Upload
others
View
3
Download
0
Embed Size (px)
Citation preview
1
Rescue Breaths:Nature Giving a Breath of Life to Serrano Middle School
Laurel Skinner LA 6121-L
2Table of Contents
I. Designer Bio 3II. Background & Context 4-5 A. Background & Context-Location 4 B. Background & Context-Location 5III. Opportunities and Constraints 6-7 A. Opportunities and Constraints 6 B. Opportunities and Constraints-UHI 7IV. Stage of Romance 8V. Goal 9VI. County Level Analysis 10-12VII. Student’s in Outdoor Spaces 13-15VIII. Opportunities 16-20 A. Prior Example B.BenefitsofanOutdoorClassroom C. How Plants Capture Particulate Matter D. Planting Trees for Better Air Quality E. Plants as a Noise BarrierIX. Concept SketchX. MuralXI. Final PlanXII. Planting Palettes 24-28Riparian AreaShrubsTreesSedges & GrassesButterflyGardenXIII. Program Elements A. Seating Area 1. Layout 2. Perspective 3. Section B. Slide
C. Courtyard 1. Perspective 1 2. Perspective 2 D.ButterflyGarden 1. Perspective 1 2. Perspective 2 E. River 1. Perspective 1 2. Perspective 2 3.Section F. Maze G.GreenRooftopXIV.ProgrammingDiagrams A. Body Positivity B. Shade Map C.GreenerCampusXV.EvaluationXVI.TheEndXVII.ReferencesXVIII.EvaluationReferencesXIX. Image Sources
34-5
45
6-76789
10-1213-1516-20
1617181920212223
24-282425262728
29-4729-31
29303132
33-343334
35-363536
37-393738394041
42-44424344
45-4748
49-5051-52
53
3Designer Bio
LaurelSkinnerisa2ndyeargraduatestudentatCalPolyPomona.HerundergraduatedegreeisinHealthScience-CommunityHealthEducation.Shewantstofocusworkingonresearchandmakinglandscapesthatimprovehumanhealth.ShehopestodoathesisnextyearlookingatgreenspaceandasthmaratesinLosAngelescounty.
4Background & Context-Location
Asseenintheleftimage,SanBernardinoCountyishighlightedinred.OnthetoprightthereisacloseofwherethecityofMontclairislocatedincontrasttotheentiretyofSanBernardinoCountyandtheninthebottomrightwhereSerranoMiddleSchoolisinrelationtoMontclair.
5Background & Context- Location
SerranoMiddleSchoolliesadjacenttothetenfreeway,whichwasbuiltin1957,totheEastofahistoricriver,andaboutaquartermileawayfromtheMontclairMall.ItislocatedinSanBernardinocounty.Theschoolislocatedat:4725SanJoseSt.MontclairCA91763.TheschoolopenedinJuly1,1980.Theschoolspansgrades7-8.
SanAntoninoCreekChannel
10Freeway
SerranoMiddleSchool
MontclairMall
6Opportunities and Constraints
Ascanbeseenhere,thereisalotofspaceonthatcouldbedevelopedintogreenspace,butadditionally,thereisroomforbluespace.Themajorconstraintofthiscampustheborderingwiththe10freeway,whichcontributestonoiseandairpollution.
7Opportunities and Constraints-UHI
TheurbanheatisleindexascalculatedbyCalEPAis“calculatedasapositivetemperaturedifferentialovertimebetweenanurbancensustractandnearbyupwindruralreferencepointsataheightoftwometersabovegroundlevel,wherepeopleexperienceheat.TheIndexisreportedindegree-hoursperdayonaCelsiusscale.Anincreaseofonedegreeoveraneighthourperiodwouldequaleightdegree-hours,aswouldanincreaseoftwodegreesoverafour-hourperiod.Thedegree-hourthereforecombinesboththeintensityoftheheatandthedurationoftheheatintoasinglenumericalmeasure”.
8Stage of Romance
Idecidedtofocusmystagesofromanceprojectonthefeelingofbeingnexttoafreeway.IchoosethisaspectasthiswasonetheprimaryreasonsIchoosethisschool.IpurposelywenttolistentothesoundofthefreewaywhenIfeltverystressedaboutschoolsoIcouldtrytounderstandhowthestudentsfeelwhenthenoiseofthefreewaymightimpactthemthemost.IdecidedthatpinswouldaccuratelyrepresenthowIfeltaboutbeingnexttothefreewayandclaycouldhelpsupportthemasIcouldmakethemstickoutoftheclay.IinitiallystartedbymaketheshapeasawavywallbutthatdidnotconveywhatIwanteditto.Iendedonacave/mouthshape,whichfeelsmoreeminentandforeboding,whichIfeelmoreaccuratelyrepresentshowIfelt.
