Pdm314 health optimized

One a Day*Multivitamins Great tasting Fruiti-ssentials gummiesor easy to taketablets.60 - 90's *Excludes Weightsmart 90’s

OmbrelleContinuousSpray SunscreenEven coverage withUVA-UVB protection.140mL

One a DayMultivitamins Great tasting Fruiti-ssentials gummiesor easy to taketablets.60 - 90's *Excludes Weightsmart 90’s

One a Day*One a Day

PEOPLES DRUG MART • PEOPLES PHARMACY

PeopleFirst

PDM 314 Vol. 13 No. 6

pleFiHelping People Live Better Lives

PEOPLES PHARMACY

*Excludes Weightsmart 90’s

899Ea.

PHARMACY ADVICE ON

BABY CAREDR. HISTER ON

SHINGLESHELPFUL ADVICE ON

WATER SAFETYTIPS FOR HEALTHY

DINING OUT COMPANY’S COMING GRILLED CRANDRIZZLE SALMONRECIPE

PDM 314 Vol. 13 No. 6

799Ea.

Boost Meal replacement.Regular or Plus

6 x 237mL

OmbrelleContinuousSpray SunscreenEven coverage withUVA-UVB protection.140mL

PEOPLES PHARMACYPEOPLES PHARMACY

Prices In Effect Until July 7Prices In Effect Until July 7Prices In Effect Until July 7Prices In Effect Until July 7

1499Ea.

NEW!

TWO WEEK SALE PERIOD - Prices In Effect Until July 7

Helping People Live Better Lives

JamiesonCalciumHelps to prevent

bone loss.650mg or With Vitamin D

100 + BONUS 20or Calcium Magnesium

or With Vitamin D3100 + BONUS 100’s

webber naturalsMelatonin or LuteinSleep support or foreye health.Easy Dissolve 5mg Extra Strength 120 +BONUS 24’s or 60 Softgels

999Ea. 399

Ea.

JamiesonMagnesiumor B12Natural sources.B12 Time Release1200mcg, 60 + 20’sor Magnesium250mg, 90’s

899Ea.

ClaritinAllergy24 hour non-drowsyrelief of allergysymptoms or withsinus relief. Tablets, Sinus orRapid Dissolve 30's

2199Ea.

Pepcid Acid ControllerRelief of heartburn, indi-gestion and upset stom-ach for up to 12 hours.Regular Strength30's, Easy SwallowMaximum Strengthor Complete 25's

999Ea.

Lax A DayLaxativeTaste-free, and withno gritty texture. Provides gentle reliefof constipation. 238g, 10 X 17g

1199Ea.

Deep ReliefPain ReliefPain relief you applydirectly to where ithurts.Rub, Gel or PatchesAssorted Selection

20%OFF

Regular Retail

Benadryl Allergy ReliefFast effective relief ofmajor allergy symp-toms.Extra Strength 25mg, 24's

799Ea.

Johnson & Johnson

First Aid KitOn the go or forminor home or officefirst aid treatment.

1999Ea.

2 People First Join us on acebook.com/peoplesdrugmart

JamiesonCalciumHelps to prevent

bone loss.650mg or With Vitamin D

100 + BONUS 20or Calcium Magnesium

or With Vitamin D3100 + BONUS 100’s

699Ea.

99

webber naturalsGlucosamineSulfateHelps to relieve symp-toms of osteoarthritis andis a factor in the buildingof healthy cartilage.500mg300 + BONUS 30's300 + BONUS 30's

999Ea.

899Ea.

*No purchase necessary. Visit flipthelid.comfor full rules and regulations. Offer applies to

specially marked packages only.

Folic Acid orVitamin D3Insurance your meet-ing prenatal nutrientrequirements.Folic Acid 100'sVitamin D 120's

*No purchase necessary. Visit flipthelid.comfor full rules and regulations. Offer applies to

specially marked packages only.

Soft Grip CapPage 5Easy open cap for people sufferingfrom arthritis.

contentsPeople First

from arthritis.

Helping People Live Better Lives

4 ShinglesDr. Art Hister looks at shingles, a reactivation of an old chicken pox infection, a health concern for adults 50 plus.

