing, oligonucleotide delivery
is a two-fold process. First, the oligo-
nucleotide must be transported to the
tissue of therapeutic interest with mini-
mized exposure to other tissues. Then
it must then be delivered to the correct
intracellular compartment in order to
function. In order for an oligonucle-
otide to downregulate gene expression,
it must penetrate into the targeted cells.
Systemic oligonucleotide delivery has
been accomplished in rodent models,
but their action becomes localized to
the liver (6), and high oligonucleotide
accumulation is also observed in the kid-
ney and other organs such as the spleen,
heart, pancreas, and the brain, which
show far lower concentrations.
Single-stranded DNA and RNA oli-
gonucleotides also have other proper-
ties that complicate drug development.
For example, they can be degraded by
nucleases when introduced into biologi-
cal systems; other potential problems
include: poor uptake through cell mem-
branes, unfavorable bio-distribution
and pharmacokinetic properties, and
sub-optimal binding affinity for com-
plementary sequences (7). Fortunately,
challenging delivery issues are being
addressed (e.g., through approaches
such as chemical modification of the
oligonucleotide itself; implementation
of lipid or polymeric nanocarriers; and
linking oligonucleotides to receptor-
targeting agents such as carbohydrates,
peptides, or aptamers).
As a result, significant contributions
have been made at a therapeutic and
clinical level, applying tailored solutions
based on the characteristics of the mol-
ecules involved. Even with the most effi-
cient synthesis, however, it is crucial that
synthesized oligonucleotides be evalu-
ated for quality before they are used in
molecular biology applications.
ANALYZING WITH MSMS techniques, including electrospray
ionization (ESI) and matrix-assisted
laser desorption/ionization (MALDI),
are being used to obtain accurate
molecular weight, sequence confirma-
tion, and characterize impurities in
both high- and low-throughput modes.
These powerful technologies can be
applied across the biopharmaceutical
pipeline, from oligonucleotide devel-
opment through to QC.
High-resolution MS generates accu-
rate data to support characterization
requirements. A mass spectrum can
be a useful QC tool to help verify that
a custom oligonucleotide was syn-
thesized correctly and, more specifi-
cally, that it has the expected molecular
weight based upon the requested base
sequence. When considering intact
mass, low-resolution instrumentation
can only be used to obtain the average
molecular weight. In contrast, high-res-
olution mass spectrometry enables the
determination of accurate mass. This
method is based on obtaining negative
ion spectra of the oligonucleotide fol-
lowed by interpretation of the spectra.
This is typically done using deconvolu-
tion software algorithms where all the
FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 43
Analytical Methods
multiply-charged species are recalcu-
lated into the singly-charged form.
The accuracy of these measurements
is typically less than 5 ppm, and, as
such, the mass can be used to help
establish the empirical formula of the
molecule, which is in turn used to pos-
tulate or confirm structure (8).
In addition to determining accu-
rate molecular weight, MS provides
information about the sequence and/or
structure of the biomolecules. When
comparing the use of MALDI and ESI
for the analysis of oligonucleotides, it
is important to consider the type of
mass analyzer used because that will
determine the limits of resolution and
mass range. Analyses of LC-separated
and ionized samples can be accom-
plished through the use of different
mass analyzers. These can be divided
into two main groups based on their
working methods: beam type analyzers
that continually scan ions (e.g., time-
of-flight [TOF] and quadrupole) and
trap-based analyzers that capture ions
of interest for a specific time to acquire
mass spectrum.
A quadrupole mass analyzer acts
as a variable mass filter that separates
ionized species using only electri-
cal fields generated by a direct current
and superimposed radio-frequency
potential. Ions are then introduced in
a path parallel to that of a quadrupole
rod and only ions of a particular mass
and charge can pass through, with all
non-confirming ions filtered out. The
majority of quadrupole TOF (QTOF)
MS systems have tandem capabilities,
so that precursor ions that have been
separated by mass-to-charge ratio in
the first stage (MS1) can be selected
and then separated and detected in
the second stage (MS2) as fragments
(product ions) in the QTOF. Precursor
ions are selected in the quadrupole and
sent to the collision cell for fragmenta-
tion, and the generated product ions are
then detected by TOF MS.
MALDI-TOF offers high sensitiv-
ity for oligonucleotides, is relatively
easy to use, and is well-suited to a
high-throughput laboratory environ-
ment. The method is also reasonably
tolerant of the presence of salts, buffers,
and other additives. Accurate measure-
ment by MALDI-TOF is limited to
oligonucleotides less than 50 bases in
length. Longer oligonucleotides tend
to ionize poorly or “fly” in a MALDI–
TOF instrument.