9(SerranoMS,n.d.)
1.Decreasenegativeimpactsfromadjacentfreeway 2.CreateanaturalEco-friendlyriverhabitatthatmimicsthehistoricone3.Increasescienceeducation4.Increaseoutdooractivityandengagement5.Createalearningenvironmentsthatadequatelysupportsstudent’s
Goals
10County Level Analysis (CalEnvironScreens,2018)
County-Red Zones in San Bernardino County County-Cardiovascular Disease
County-Traffic County-Diesel
11
County-Air Pollution County-Asthma
County-Low Birth Weight County-Selected Parcel
County Level Analysis(CalEnvironScreens,2018)
12Cal Environ Screens Data (CalEnvironScreens,2018;SparetheAir,n.d.a.,
SparetheAir,n.d.b.)
Airqualityinthisareaisverypoor.Thisputsthestudentsatriskformanypossiblenegativehealthoutcomes.ThesepossibilitiesincludeAsthma,respiratoryillness,damagedcells,cardiovascularillness,bronchitis,emphysema,cancer,acceleratesagingofthelungs,decreaseslungcapacityandfunction.OzoneandPM2.5particularlycanaggravateandcausetheseconditions.Childrenundertheageof14areoneofthehighrisksgroupsforbeingimpactedbyairpollution.
13AllImages:(SerranoMS,n.d.)Student’s in Outdoor Space
TheseimagestakenfromSerranoMiddleSchool’sTwittershowhowstudentsusetheoutdoorspaceoftheirschool.Theimageatthebottomrightwascaptionedexplainingthestudentwasnotmovingaroundbecauseoftheheat.
14Student’s in Outdoor Space
AllImages:(SerranoMS,n.d.)
ThefirstimageinthispagewastheonlyoneIcouldfindshowingstudentsactivelymovinginthespaceandnotperforminganorganizedsport.Thelastimagehighlightssomethingthefirstimagealsobringslightto,therewaslittlephotosofgirlsbeingactiveintheoutdoorspaceincomparisontoboys.
15Student’s in Outdoor Space
AllImages:(SerranoMS,n.d.)
Inthefirstphotoitcanbeseenhowthestudentsarecongregatingunderneaththesolarpanels,oneoftheschool’sfewplacesofexpansiveshade.Thebottomleftphotoshowshowmuchofthestudentsarestillsittingdownduringtimetheyareside.Thebottomrightshowsarareviewoftheinteriorcourtyardofthemainbuilding,whichisverydull.
16Opportunities- Prior Example
PriorExample:OwensboroRegionalHospitalhascreatedwaterfeaturesfromcollectingrainwater.Watereventuallyisdepositedintothelocalriver.Thesewaterfeatureshaveimprovedthestressofpatients.
(LandscapePerformanceSeries,n.d.)
17Benefits of an Outdoor Classroom
1. Fosters cooperative, non-competitive environment.
2. Supporting active lifestyle.
3. Encourages interest in science and math.
4. Encourages environmental stewardship.
5. Fosters nature appreciation
6. Supports broad view of how the world works.
18How Plants Capture Particulate Matter
(GreenHeartProject,n.d.)
SolidCarbonCores (0.01-0.08mm)
AbsorbedHydrocarbons
LiquidCondensedHydrocarbonParticles
SolidCarbon
Vegetated barriers are most effective if planted close to the pollution source in highly polluted areas.
DepositionThe physical capture of particulate matter on the leaves and bark of trees and plants. The greater surface area and the rougher or sticker the leaf and bark, the higher
Vegetation Barrier
Greenbelt scenarios in which vegetation acts as a barrier to air flow, altering airflow patterns and pollution plume trajectory in addition to deposition.
Diesel PM depositingtoleaftexture.
Minimumplantedwidthof16’
19(GreenHeartProject,n.d.)Planting Trees for Better Air Quality
20(Sannuta,n.d.)Plants as a Noise Barrier
“Plantscanbeusedfunctionallytosolvesomeoftheenvironmentalproblemsthehomeownermayhaveontheproperty.Thismayincludetheneedforprivacy,protectionfromglareordirectsunlightintowindows,orshadeonapatio.Athickrowofhighshrubsborderingsroadcanreducenoiseandpreventlitterfromenteringayard,orperhapsscreenanunpleasantviewsuchasashoppingcenterorrowofbuildings.”
Earthenberm,3-6’tall.2:1sidedslopesorflatter.