5 Trusted Health ProductsWide selection of items to help you live a better life.

6 Baby CarePeoples Pharmacist Ian Lloydprovides tips on keeping your baby happy and healthy.

7 Baby HealthSelection of health products to help keep your baby happy.

9 Pharmacist RecommendedHelpful tips on water safetyfor children. Health news onB vitamins and how they may fend off Alzheimer’s.

14 Tips for Healthy Dining Out Darlene Booth helps you make the right choices in choosing healthy menu items.

15 Grilled Crandrizzle SalmonBrand new feature recipeFrom Company’s ComingHealthy Family Recipes.

Soft Grip Cap

Easy open cap for people suffering

Soft Grip CapPage 5Easy open cap for people sufferingfrom arthritis.

4 Shingles

5 Trusted Health Products

6 Baby Care

7 Baby Health

9 Pharmacist Recommended

Like Perry Como (remember him? Greatsweaters, eh? And what a lovely soothing smoothvoice – no one croons like that any longer, alas), Iget letters, I get letters, I get lots and lots of letters.Actually, no one gets lots of letters any more, not

even a health columnist like me, but I do get lotsand lots of emails, and most of them, of course,detail some very frustrating situation that the emailwriter has witnessed or endured, and unfortu-nately, some emailers tell me stories about what anobjective reader could only describe as horrible oreven tragic medical problems.In other words, I am used to reading about

misery. So you really have to trust me when I tell you

that I’ve learned over the years that high on thelist of the most frustrating and debilitating med-ical problems that can befall an aging individualis to end up with enduring pain from a case ofshingles, what doctors refer to as post-herpeticneuralgia or PHN. So what is shingles? And why does PHN happen

to some and not to others?Well, the first question is easy to answer.Shingles (AKA a herpes zoster infection) is nothing

more than the reactivation of an old chicken pox in-fection, and those of you who can still rememberPerry Como will also easily remember that back inour day, nearly every kid you knew got the telltaleoutbreak of a chicken pox infection sometime dur-ing early childhood, although quite happily chicken

pox has now become much more rare as a result afew years ago of the introduction of an effectivechicken pox vaccine (but please note that thischicken pox vaccine is not the same thing as theshingles vaccine that I will discuss later on).(As an important aside about chicken pox, however,I must note that since chicken pox was so prevalentonce, that there were even some parents out therewho used to organize “chicken pox parties” duringwhich an infected child would pass this highly con-tagious virus to other pre-school kids in the neigh-bourhood who had not yet been infected but whowould now get that infection out of the way beforethey started school, a practice that is fairly risky, how-ever, since the usually benign chicken pox infectioncan occasionally result in significant, even life-threat-ening complications. In fact, as I am writing this,there is a story on one of the wire services about a15-year-old girl from Ohio who has just died as aconsequence of chicken pox).But back to shingles, and the connection here

between chicken pox and shingles is this: like kidswho never again move out of the basement suitein mom and dad’s house once they’ve managed tore-establish their residence down there, the chickenpox virus also never leaves once it’s lodged in yoursystem because what that virus does after enteringyour body is to burrow into your nerve tissue andto remain there forever.And unfortunately, under certain circumstances

which we still don’t fully understand (although itContinued On Page 11

Dr. Art HisterSHINGLES


TWO WEEK SALE PERIOD - Prices In Effect Until July 7

Relief For Your Discomfort Or Pain

peoplesdrugmart.com People First 5

Advil NighttimeLiqui-gel pain reliefthat starts to workfast for a restful, painfree sleep.Liqui-Gels 20's

Aleve Soft GripArthritis CapThe new soft grip capmakes it even easierto open, for long last-ing 12 hour relief.125 Caplets

799Ea. 1699

Ea.

TylenolPain ReliefEffective pain reliefyou can trust.100 - 150's or Nighttime 40'sSelect Types

1199Ea.

299Ea.

essentiel DentureTabs Effervescent actionremoves stains,fights odour andkills bacteria.108 Tablets

499Ea.

Gravol Anti-NauseantBanish motion sicknessfrom travel plans bychoosing a formulathat’s just right for anymember of your family.Assorted Selection

20%OFF

Regular Retail

Polysporin Antibiotic orPoly To GoHelps protect againstinfection from cuts.Antiseptic Spray7.7mLor Ointment orCream 15g

699Ea.