Alternatively, ESI technology
maintains high mass accuracy, reso-
lution, and sensitivity over a range
of lengths (20–120 bases), but has
a reduced throughput compared to
MALDI–TOF. MALDI–TOF is ame-
nable to high throughput since the
sample/matrix mixture is spotted on
a metal grid which is then analyzed
in the instrument, with data typically
acquired in a fraction of a second. In
ESI–MS, the sample is introduced
via a syringe or injected by an HPLC
system, and data acquisition takes
place in a matter of several minutes,
depending on the complexity of the
samples.
This requires closer attention to be
given to sample cleanliness, which is
important in ESI as the instrument
is more susceptible to contamination.
Generally, ESI is most effective in syn-
theses involving more than 50 bases.
THE FUTURE OF ANALYSISOligonucleotides continue to present
a growing opportunity, as well as an
analytical challenge, to biopharmaceu-
tical developers. MS techniques such
as ESI-QTOF and MALDI-TOF
can be used for ultra-high-resolution
analysis of oligonucleotides to achieve
sensitive detection with enhanced
speed and data quality. Current data
analysis software such as Bruker
Daltronics’ BioPharma Compass
3.1 is available that can work with
both high resolution ESI-QTOF and
MALDI-TOF data.
Advances in these technolo-
gies promise to facilitate the ongo-
ing development of more efficient
oligonucleotide therapies, improving
methods of delivery as well as the
QC pipeline. Oligonucleotides show
low stability against nuclease in vivo,
but progress in the development of
chemically modified nucleic acids and
technology has allowed the develop-
ment of a number of stable and effec-
tive candidate products.
In 2016 Nusinersen (Spinraza), an
antisense oligonucleotide drug for
spinal muscular atrophy, was approved
as an oligonucleotide therapeutic for
infants (9). Current techniques and
studies are paving the way for future
analysis of polymeric sequences of
nucleotides. Coupled with novel data-
analytical software, MS is supporting
the development of new oligonucle-
otide therapeutics.
REFERENCES1. Zion Market Research, “Oligonucleotide
Synthesis Market Expected to Reach USD 3,697 Million By 2026, Globally,” Press Release, January 2019.
2. B2B Labs, “Oligonucleotides: Opportunities, Pipeline and Challenges,” accessed Dec. 12, 2016, www.b2blabs.com/2016/06/oligonucleotides-opportunities-pipeline-challenges/
3. Integrated DNA Technologies, “Technical Report: Mass Spectrometry Analysis of Oligonucleotide Syntheses,” 2017, www.sfvideo.blob.core.windows.net/sitefinity/docs/default-source/technical-report/mass-spec-of-oligos.pdf?sfvrsn=ca483407_6
4. B2B Labs, Oligonucleotides: Opportunities, Pipeline and Challenges, June 2016. http://b2blabs.com/2016/06/oligonucleotides-opportunities-pipeline-challenges/
5. FDA, “CMC Regulatory Considerations for Oligonucleotide Drug Products: FDA Perspective,” pqri.gov, 2017. www.://pqri.org/wp-content/uploads/2017/02/3-SapruPQRI-FDA-Conference-Oligo-2017-Presentation.pdf
6. D. Argyle et al., “Molecular/Targeted Therapy of Cancer,” in Small Animal
Clinical Oncology (Fourth Edition), ed. Stephen J.. Withrow, David M. Vail, (Withrow & MacEwen, 2007).
7. X. Shen, D. R Corey, Nucleic
Acids Research, 46(4) (2018).8. R. Houghton, “Oligonucleotides: The
Next Big Challenge for Analytical Science,” Chromatography
Today, March 2011).9. C. Stein and D. Castanotto, Molecular
Therapy, 25 (5) (2017). X
FOR PERSONAL, NON-COMMERCIAL USE
44 BioPharm International September 2019 www.biopharminternational.com
Operations
Container Closure Integrity Testing of Finished Sterile Injectable Product
As regulatory guidance has changed, so too has CCIT testing. In this article, possible CCIT strategy approaches are outlined.
DEREK DUNCAN
Container closure integrity (CCI) plays an important
role in maintaining the sterility and stability of sterile
injectable products. The defects that cause a sterile
vial to leak are not necessarily detectable by a visual inspec-
tion process. Examples of such defects are those that are
hidden by the crimp, microscopic cracks and scratches in
the glass, or temporary defects such as stopper pop-up that
result in temporary container leakage.