21Concept Sketch
Theconceptofthisdesignistheideaofbiomimicryasawaytoexpresstheamazingthingsoursbodiesdoinaneducationalwayandinawaythatempowersstudentstofeelpositiveabouttheirbodies.Additionally,thisdesignbreatheslifethroughcomplexityandgreeningofthecampusSomebasicelementsofthisincludethewallasmimickingskin,therecycleareaasmimickinglysosomes(partofthecellsthathandlewaste),andtreesasoxygenmolecules.
(ColonelHighSchool,n.d.)
22Mural
Thisisaroughconceptforamuralthatcouldgoonthebackwallandwouldexplaindifferentpartsofthemetaphorthroughoutthecampus.Thetoprightbackgroundisanabstractionofoxygenmolecules,theleftisasimplecubodalepithelialcell.Themiddleislayersofskin.Thebottomleftisanesophagus.Themiddlebottomispartofthecell.Thebottomleftisrecbloodcells.
23Final Plan
RiverLunchArea
GreenRoofRaisedBeds
Maze
ButterflyGarden
Recycle/CompostCenter
Walkway
RiparianTrees
OrnamentalTrees
Wall
24
25
26
27
28
29Seating Area-Layout
Redbloodcellsareknownforcaringnourishment,electrolytes,andvitaminstotherestofthebody.Thisismimickedinthepurposeofaluncharea.Theconcaveshapeofredbloodcellswereusedasinspirationfortheshapeoftheseareas(note:forADAaccessibilitysomeoftheseindividualcellswouldlookdifferenttoaccommodateADAcompliance,notablyinprovidingarampandbeingabouthalfthedepthofthetwotieredsittingarea.Overheadshadestructureswouldprotectthestudentsfromthesun.Becausethesearedepressionsandstudentsdonotstayoutsideduringtherainwatercouldbecollectedbythesestructures.
Image:Source2Text:(UniversityofRochesterMedicalCenter,n.d.)
30Seating Area-Perspective
31Seating Area-Section
32Slide
Theslideisametaphorfortheesophagus,becausefoodslidesdowntheesophagus.Similarly,studentscangetfoodfromthegreenrooftopraisedbedsandthenslidedown.
Image:Source3
33Courtyard-Perspective
Theinnercourtyardissymbolicofsimplecubodalcellsunderamagnifyglass.Thiswouldhelptoengagethestudentsthroughcolor.Thepavingwouldbeaccomplishedbypermeablepavers.
Image:Source4
34Courtyard-Perspective
35ButterflyGarden
Thebutterflygardenwouldbesimilartothecourtyard,withtheexceptionofinsteadofsimplecubodalcells,thefocuswouldbelookingatcellsunderamicroscopeandthenseeingansmallerorganismunderamicroscope.Thiswouldbemimickedbypollinatorsinteractingwiththespace.
Image:Source5
36ButterflyGarden-Perspectives
37River-Perspective
Theriverthatwouldgoalongthenaturalwatershedofthespaceandmimicstheideaofthebreath.Waterisalifegivingforceandcanrejuvenateaspace,ascanbreathingrejuvenateus.
Image:Source6
38River-Perspective
39River-Section
40Maze
ThemazerepresentsthetwistsandturnsofthesmoothandroughER,whichtransportthingsinthecell.
Image:Source7(ColonelHighSchool,n.d.)
41Green Rooftop
Thegreenrooftopswouldbemimickingthemitochondriaofthecell,whicharepopularlyknownasthepowerhouseofthecell.Alternatively,foodhelpspowerourbodies.
Image:Source8Text:(ColonelHighSchool,n.d.)
42
43
44
45Evaluation
Program/Design Element Objectives Cost Benefits/Function Impacts How to MeasureTree Canopy Decrease
negatives impacts from adjacent freeway
$/per tree Increases shade (27) Decreases UHI (4)Reduces exposure to UV B Rays (4)
Compare test scores before and after implementation, measure temperatures before and after, compare health scores before and after.
Reduce heat (27) Decreases UHI (4)Cooler temperatures help with test scores (34)
Remove ozone and PM 2.5 pollution from freeway (39) Improves student health (4)Encourages civic pride (4) Brings communities together (28)Decrease noise (13) Improve education (16)
Adding in rocks Recreate natural river habitat
$/per rock Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare water usuage before and after.
Helps with water conservation (24)
New pavement in courtyard Increase science education
$/dollar Increased color in educational environment (22) (23) Increased educational outcome (22) (23) Compare test scores before and after implementation.
Shrubery (maze) Increase outdoor activity and engagement
$/Shrub Enhances problem solving skills (6) Improve educational outcomes (29) Compare test scores before and after implementation, especially in mathematics.