Spectro Skin CareJel or Derm Soap FreeCleanser or EczemaCareAssorted Selection

20%OFF

Regular Retail

DocusateSodiumRelief of occasionalconstipation. Helpsto soften stools.100's

999Ea.

CalamineLotionRelief for skin irrita-tions and itchingcaused by insectbites, sunburn andpoison ivy.250mL

Earn Rewards OnYour Health Care

PurchasesIt Pays To ShopAt Peoples

Extra Strength IbuprofenExtra strength relief of body pain, fever,arthritis, head ache and inflammation.

400mg, 32’s

NEW!

Relief For Your Discomfort Or Pain

Extra Strength IbuprofenExtra Strength IbuprofenExtra strength relief of body pain, fever,

Extra Strength IbuprofenExtra strength relief of body pain, fever,

Extra Strength Ibuprofenarthritis, head ache and inflammation.

400mg, 32’s400mg, 32’s

499Ea.

Continued On Page 8

Despite being smelly, loud and disruptive to one'ssleep, babies are wonderful. They really don't needmuch in the way of special care. Just add goodfood, love, lots of sleep and they thrive. Often theparents need more care. Sometimes little ones needspecial attention. They get colds, skin rashes,bumps and bruises. This month we shall take a condensed look at baby care.

Jokes about missing instruction manuals aside,babies need a lot of attention. Lets start our discus-sion about baby care needs from the top. Cradlecap (seborrheic dermatitis) is usually the first med-ical condition parents encounter. While potentiallyunsightly, this is a harmless condition. It is causedby an overproduction of skin oil on the scalp. Thisdried oil looks like dandruff with yellow/brownscales or crusty patches. Cradle cap will often re-solve on its own. Parents often feel the need to dosomething; treatments for cradle cap are simple.You can massage the scalp or use a soft brush to re-move the scales. Shampooing the scalp, only oncea day, will aid in the clearing the scalp. For moretroublesome cases, try massaging a small amountof olive oil into the scalp about one-half hour beforeshampooing. Bring this condition to the attentionof your doctor if the scales spread beyond the scalpor if there is any bleeding.

Next we arrive at the eyes. Little ones are proneto getting conjunctivitis (inflammation around theeye). This should be brought to the attention ofyour physician quickly, to ensure there are no otherissues. Usually, it is a minor viral or bacterial infec-tion which is easily resolved with treatment. Parents

can remove any yellow discharge around the eyewith a lukewarm, damp cloth.

Teething can be the most troublesome condi-tion new parents will face. With good reason, ifsharp bones started to poke through my gums, Iwould start yelling too. Symptoms of teething areunmistakable: drooling, facial rash, red cheeks, un-usual irritability, sleep problems and loose stools.The best treatments involve providing cool, hardthings to gnaw on. Our favourite was a damp facecloth and a refrigerated soother. For more persist-ent symptoms, I recommend homeopathicteething remedies. These remedies are very safeand can be quite effective. You can also apply a verysmall amount of topical anesthetic teething gel. Atnight time, I recommend giving a dose of aceta-minophen if teething disturbs sleep. Check withyour Peoples Pharmacist for the proper dose. Par-ents are reluctant to give their little ones medica-tion. However, a good night’s sleep is veryimportant; both for parents and baby .

There is no bigger parental concern than infantswith cold and flu symptoms. In most cases, nomedications are needed. In fact it is not recom-mended that you use any over the counter coughand cold products for children under six years old.It is also not recommended that you use topicalmenthol and camphor rubs on children under twoyears old. For nasal congestion, the best treatmentsare saline nasal drops, a humidifier and lots of flu-ids. If congestion is affecting sleep, try placing themin their car seat to sleep. When a child coughs inthe night, the only ones who lose sleep are their

Ian LloydPeoples PharmacistBABY CARE


Your Source For Baby Care

Prenatal &Postpartum

Multivitamins Help to reduce the risk of neural

tube defects.120 Tablets

essentielIhle's Paste Helps prevent andtreat diaper rash.25% Zinc Oxide150g

Orajel TeethingPain ReliefInstant relief for chil-dren’s mouth pain.Teething Pain orNighttime9.5g

499Ea.

essentielZinc Cream Helps prevent andtreat diaper rash.15% Zinc Oxide150g

499Ea.