New regulatory guidance has triggered changes in industry
best practices in the area of CCI testing (CCIT). This article
summarizes the current state of container closure integrity testing
in the pharmaceutical and biopharmaceutical industries and out-
lines possible approaches for developing a CCIT strategy.
REGULATORY ENVIRONMENT FOR CCIHistorically, good CCI has been linked to the maintenance of
sterility. A container that loses, or does not have, good closure
integrity is at risk for microbial contamination. However, the con-
text of CCI has become broader over the years.
An increasing number of formulations have significant
sensitivity to oxygen and need to be packaged under an inert
atmosphere. Freeze-dried product requires protection against
water vapor and is often packaged at a partial vacuum to help
with reconstitution and/or seating of the stopper. In these cases,
good CCI is necessary not only for the maintenance of sterility
but also to maintain critical headspace gas conditions.
Note that, quite generally, a container that is gas-tight will also
be tight against microbial ingress. Therefore, the requirement to
maintain headspace gas conditions imposes higher standards on
CCI than the requirement to maintain sterility.
In light of the importance of CCI for product sterility and sta-
bility, regulatory guidance has placed an increasing emphasis on
CCI concepts. The current United States Pharmacopeia (USP)
<1207> chapter titled Package Integrity Evaluation—Sterile
Products was implemented in late 2016 and represents the most
thorough guidance document to date on CCI concepts for sterile
injectable product (1).
The chapter gives an overview on CCIT technolo-
gies and approaches for CCI control over the product life-
idam
be
er
- S
tock
.Ad
ob
e.c
om
DEREK DUNCAN, PHD is director of Lighthouse Instruments, Amsterdam, The Netherlands.
FOR PERSONAL, NON-COMMERCIAL USE
www.biopharminternational.com September 2019 BioPharm International 45
Operations
cycle. Traditional CCIT methods, such
as microbial challenge tests or blue dye
ingress tests, are described as methods
associated with probabilistic outcomes
having some uncertainty in the results
which, in turn, makes such methods dif-
ficult to quantitatively validate for the
detection of critical leaks (1). The chap-
ter also makes clear that CCIT should
be performed throughout the product
lifecycle. Deterministic CCIT methods
based on non-destructive analytical mea-
surements can be used to generate sci-
ence-based CCI data that, coupled with
a risk-based approach, enable informed
decisions about a CCIT strategy in
commercial manufacturing.
A draft revision of the European
Union’s Annex 1 requirements for sterile
product manufacturing was released at
the end of 2017 (2). CCIT was a popular
discussion topic for the revision, and the
draft text contains new requirements for
CCIT in manufacturing. Other world
regulatory bodies, Russia and South
Korea for example, have also been putting
increasing emphasis on CCI control for
finished sterile products. It is clear from
these developments that regulators are
wanting to see improved industry prac-
tices in the area of CCIT.
CCI TEST METHODSUSP <1207> provides an overview of
CCIT technologies and categorizes them
as being deterministic or probabilistic (see
Table I). The chapter emphasizes that
this overview of CCIT technologies is
not exhaustive but is a summary of tech-
nologies that have been implemented for
CCIT in the pharmaceutical industry
and that are described by a body of peer-
reviewed literature.
It is important to distinguish between
CCI technologies and CCI test methods.
Once a leak testing technology has been
chosen as the basis for a test method, the
chapter emphasizes the need to perform
method development studies generating
data that demonstrate detection of a criti-
cal leak for a specific product container
configuration using defined test method
parameters (1): “After a methodology has
been selected for use, the test equipment
operation and performance is qualified.
Test method parameters are optimized
during method development and con-
firmed during validation. Thus, a final leak
test method is specific to a particular con-
tainer-closure or product-package system.”
Another point emphasized in the
chapter is that “no one test is appropri-
ate for all packages or for all leak test-
ing applications.” The chapter and its
three sub-sections describe a framework
in which appropriate CCI test method-
ologies are chosen, optimized per product
configuration, and a robust validation of
the method for detecting a critical leak
is performed. In selecting a methodology,
“deterministic leak test methods are pre-
ferred over probabilistic methods when
other key method selection criteria per-
mit.”
Package integrity data are generated
over the product lifecycle and serves as
input for an ongoing database of CCI
data (the package integrity profile), which
then serves as a risk management tool
to ensure that CCI of finished product
meets the product quality requirements.