Improve spatial awareness (6) Improve educational outcomes, improve mathematics score (30)
Enhances memory (6) Improve educational outcomes (31)Sensory experiences (6) Improve educational outcomes, improve mathematics
score (32)
Palettes for compost structures
Increase science education
$10/Palette (5) Diverts wasfe from landfills (18) decreases production of methane (18) Survey students before and after about eco-friendly practices at home before and after implementation.
Encourages/empowers students to take action (18) Increased practice of eco-friendly practicesBecomes a role model for other schools (18) Increased practice of eco-friendly practicesAdditionally educating parents (18) Increased practice of eco-friendly practices
Hay for compost Increase science education
$/bale Diverts wasfe from landfills (18) decreases production of methane (18) Survey students before and after about eco-friendly practices at home before and after implementation.
Encourages/empowers students to take action (18) Increased practice of eco-friendly practicesBecomes a role model for other schools (18) Increased practice of eco-friendly practicesAdditionally educating parents (18) Increased practice of eco-friendly practices
Raised beds Increase science education
$/Raised bed Reduces neighborhood crime (19) Improves educational outcomes (35) Compare test scores before and after implementation, compare costs before and after, measure temperatures before and after, survey students about eco-friendly practices before and after implementation.
Increases chances of eating more vegetables (19) Improves educational outcomes (36)Positive attitudes towards education (19) Improves educational outcomes (37)Support student connection to natural world (19) Enhances cognitive abilities, academic performance, social
relationships, self-discipline, nutrition, reduce stress, reduce ADD symptoms, increase physical activity (45)
More likely to accept people different than themselves (19) Prepares students for college (44)Increase self-understanding, interpersonal skills, cooperative skills (19)
Every dollar spent on social emotional programs decreases overall costs by $11 (43)
Reported "calm", "safe", "happy" (19) Every dollar spent on social emotional programs decreases overall costs by $11 (43)
Students teach people outside of school (19) Increased practice of eco-friendly practicesGeneral school satisfication (19) Improves educational outcomes (38)Decreases roof temperatures (20) Reduces UHI (20)
Cooler temperatures help with test scores (34)
Green roofs Increase science education
$9.5-$39 /per linear foot (9)
Decreases roof temperatures (20) Reduces UHI (20) Compare test scores before and after implementation, measure temperatures before and after, measure water waste before and after.
Cooler temperatures help with test scores (34)Increases wildlife habitat (20) Increased student comprehension, performance and
motivation (42)Reduces stormwater runoff (20) Decreased water waste (41)
Providing fresh vegetables for students grown in the raised bed
Creating a learning environment that adequately supports student's learning
$/per vegetable plant
Better dietary intake Improved educational outcomes (47) Compare test scores before and after implementation.
Lunch area concrete/drainage
Recreate a natural eco-friendly river habitat that mimics the historic one
$4-8/Square foot (2)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
Shade structures for students
Creating a learning environment that adequately supports student's learning
$/cubic yard Decreases exposure to UV (14) Skin cancer prevent (14) Compare test scores before and after implementation.
Keeps outdoor area cooler (15) Cooler temperatures help with test scores (34)Increases physical activity outside (15) Positive educational outcomes (33)
Drainage system in lunch area
Create a natural eco-friendly river habitat that mimics the historic one
$10-15 /per foot (11)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
Cistern Create a natural eco-friendly river habitat that mimics the historic one
$3,000-$10,000 (12)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
46Evaluation
Program/Design Element Objectives Cost Benefits/Function Impacts How to MeasureTree Canopy Decrease
negatives impacts from adjacent freeway
$/per tree Increases shade (27) Decreases UHI (4)Reduces exposure to UV B Rays (4)
Compare test scores before and after implementation, measure temperatures before and after, compare health scores before and after.
Reduce heat (27) Decreases UHI (4)Cooler temperatures help with test scores (34)
Remove ozone and PM 2.5 pollution from freeway (39) Improves student health (4)Encourages civic pride (4) Brings communities together (28)Decrease noise (13) Improve education (16)
Adding in rocks Recreate natural river habitat
$/per rock Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare water usuage before and after.
Helps with water conservation (24)
New pavement in courtyard Increase science education
$/dollar Increased color in educational environment (22) (23) Increased educational outcome (22) (23) Compare test scores before and after implementation.
Shrubery (maze) Increase outdoor activity and engagement
$/Shrub Enhances problem solving skills (6) Improve educational outcomes (29) Compare test scores before and after implementation, especially in mathematics.
Improve spatial awareness (6) Improve educational outcomes, improve mathematics score (30)
Enhances memory (6) Improve educational outcomes (31)Sensory experiences (6) Improve educational outcomes, improve mathematics
score (32)
Palettes for compost structures
Increase science education
$10/Palette (5) Diverts wasfe from landfills (18) decreases production of methane (18) Survey students before and after about eco-friendly practices at home before and after implementation.