Pediatric ElectrolyteBalanced electrolytes,carbohydrates andwater helps kids stayhydrated, without allthe sugar found insports drinks and pop.1 Litre

799Ea.

First ResponsePregnancyTestKnow for sure andknow faster with over95% accuracy in oneminute.2 Analog Tests

1499Ea.

First Response Ovulation KitDetects the two daysduring your cyclewhen you are mostlikely to conceive.9 Tests

3499Ea.

Trojan Condoms Enhances intimacywhile providingprotection.10 - 12's

799Ea.

Tylenol Children’sRelief for children’saches, pain and fever.Children’s, Jr.Strength or InfantAssorted Selection

699Ea. 499

Ea.

TWO WEEK SALE PERIOD - Prices In Effect Until July 7 peoplesdrugmart.com People First 7

Prenatal vitamins help to coverany nutritional gaps that mightbe in your pre and postpartumdiet.Formulated with vitamins andminerals, folic acid, iron, andcalcium help prevent neuraltube birth defects and insureyour nutritional needs arebeing met.

499Ea.

Allergy Formula For ChildrenFast, long lasting reliefformulated for kids.100mL

Prenatal &Postpartum

Multivitamins Help to reduce the risk of neural

tube defects.120 Tablets

Prenatal vitamins help to coverany nutritional gaps that mightbe in your pre and postpartumdiet.Formulated with vitamins andminerals, folic acid, iron, andcalcium help prevent neuraltube birth defects and insureyour nutritional needs arebeing met.being met.899

Ea.

Join us on acebook.com/peoplesdrugmart

Travel VaccinationsAt Peoples PharmacyMost Peoples Pharmacists can nowadminister travel vaccinations on-site

A visit to your doctor, and a subsequent visitto a Peoples Pharmacist that is trained andcertified to provide travel vaccinations, canhelp you with travel health.

Besides travel vaccinations, a Peoples Phar-macist can also recommend medicationsfor stomach troubles and motion sickness.

Talk to a Peoples Pharmacist for advice onstaying healthy while you travel.

PmorFFrdeunitnoCo...dyooylLnaIIa

urbottegroft'nodosraeyenofoegayenohfolufnoopsohtaergA.stnerap

6egaagP

T.sdrawretfahteetriehthsuohdeziruetsapesutsuJ.dlenoynaroftaergsisihT.ygnihguocrofydemeremo

deinapmoccasi%05nahterom(octifinaicisyhpgnirB.gnizirut

ylnoehTdnayenoehtrevo-aetasig

omehT.revefhgihaybdnahtregnoldetsalsah,)%tnuomatnacifingisasrevottaehtothsarniksynag

nommoctsorosyadowtydobehtfoafonoitnet

iisaedidoogynamynaroftsicamrahPnoelttilafosmotmoh,elpmisynamhnacdnaytivitcagrellataertotdesusi,peelsrofetarepaheslegnihtyrryevemitemosItcudorpurbottegroftnod

Yfhdlha,ediuGhtlaeHCBehtniT.evahthgimyehtsaediyruoyksA.ulfdnadlocs'ehttaertplehotseidemeremrehT.gnipeelshtiwplehoc-itnadlimsahoslati,seignelihW.enimardyhnehpidelpoepdnadekrowtonsaihguocrofdnemmocerseT.sdrawretfahteetriehthsu

resolcatpekdesuew,esrow

noitatirridnaarrepaiD.emitidehtgnipeekonimroF.hsarlumadaheWuoneeraerehTerapwenhsardeinapmoccasi

kisallewsaeraerehTselpoeP-pmysehoseraegnihguoyllamron-sederaretfa,gnylnoehT

diifikhl”mottob“ehtnoeyeiniatnocmaercreirrabadfI.slootsroenirumorfdesuacyllarenegerasehsaangniwolladnayrrydrepaliderewew,smotpmysroaertothcaorppaegats-ittseidemerhsarrepaidhgudsihtiwlaedotevahstneomehT.revefhgihaybd

idreirraB.enildnacnizgntogsgnihtssentewybdmottobdektuobatnegirepaidgnita.kooballifo.hsarrepaidnommoctso

iehtlaehotderiuqyryevesgnihtwensyrevsinikswentiwsmelborpevahr,sehsar,sehsaR.tinuhtlaehroecifuGhtlaeHCBapuuoysngisgninraw

nagninaelcelttilasiniksrihtlla,sesactsomnI.yadpxeerayehtdnaevitisnemronsisihT.niksriehthttnafnitahtsmeestI.sehsar