The framework described in the chapter
is currently driving changes in industry
best practices for CCI testing, including:
• Implementation of a ‘toolbox’ of CCI
test methods optimized and chosen
on a per product configuration basis
rather than the application of a single
legacy test method in a one-size-fits-
all approach
• Generation of science-based CCI data
in robust method validation studies,
which demonstrate the detection of
a critical leak represented by various
types of positive controls.
STATISTICAL SAMPLINGA big topic of current discussion is
how much CCIT is required, especially
for commercial batches of finished
sterile product. Despite the general
consensus that CCI is a critical quality
parameter for finished sterile product,
the industry has historically expended
much more effort on testing for par-
ticle contamination than for CCI.
Visual inspection to detect particulate
contamination has been a requirement
for many years with 100% inspection of
finished parenteral product being done
manually or by automated inspection
platforms. In the context of risk to the
patient, a loss of CCI would, in general,
be assessed as being just as critical as par-
ticle contamination.
The current EU Annex 1 guidelines
require 100% leak testing for certain types
of product containers. “Containers closed
by fusion, e.g., glass or plastic ampoules,
should be subject to 100% integrity test-
ing” (3). This requirement is a result of the
fact that the inherent failure rate of the
sealing process for these types of contain-
ers cannot be sufficiently controlled.
The ongoing draft revision of the
EU Annex 1 guidelines again states the
requirement of 100% integrity testing
for fused containers and adds the follow-
ing requirements for all other types of
containers. “Samples of other containers
should be checked for integrity utilizing
validated methods and in accordance with
Table I. Overview of container closure integrity testing (CCIT) technologies.
Deterministic Probablistic
Electrical conductivity and capacitance (high-voltage leak detection)
Bubble emission
Laser-based gas headspace analysis Microbial challenge, immersion exposure
Mass extraction Tracer gas detection, sniffer mode
Pressure decay Tracer liquid (blue dye ingress)
Tracer gas detection, vacuum mode
Vacuum decay
Source: Adapted from USP 40 <1207.2>
FOR PERSONAL, NON-COMMERCIAL USE
46 BioPharm International September 2019 www.biopharminternational.com
Operations
QRM, the frequency of testing should be
based on the knowledge and experience
of the container and closure systems being
used. A statistically valid sampling plan
should be utilized. It should be noted that
visual inspection alone is not considered
as an acceptable integrity test method”
(2). If finalized in this form, these CCIT
requirements will require the evolution of
best practices for CCIT in the manufac-
turing environment.
Currently, a small percentage of the
industry performs statistical CCIT of fin-
ished commercial product. Most compa-
nies point to the 100% visual inspection
process to justify meeting current CCIT
guidance, such as the following from the
FDA (4). “A container closure system that
permits penetration of microorganisms is
unsuitable for a sterile product. Any dam-
aged or defective units should be detected,
and removed, during inspection of the
final sealed product.” The language of the
draft EU Annex 1 revision makes clear
that visual inspection is not considered an
acceptable integrity test method; in other
words, the CCI test methods that enable
the testing of larger amounts of samples
will need to be implemented.
To demonstrate statistical confidence
in the process requires the generation of
statistical CCI data. However, an argu-
ment could be made that a better place
to do this in the product lifecycle is in
process development and scale-up rather
than in manufacturing. The guidance pro-
vided in USP <1207> to collect package
integrity data throughout the product life-
cycle so that a package integrity profile
database is built up implies an approach
in which a significant amount of CCI
data are generated outside of the manu-
facturing environment. The generation of
robust CCI data providing knowledge of
the container and closure system (which
then gives guidance to a CCIT strategy
in manufacturing) is also implied in the
text of the draft revised EU Annex 1, “the
frequency of testing should be based on
the knowledge and experience of the con-
tainer and closure systems being used.”
Figure 1 outlines a possible approach
to generating CCI data that enables the
design of an appropriate CCI testing pro-
gram in manufacturing.
After validation of the fundamental clo-
sure system, data need to be generated to
understand if the process introduces risk to
CCI. To gain statistical confidence in the
process, it would be necessary to perform
testing on statistical sample sets. This in
turn will require the use of non-destructive
deterministic test methods because the
probabilistic legacy test methods (blue dye
and microbial ingress testing) have limited
throughput capability. Testing could be
done on either a pilot scale or with test
and engineering batches from the manu-
facturing environment. Once a baseline
failure rate has been established, process
controls could be implemented to improve
the process, if necessary.
Product from the improved process
would be tested to quantify the residual
risk to CCI after which a decision could
be made for an appropriate testing strat-
egy in manufacturing. Packages and pro-
cesses having a high inherent failure rate
that is difficult to control would require a
heavier inspection process and vice versa.