Encourages/empowers students to take action (18) Increased practice of eco-friendly practicesBecomes a role model for other schools (18) Increased practice of eco-friendly practicesAdditionally educating parents (18) Increased practice of eco-friendly practices
Hay for compost Increase science education
$/bale Diverts wasfe from landfills (18) decreases production of methane (18) Survey students before and after about eco-friendly practices at home before and after implementation.
Encourages/empowers students to take action (18) Increased practice of eco-friendly practicesBecomes a role model for other schools (18) Increased practice of eco-friendly practicesAdditionally educating parents (18) Increased practice of eco-friendly practices
Raised beds Increase science education
$/Raised bed Reduces neighborhood crime (19) Improves educational outcomes (35) Compare test scores before and after implementation, compare costs before and after, measure temperatures before and after, survey students about eco-friendly practices before and after implementation.
Increases chances of eating more vegetables (19) Improves educational outcomes (36)Positive attitudes towards education (19) Improves educational outcomes (37)Support student connection to natural world (19) Enhances cognitive abilities, academic performance, social
relationships, self-discipline, nutrition, reduce stress, reduce ADD symptoms, increase physical activity (45)
More likely to accept people different than themselves (19) Prepares students for college (44)Increase self-understanding, interpersonal skills, cooperative skills (19)
Every dollar spent on social emotional programs decreases overall costs by $11 (43)
Reported "calm", "safe", "happy" (19) Every dollar spent on social emotional programs decreases overall costs by $11 (43)
Students teach people outside of school (19) Increased practice of eco-friendly practicesGeneral school satisfication (19) Improves educational outcomes (38)Decreases roof temperatures (20) Reduces UHI (20)
Cooler temperatures help with test scores (34)
Green roofs Increase science education
$9.5-$39 /per linear foot (9)
Decreases roof temperatures (20) Reduces UHI (20) Compare test scores before and after implementation, measure temperatures before and after, measure water waste before and after.
Cooler temperatures help with test scores (34)Increases wildlife habitat (20) Increased student comprehension, performance and
motivation (42)Reduces stormwater runoff (20) Decreased water waste (41)
Providing fresh vegetables for students grown in the raised bed
Creating a learning environment that adequately supports student's learning
$/per vegetable plant
Better dietary intake Improved educational outcomes (47) Compare test scores before and after implementation.
Lunch area concrete/drainage
Recreate a natural eco-friendly river habitat that mimics the historic one
$4-8/Square foot (2)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
Shade structures for students
Creating a learning environment that adequately supports student's learning
$/cubic yard Decreases exposure to UV (14) Skin cancer prevent (14) Compare test scores before and after implementation.
Keeps outdoor area cooler (15) Cooler temperatures help with test scores (34)Increases physical activity outside (15) Positive educational outcomes (33)
Drainage system in lunch area
Create a natural eco-friendly river habitat that mimics the historic one
$10-15 /per foot (11)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
Cistern Create a natural eco-friendly river habitat that mimics the historic one
$3,000-$10,000 (12)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
47Evaluation
Program/Design Element Objectives Cost Benefits/Function Impacts How to MeasureTree Canopy Decrease
negatives impacts from adjacent freeway
$/per tree Increases shade (27) Decreases UHI (4)Reduces exposure to UV B Rays (4)
Compare test scores before and after implementation, measure temperatures before and after, compare health scores before and after.
Reduce heat (27) Decreases UHI (4)Cooler temperatures help with test scores (34)
Remove ozone and PM 2.5 pollution from freeway (39) Improves student health (4)Encourages civic pride (4) Brings communities together (28)Decrease noise (13) Improve education (16)
Adding in rocks Recreate natural river habitat
$/per rock Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare water usuage before and after.
Helps with water conservation (24)
New pavement in courtyard Increase science education
$/dollar Increased color in educational environment (22) (23) Increased educational outcome (22) (23) Compare test scores before and after implementation.
Shrubery (maze) Increase outdoor activity and engagement
$/Shrub Enhances problem solving skills (6) Improve educational outcomes (29) Compare test scores before and after implementation, especially in mathematics.
Improve spatial awareness (6) Improve educational outcomes, improve mathematics score (30)
Enhances memory (6) Improve educational outcomes (31)Sensory experiences (6) Improve educational outcomes, improve mathematics
score (32)
Palettes for compost structures
Increase science education
$10/Palette (5) Diverts wasfe from landfills (18) decreases production of methane (18) Survey students before and after about eco-friendly practices at home before and after implementation.
Encourages/empowers students to take action (18) Increased practice of eco-friendly practicesBecomes a role model for other schools (18) Increased practice of eco-friendly practicesAdditionally educating parents (18) Increased practice of eco-friendly practices
Hay for compost Increase science education
$/bale Diverts wasfe from landfills (18) decreases production of methane (18) Survey students before and after about eco-friendly practices at home before and after implementation.
Encourages/empowers students to take action (18) Increased practice of eco-friendly practicesBecomes a role model for other schools (18) Increased practice of eco-friendly practicesAdditionally educating parents (18) Increased practice of eco-friendly practices
Raised beds Increase science education
$/Raised bed Reduces neighborhood crime (19) Improves educational outcomes (35) Compare test scores before and after implementation, compare costs before and after, measure temperatures before and after, survey students about eco-friendly practices before and after implementation.
Increases chances of eating more vegetables (19) Improves educational outcomes (36)Positive attitudes towards education (19) Improves educational outcomes (37)Support student connection to natural world (19) Enhances cognitive abilities, academic performance, social
relationships, self-discipline, nutrition, reduce stress, reduce ADD symptoms, increase physical activity (45)
More likely to accept people different than themselves (19) Prepares students for college (44)Increase self-understanding, interpersonal skills, cooperative skills (19)
Every dollar spent on social emotional programs decreases overall costs by $11 (43)
Reported "calm", "safe", "happy" (19) Every dollar spent on social emotional programs decreases overall costs by $11 (43)
Students teach people outside of school (19) Increased practice of eco-friendly practicesGeneral school satisfication (19) Improves educational outcomes (38)Decreases roof temperatures (20) Reduces UHI (20)
Cooler temperatures help with test scores (34)
Green roofs Increase science education
$9.5-$39 /per linear foot (9)
Decreases roof temperatures (20) Reduces UHI (20) Compare test scores before and after implementation, measure temperatures before and after, measure water waste before and after.
Cooler temperatures help with test scores (34)Increases wildlife habitat (20) Increased student comprehension, performance and
motivation (42)Reduces stormwater runoff (20) Decreased water waste (41)
Providing fresh vegetables for students grown in the raised bed
Creating a learning environment that adequately supports student's learning
$/per vegetable plant
Better dietary intake Improved educational outcomes (47) Compare test scores before and after implementation.
Lunch area concrete/drainage
Recreate a natural eco-friendly river habitat that mimics the historic one
$4-8/Square foot (2)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
Shade structures for students
Creating a learning environment that adequately supports student's learning
$/cubic yard Decreases exposure to UV (14) Skin cancer prevent (14) Compare test scores before and after implementation.
Keeps outdoor area cooler (15) Cooler temperatures help with test scores (34)Increases physical activity outside (15) Positive educational outcomes (33)
Drainage system in lunch area
Create a natural eco-friendly river habitat that mimics the historic one
$10-15 /per foot (11)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
Cistern Create a natural eco-friendly river habitat that mimics the historic one
$3,000-$10,000 (12)
Improved understanding of hydrologic processes (24) Help with STEM education (24) Compare test scores before and after implementation, compare cost of water before and after.
Helps with water conservation (24)
48The End
49
AboutGreenHeartLouisville.(n.d.).Green Heart Project. Retrievedfromhttps://louisville.edu/greenheart/about
AirQualityandYourHealth.(n.d.a.).Spare the Air.Retrivedfromhttp://www.sparetheair.org/stay-informed/air-quality-and-your-health
BenefitsofanOutdoorClassroom.(n.d.).Olson Lewis.Retrievedfromhttps://olsonlewis.com/wp-content/uploads/2018/10/Outdoor-classroom-BENEFITS-2.jpg