In this way, the decision for an inspection
process design is driven by science-based
statistically relevant data.
SUMMARYThe current environment for CCIT of
sterile injectable product is evolving. New
regulatory guidance recognizes CCI as a
quality parameter that is critical for the
maintenance of both the sterility and the
stability of finished sterile product. New
concepts introduced in the regulatory
guidance are changing industry best prac-
tices and include the following:
• Generate science-based CCI data
throughout the product lifecycle to
build up a package integrity profile
database that can be used as input for
risk management.
• When possible, use deterministic CCI
test methods that have been validated
to detect a critical leak.
• There is no one-size-fits-all CCI test;
a toolbox of CCIT technologies that
can be optimized on a per-product
package configuration is necessary for
a robust CCIT program.
Because industry best practices will
be evolving as the impact of new guid-
ance becomes clearer, a certain amount
of uncertainty in CCIT best practices is
to be expected in the near term. However,
a general approach that includes the
implementation of validated deterministic
CCIT methods and the increased genera-
tion of science-based CCI data to enable
informed risk assessments will help pre-
pare the industry for the future.
REFERENCES1. USP, USP 40 <1207> “Sterile
Product Packaging—Integrity Evaluation” (US Pharmacopeial Convention, Rockville, MD, 2017).
2. EC, EU GMP Annex 1 Revision:
Manufacture of Sterile Medicinal Products
(Draft) (Brussels, December 20, 2017). 3. EC, EudraLex, Volume 4, EU Guidelines to
Good Manufacturing Practice-Medicinal
Products for Human and Veterinary
Use, Annex 1, Manufacture of Sterile Medicinal Products (Brussels, 2009).
4. FDA, Guidance for Industry: Sterile Drug
Products Produced by Aseptic Processing—
Current Good Manufacturing Practice
(FDA, Rockville, MD, September 2004).◆
Figure 1. Schematic of possible approach to generating container closure integrity (CCI) data.
Fig
ure
is
cou
rte
sy o
f th
e a
uth
or
Understand base-
line failure rate
Quantify
residual risk
CCI testing
strategy
Implement / improve
process controls
FOR PERSONAL, NON-COMMERCIAL USE
Downstream Processing
www.biopharminternational.com September 2019 BioPharm International 47
sin
hyu
- S
tock
.Ad
ob
e.c
om
What’s New in Manufacturing: Process Chromatography
Advances in process chromatography are necessary for
accuracy and productivity in biologics manufactur-
ing. The following products promise to improve and
enhance the reliability of process chromatography.
PRE-PACKED CHROMATOGRAPHY COLUMNSThe ReadyToProcess chromatography column with 600 mm
inner diameter is the latest addition to the ReadyToProcess
chromatography column line from GE Healthcare. The pre-
packed, ready-to-use column offers enhanced flexibility and
productivity in clinical and commercial manufacturing by
eliminating the need for column preparation, packing, and
validation procedures, according to the company.
Introduced to the market in July 2019, the
ReadyToProcess 600 mm inner diameter chromatography
column comes equipped with bed heights of 100–250 mm.
The column is compatible with a variety of chromatography
resins including those used for monoclonal antibody (mAb)
purification, viral vectors, plasmids, recombinant proteins,
and more.
Validation columns from GE Healthcare involve pre-
packed scale down Tricorn 10/200 columns for process
development and process validation. The columns can be run
on chromatographic systems, including the company’s own
ÄKTA chromatography systems, and are prepacked to save
time, improve reproducibility, and eliminate the need for
packing expertise, the company says.
The columns come equipped with a bed height of 20
cm and an inner diameter of 10 mm. MabSelect PrismA,
MabSelect SuRe, MabSelect SuRe LX, Capto S ImpAct,
Capto Q, Capto SP ImpRes, and Capto Adhere prepacked
resins are available for use with these columns.
The latest advances in process chromatography include pre-packed chromatography columns, process characterization kits, fast protein liquid
chromatography systems,and mixed-mode chromatography resins.
LAUREN LAVELLE
FOR PERSONAL, NON-COMMERCIAL USE
48 BioPharm International September 2019 www.biopharminternational.com
Downstream Processing
CHROMATOGRAPHY PROCESS CHARACTERIZATION KIT GE Healthcare also introduced
Process Characterization Kits to its
catalog in July 2019. The kits provide
access to knowledge from resin devel-
opment projects, enable risk assess-
ments and process characterization
of resin variability, and interplay with
process parameter impact on pro-
cess performance and critical quality
attributes. According to the company,
this aids in the understanding of pro-
cess parameters and raw material
attributes, which are key to develop-
ing successful control strategies and
productive processes.
The kits come with three lots of a
given resin with different ligand den-
sities (high, center, and low) and are
available for Capto S ImpAct, Capto
SP ImpRes, Capto adhere, Capto
adhere Impres, Capto MMC, Capto
MMC ImpRes, Capto Phenyl, Capto
Phenyl ImpRes, and Capto Butyl
ImpRes resins.
SOON-TO-BE-RELEASED CHROMATOGRAPHY PRODUCTS ÄKTA go is GE Healthcare’s most
recent addition to the ÄKTA chro-
m a t o g r a p h y s y s t e m s p o r t f o -
l io. Deve loped for automated
chromatography descended from
fast protein liquid chromatography
(FPLC) technology, the system sup-
ports routine lab-scale protein purifica-
tion for affinity, size exclusion, and ion
exchange chromatography.
With a flow rate range of 0.01 to 25
mL/min, an operating pressure of 0 to
5 MPa (50 bar, 725 psi), pressure, ultra-
violet, conductivity, and pH monitors,
and dimensions of 335 × 482 × 464
mm without accessories, the ÄKTA
go is designed to simplify method cre-
ation, achieve desired purity with ease,
and make the most of bench space in
crowded laboratories. The company
plans to introduce the system to the
market in October 2019.
Chromatography
products promise
to improve and
enhance the
reliability of process
chromatography.
Similarly, Repligen will introduce
a new proprietary method of pack-
ing ceramic hydroxyapatite resin
in its OPUS pre-packed columns
in September 2019. The columns
will be ≤45 cm in diameter with a
range of configurable bed heights
(5–30cm) and standard OPUS pre-
packed column lead times will apply,
according to the company.
PROCESS CHROMATOGRAPHY RESINSOriginally introduced in 2016, the
next generation of Pall Biotech’s
CMM HyperCel mixed-mode resin
is designed for large-scale drug man-
ufacturing. The resin works to sepa-
rate proteins with similar isoelectric
points and hydrophobicity in broad
conditions while using a pH from
five to eight and conductivity up to
50 ms/cm.
The product is made up of a cel-
lulosic matrix on which amino ben-
zoic acid provides the ionic charge and
hydrophobicity attached to it. It aids in
process and product-related impurity
removal and is particularly suitable for
new engineered modality of mono-
clonal antibodies (mAbs) that are dif-
ficult to purify or recombinant proteins.
The resin is also able to work from
low to high conductivity and avoid the
dilution needs required with cation
exchange conditions.
The rebooted resin has an applied
flow rate allowing three-to-four-
minute residence time, a binding
capacity of 100 mg/mL immuno-
globulin G (IgG) at pH 5, 12 ms/cm,
and > 60 mg/ml mAb at 25 ms/cm
efficient ion exchange at high con-
ductivity with no need for dilution
or defiltration, the company states.
The Eshmuno CPS Resin from
MilliporeSigma is a cation exchange
resin that combines high dynamic
binding capacity and separation
efficiency in high-salt purification
processes. According to the com-
pany, the resin’s salt tolerance allows
for direct loading of high conduc-
tivity feed streams, which reduces
costs, time, and manufacturing. It
also features easy process develop-
ment capabilities with bind and
elute conditions and selection of
process parameters.
The resin is composed of a base
matr ix , hydrophi l ic polyv iny le-
ther polymer, and a sulfonate cat-
ion exchanger. It also has a capture
and intermediate polishing step of
recombinant proteins, enzymes, anti-
body fragments, growth factors, etc.
The product has a linear flow rate up
to 500 cm/h (<3.0 bar net pressure)
and a binding capacity of approxi-
mately 160 mg lysozyme/mL of gel.
GE Healthcare’s high resolution
Capto HiRes Q and Capto HiRes S
ion exchange chromatography col-
umns are designed for high reso-
lution separation for protein and
nucleic acid purification or analysis.
Prepacked in a Tricorn high-perfor-
mance column, the resins are based
on high-flow agarose with a particle
size of 8 um.