BenefitsofOutdoorPlay-33reasonstogetanoutdoorclassroomforyourSchool.(n.d.).Cabinco Structures.Retrievedfromhttp://cabincostructures.co.uk/outdoor-play-benefits/
CalEnviroScreen3.0(2018).The Office of Environmental Health Hazard Assessment (OEHHA).Retrievedfromhttps://oehha.ca.gov/calenviroscreen/report/calenviroscreen-30
CaliforniaSchoolDirectory.(n.d.). California Department of Education. Retrievedfromhttps://www.cde.ca.gov/SchoolDirectory/details?cdscode=36678196036404
Claremont,CANoiseHeatmap.(n.d.). Rentlingo. Retrievedfromhttps://www.rentlingo.com/noise-index?latitude=34.084827&longitude=-117.70160829999998
DistrictSummary.(n.d.a). Ed Data: Education Data Partnership. Retrievedfromhttp://www.ed-data.org/district/San-Bernardino/San-Bernardino-County-Office-of-Education
Edgecomb,Misty.(2017).JourneytotheCoronaryValley.The Nature Conservancy. Retrievedfromhttps://www.nature.org/en-us/what-we-do/our-insights/perspectives/journey-to-the-coronary-valley-louisvilles-green-heart-project/
Green,Jared.(2017).GreenHeart:FirstMajorClinicalStudytoExaminetheHealthImpactofTrees. The Dirt.Retrievedfromhttps://dirt.asla.org/2017/12/18/in-louisville-first-major-clinical-study-will-examine-the-health-impact-of-trees/
Historical1857U.S.CoastSurveyMapofSanAntonioCreek(n.d.).Amazon.Retrievedfromhttps://www.amazon.com/Historical-Antonio-Oakland-California-Francisco/dp/B01N8PCKRT
Kuo,C.,Huynh,R,Luu,C,Morphew,T.,Scott,L.,&Huynh,P.(2010).TheImpactofSchoolProximitytoFreewaysonAsthmaPrevalenceandAsthmaControl.The Journal of Allergy and Clinical Immunology.125(2):1.Retrievedfromhttps://www.jacionline.org/article/S0091-6749(09)02708-0/fulltext
LinearLandscapes:FabricatingaRural/UrbanInterface.(n.d.).ESKYIU. Retrievedfromhttp://eskyiu.com/linear-landscapes/
MapofCaliforniahighlightingSanBernardinoCounty.svg.(n.d.).Wikipedia. Retrievedfromhttps://en.wikipedia.org/wiki/File:Map_of_California_highlighting_San_Bernardino_County.svg
MiddleSchoolBoundaries.(2015). Ontario-Montclair School District. Retrievedfromhttps://www.omsd.net/cms/lib/CA02204858/Centricity/domain/4/maps/All_District_maps.pdf
MissionStatement.(n.d.).Serrano Middle School.Retrievedfromhttps://www.omsd.net/serrano
Montclair,CARealEstate&DemographicData.(n.d.a.).Neighborhood Scout. Retrievedfromhttp://www.ed-data.org/district/San-Bernardino/San-Bernardino-County-Office-of-Education
Montclair,CA(EMontclairPlazaLN/CentralAve).(n.d.b.).Neighborhood Scout. Retrievedfromhttps://www.neighborhoodscout.com/ca/montclair/montclair-plaza-ln
Nature’sClassroom(2018).[TwitterPage].Retrivedfromhttps://twitter.com/NaturesClassRm
OverallHealthEffects.(n.d.b.).Spare the Air.Retrivedfromhttp://www.sparetheair.com/health.cfm
References
50
UnderstandingtheUrbanHeatIslandIndex.(n.d.a.)CalEPA.Retrievedfromhttps://calepa.ca.gov/climate/urban-heat-island-index-for-california/understanding-the-urban-heat-island-index/
UrbanHeatIslandInteractiveMaps.(n.d.b.).CalEPA.Retrievedfromhttps://calepa.ca.gov/climate/urban-heat-island-index-for-california/urban-heat-island-interactive-maps/
SanAntonioCreek(SanBernardinoCounty).(n.d.).Revolvy.Retrievedfromhttps://www.revolvy.com/page/San-Antonio-Creek-%28San-Bernardino-County%29
SanBernandinoCountyMap.(n.d.).World Map Store.Retrievedfromhttps://www.worldmapstore.com/product/wall-maps/san-bernardino-county-map/
SchoolSummary:SerranoMiddle.(n.d.a.).Ed Data: Education Data Partnership. Retrievedfromhttp://www.ed-data.org/school/San-Bernardino/Ontario--Montclair/Serrano-Middle
Theimpactofnoiseonchildhoodcognitivedevelopment.(n.d.).Center for Hearing and Communication. Retrivedfromhttp://chchearing.org/noise/children/learning/
TopoView.(n.d.).USGS. Retrievedfromhttps://ngmdb.usgs.gov/topoview/viewer/#15/34.0844/-117.7002
UrbanHeatIslandInteractiveMaps.(n.d.).CalEPA.Retrievedfromhttps://calepa.ca.gov/climate/urban-heat-island-index-for-california/urban-heat-island-interactive-maps/
Sannuta,Saima.(n.d.).VegetationinLandscapeArchitecture.Slideshare.Retrievedfromhttps://www.slideshare.net/sweetsaimaiqbal/vegetation-in-landscape
https://www.suncalc.org/#/34.0825,-117.7019,17/2019.03.18/13:04/1/0
https://www.statnews.com/2016/11/03/biotech-results-stock-crash/
http://www.edu.pe.ca/gray/class_pages