The resins come with bed heights
of 50 mm (5/50 column) and 100
mm (10/100 column); column inner
diameters of 5 mm (5/50 column)
and 10 mm (10/100 column); max-
imum pressure over a packed bed
of 4.0 MPa; and an ionic capacity/
ml packed resin of ~0.23 mmolCl-/
mL resin for the Capto HiResQ and
~0.12 mmol H+/mL resin for the
Capto HiRes S. X
FOR PERSONAL, NON-COMMERCIAL USE
September 2019 www.biopharminternational.com BioPharm International 49
New Technology Showcase
Ask the Expert — Contin. from page 50
INTEGRATED BIOLOGICS DEVELOPMENT SERVICESCatalent Biologics has the
capabilities and experience in
the development, manufacturing, and analytical services for new
biological entities, gene therapies, biosimilars, and antibody-drug
conjugates. Using advanced biologic development technology and
tailored solutions from DNA through to clinical and commercial supply,
Catalent Biologics brings better biologic treatments to patients, faster.
Catalent, 14 Schoolhouse Road Somerset, NJ 08873 USA,
Tel.+1 888.765.8846, [email protected], www.catalent.com
OSMOTECH® PRO MULTI-SAMPLE MICRO-OSMOMETERThe OsmoTECH PRO Multi-Sample Micro-Osmometer
from Advanced Instrument tests osmolality–an essential
parameter for process control and QC. Designed to meet
these testing pharmacopeia guidelines, OsmoTECH
PRO utilizes freezing point depression–the gold
standard method for testing osmolality. Designed
for user-friendliness, OsmoTECH PRO has an intuitive touchscreen
interface, a 20-position turntable (that requires only a small sample
of 30μL), and arrives factory-calibrated so your lab can start testing
quickly. Built with the most data-management and security features
of any osmometer currently on the market, the OsmoTECH PRO
also helps support 21 CFR Part 11 and EU Annex 11 compliance.
Advanced Instruments, www.aicompanies.com
VALPLUS™ CONFIDENCE THROUGH VALIDATIONSaint-Gobain Life Sciences
ValPlus™ provides pharmaceutical
manufacturers increased confidence
in the cleanliness of the tubing
products they use in critical applications. Available with a variety of
Saint-Gobain tubing brands such as C-Flex® and Sani-Tech®, ValPlus
is certified to USP <788> for particulate, USP <85> for bacterial
endotoxin, and ISO 11737 for bacterial and fungal bioburden.
Saint-Gobain Life Sciences, www.biopharm.saint-gobain.com/valplus
AMBR® 15 CELL CULTURE GENERATION 2ambr® 15 cell culture from
Sartorius Stedim Biotech
is a high throughput,
automated bioreactor
system for 24 or 48 parallel
cultivations at the 10–15
mL microbioreactor scale.
Offering new functionality,
a high level of flexibility and improved performance the
Generation 2 system is ideally suited for applications including:
clone selection, media and feed development, early stage process
optimization, and screening under perfusion mimic conditions.
Sartorius Stedim Biotech, www.sartorius.com
• Your personnel training and personnel following
procedures is correct
• Your contamination control strategy for all points of
risk of contamination from gloved hands is appro-
priate and sufficient.
If not, you should be able to immediately identify
corrective action and preventive action (CAPA) mea-
sures to reduce the risks to an acceptable level.
The CCS will bring all these assessments together
and provide a holistic view of your approach to con-
tamination control. The CCS is not only needed for
responding to the inspection observations, it is an
essential document for any pharmaceutical operation
and, in particular, for sterile manufacturing ones.
REFERENCES 1. EC, Annex 1, Manufacture of Sterile Medicinal Products,
December 2017. Link: https://ec.europa.eu/health/sites/
health/files/files/gmp/2017_12_pc_annex1_consultation_
document.pdf
2. PHSS, Control Strategy in Manufacture of Sterile
Pharmaceutical/Drug Products, Whitepaper, www.phhs.co.uk.
3. CDC, Morbidity and Mortality Weekly Report, 51 (RR-16), (Oct.
25, 2002). Link: www.cdc.gov/mmwr/PDF/rr/rr5116.pdf ◆
Ad Index
Company Page
AGILENT TECHNOLOGIES 19
CATALENT PHARMA SOLUTIONS 52
CPHI WORLDWIDE 51
EPPENDORF 7, 33
IRVINE SCIENTIFIC 15
KNAUER GMBH 21
MASTER CONTROL SYSTEMS 9
MILLIPORE SIGMA 13
PDA 11
PENDOTECH 25
PHRMA 2
READING SCIENTIFIC SERVICES LTD 27
SARTORIUS STEDIM BIOTECH 5
THERMO FISHER SCIENTIFIC 17, 35
YOURWAY TRANSPORT COVER TIP
FOR PERSONAL, NON-COMMERCIAL USE
50 BioPharm International www.biopharminternational.com September 2019
Ask the Expert
Contin. on page 49 Fa
na
tic S
tud
io/G
ett
y I
ma
ge
s
Siegfried Schmitt, PhD, vice-president, technical,
Parexel Consulting.
Q: A recent inspection of our facility resulted
in several observations, including insuf-
ficient hand sanitization by personnel in the
sterile filling area, deficient gowning in the
microbiology laboratory, and use of wooden
pallets in the cold storage area. Before conclud-
ing, the inspectors told us that they want us to
address these deficiencies holistically. Can you
give some advice on how to do this?
A: It is correct that all too often, compa-
nies address each and every inspection
observation individually, rather than address
fundamental flaws or gaps in the systems, pro-
cesses, or organizations. The regulators want
the industry to find the true root causes for
their compliance lapses. This is why your
inspectors want to see the issues they identified
addressed holistically. For example, they want
you to clearly identify the functional relation-
ship between the parts that lead up to a compli-
ant operation and the whole.
Looking at the examples you cite, it seems
that you would be best served by preparing a
contamination control strategy (CCS). Control
strategies are an increasing requirement in the
European Union good manufacturing prac-
tice regulations (EU GMPs) and expected to
be referenced in the next revision of EU GMP
Annex 1 (1). The draft text, which is likely to be
adopted in the final version, reads:
‘Quality assurance is particularly impor-
tant, and manufacture of sterile products must
strictly follow carefully established and vali-
dated methods of manufacture and control. A
contamination control strategy should be imple-
mented across the facility in order to assess the
effectiveness of all the control and monitoring
measures employed. This assessment should
lead to corrective and preventative actions being
taken as necessary. The strategy should consider
all aspects of contamination control and its life
cycle with ongoing and periodic review and
update of the strategy as appropriate.’
The regulators want
the industry to find the
true root causes for their
compliance lapses.In your case, the CCS should consider all the
integral elements of sterile product manufactur-
ing, including quality risk management (QRM)
principles and supporting risk assessments for
contamination control and monitoring (detect-
ability of contamination event) (2). How should
or could you develop this CCS? First, you need a
complete process flow description of all materi-
als and personnel. This will allow you to iden-
tify points of critical risk of contamination and
points of inherent risk of contamination.
If we take the examples provided by your
inspectors, you will need to identify where
there is a risk for contamination (e.g., the oper-
ators) and how you control this risk of con-
tamination (e.g., gowning and barriers, such
as isolators and disinfection). Next, you need
to determine whether these control measures
(individually and as a whole) are sufficient
to reduce the risk to an acceptable level. For
example, is hand sanitization performed often
and sufficiently, and is the procedure following
industry best practices (3)? Are your personnel
suitably trained and are they following the pre-
scribed procedure? Have you collected sufficient
data (e.g., from swabs and dabs) that prove the
efficiency of the sanitizing regime? Once you
have performed this risk assessment, you will
have sufficient information and data to under-
stand, whether:
• Your hand sanitizing procedures are adequate
and effective
Developing an Effective Contamination Control StrategyProviding regulators with a holistic approach to addressing deficiencies is the best response to an inspection.
Siegfffriiieddd SSSchhhmiitittt PPPhDhDhD
FOR PERSONAL, NON-COMMERCIAL USE
30 years of uniting the entire Pharma value chainThe world’s largest pharmaceutical exhibition, CPhI Worldwide houses six zones
representing each stage of the pharmaceutical supply chain - from APIs, machinery,
Uniting over 2,500 international exhibitors, CPhI Worldwide is the place to network and
source cost effective pharma solutions from all over the world - in just 3 days, under one roof.
REGISTER NOW! V . /ȂȂǚ
165+Countries
Participating
100Hours of Free
On-site Content
2,500+Exhibiting
Companies
Meet, network & learn
Everybody here is seriously doing business,
looking for business contacts and actively engaging
Juan Sarmiento, Nemera“
FOR PERSONAL, NON-COMMERCIAL USE
CREATING BIOLOGIC TREATMENTS IS SCIENCE. ORCHESTRATING FASTER DEVELOPMENT IS ART.
us + 1 888 SOLUTION (765-8846) EU 00800 8855 6178 biologics.catalent.com/science-art © 2019 Catalent Pharma Solutions. All rights reserved
Introducing our latest masterpiece, OneBioSM Suite, which integrates development through complete clinical and commercial supply to simplify, accelerate and de-risk your biologic development.
With our deepest expertise and advanced technologies, we help you deliver better biologic therapies to patients, faster. Catalent, where science meets art.
FOR PERSONAL, NON-COMMERCIAL USE