51Evaluation References
1 https://www.homeadvisor.com/cost/walls-and-ceilings/install-a-wall/2 https://homeguide.com/costs/concrete-slab-cost3 https://www.thumbtack.com/p/mural-pricing4 https://www.treepeople.org/tree-benefits5 https://www.thebalancesmb.com/how-much-do-pallets-cost-28778576 https://mommyuniversitynj.com/2016/10/04/10-educational-benefits-of-exploring-corn-mazes/7 https://www.americanmeadows.com/wildflower-seeds/bulk-wildflower-seeds8 https://www.aaastateofplay.com/different-types-and-benefits-of-playground-slides/9 http://www.co.saint-marys.md.us/dpw/guardrails.asp10 https://www.sciencedaily.com/releases/2008/07/080717110228.htm11 https://www.fixr.com/costs/french-drain-installation12 https://home.costhelper.com/cistern.html13 https://www.sciencedirect.com/science/article/pii/S161886671000055514 https://www.cdc.gov/cancer/skin/pdf/shade_planning.pdf15 https://info.mayrecreation.com/blog/6-benefits-of-shade-structures16 https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3757288/17 https://www.wsdot.wa.gov/environment/protecting/noise-walls18 https://greenactioncentre.ca/reduce-your-waste/benefits-of-school-wide-composting/19 https://www.slowfoodusa.org/contents/sdownload/3591/file/Benefits-of-School-Gardens-Denver-Urban-Gardens.pdf20 https://bbk12e1-cdn.myschoolcdn.com/ftpimages/1059/misc/misc_157635.pdf21 http://crpbayarea.org/painting/benefits-of-murals/22 https://www.researchgate.net/publication/15176872_Children's_Emotional_Associations_with_Colors23 http://www.colorobjects.com/en/color-columns/the-colour-real/item/357-psychology-of-colour-in-the-educational-environment.html?fb_comment_id=1375447692737406_973224 http://savethewater.org/education-resources/stem-and-water-science-education/25 https://research-information.bristol.ac.uk/en/theses/a-study-in-educational-development-and-civic-pride-in-the-city-of-worcester-during-the-19th-century(1c631792-fef3-4533-a5d8-fe32db300843).html26 http://crpbayarea.org/painting/benefits-of-murals/27 https://www.epa.gov/green-infrastructure/reduce-urban-heat-island-effect28 http://www.chroniclejournal.com/opinion/columns/why-civic-pride-is-important/article_d14fd948-e252-11e5-8ead-33fc910ae6ad.html29 https://www.tandfonline.com/doi/abs/10.1080/09720073.2016.11892118?journalCode=ranp2030 https://link.springer.com/article/10.1007/s10639-018-9747-x31 https://www.frontiersin.org/articles/23378032 https://www.goodstart.org.au/news-and-advice/october-2016/exploring-the-benefits-of-sensory-play33 https://www.ncbi.nlm.nih.gov/pubmed/2922946234 https://www.hks.harvard.edu/announcements/when-heat-student-learning-suffers35 http://cepa.stanford.edu/sites/default/files/torrats-espinosa-seda-crime.pdf36 https://www.cdc.gov/healthyyouth/health_and_academics/pdf/health-academic-achievement.pdf37 https://www.ohio.edu/education/academic-programs/teacher-preparation/department-of-teacher-education/masters-programs/loader.cfm?csModule=security/getfile&PageID=218525438 https://www.sciencedirect.com/science/article/pii/S187704281002408039 https://enviroatlas.epa.gov/enviroatlas/DataFactSheets/pdf/ESC/PercentParticulateMatterPM25removedannuallybytreecover.pdf40 https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6121293/41 https://www.epa.gov/green-infrastructure/benefits-green-infrastructure
52
42 https://www.nwf.org/Garden-for-Wildlife/Create/Schoolyards/Benefits43 https://www.rwjf.org/en/blog/2017/08/learning-social-skills-in-school.html44 http://gcmag.org/why-having-an-open-mind-is-essential-for-college/45 https://naturalearning.org/wp-content/uploads/2017/09/Benefits-of-Connecting-Children-with-Nature_InfoSheet.pdf46 https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2728658/47 https://www.mdpi.com/2227-9032/5/4/60/pdf4849505152535455
53Image Sources
1.SerranoMS.(n.d.).[TwitterPage].Retrivedfromhttps://twitter.com/Serrano_OMSD2.https://www.statnews.com/2016/11/03/biotech-results-stock-crash/3.https://schoolbag.info/biology/living/207.html4.https://www.austincc.edu/histologyhelp/tissues/tc_sim_cu_e.html5.https://depositphotos.com/106553816/stock-video-cells-and-bacteria-under-microscope.html6.https://copd.net/living/problem-breathe-right/7.https://nbihealth.com/protect-mitochondria-protect-health/