.od,yy,camrahpynataediuuoY.rr.oftuohctawdluohs

othguorbevaherdnagnillewsrclagnuf-itnamotpmysfognidesudnamaercauqedeximewsyrryeveplehottcetorpsmaerc

-siomdn-ersitahotdesopriehT.lamsyawlast

-fosrotckcipnac

noC

dehteesotnirethguadruokrowtondidsihtfI.ssenderbenositrocehT.maesaeyybdesuacebyamsmnahcrepaidyrryevetasihtdositroc,lagnuf-itnastraplaottobehtfI.noitidnocniksdnastnatirrimorfniksehtt

01egaagPPanOdeunitn

-kcuL.rr.otcoddluowew,knwodsgnirehtecneh,t-nesroWWo.egcnizdnaeno,dabtogmosmeescnizd

ePtAevarTTr

etsinimdaoePtsoM

rahPselpoeitaniccaVVale

snoitaniccavlevartrecstsicamrahPselpo

ycamrsno

etis-noswonna

c

e

amotsrofnactsicamartsediseB

wuoyplehotdeifitrecelpoePaotoyottisivA

tsinimda

n

s

oitomdnaselbuorthcemdnemmoceroslanpoePa,snoitaniccavlev

.htlaehlevarthtiwtaniccavlevartedivorpoartsitahttsicamrahPseqesbusadna,rr,otcodruo

noitaniccavlevartre

.

e

ssenkcissnoitacid-rahPselp

nac,snoitdnadeniatisivtneuq

tisnos

tsriFelpoeP8 unioJ

aehgniyatsPaotklaTTa

nosu gurdselpoep/moc.koobeca

.levartuoyelihwyhtlaaroftsicamrahPselpoeP

tramg

noecivda

pharmacistrecommendedHealth & Wellness Information From Your Peoples Pharmacist

You might be surprised to learn that the sec-ond leading cause of death in children agedone to four is drowning. Here are some tips onhow to help keep your kids safe when playingnear water — whether a swimming pool, riveror lake.• Make sure young children are always wear-ing a lifejacket or personal flotation device(PFD) when playing in, on or around water.Keep young children within arm's reach at alltimes.• Choose a safe place to swim, such as a super-vised waterfront or beach. Check for hazardsbefore wading in — including any posted in-formation about water pollution.• Enroll your child in a water safety and swim-ming program — and sign yourself up to learnbasic lifesaving skills.• An adult should actively watch children at alltimes while they are in a pool. For toddlers, anadult should be in the water and within arm’sreach, providing “touch supervision.”• For older children that know how to swim,an adult should be paying constant attentionand be free from distractions, like talking onthe phone, socializing, tending householdchores, or drinking alcohol. The supervisingadult must know how to swim.

Swimming Pool RulesIf you have a pool, in-sist that the followingrules are followed:• Keep toys away fromthe pool when the poolis not in use.• Empty blow-up poolsafter each use.• No tricycles or otherriding toys at poolside.• No electrical appliances near the pool.• No diving in a pool that is not deep enough.• No running on the pool deck.Swimming Pool Fences

Children can climb out a window, though apet door, or sneak out a door to get to theback yard and the pool. To prevent small chil-dren from entering the pool area on their own,there should be a fence that completely sur-rounds the pool or spa. Combined with thewatchful eyes of an adult, a fence is the bestway to protect your child and other childrenwho may visit or live nearby.

Be safe this summer!The information contained in this article should not be used as a substi-

tute for the medical care and advice of your pediatrician. There may be vari-ations in treatment that your pediatrician may recommend based onindividual facts and circumstances.


Elderly people could fend off Alzheimer’s disease bytaking supplements of B vitamins as B vitamins werefound to reduce the brain shrinkage associated withthe disease by up to 90%, reports an Oxford Universitystudy.

Vitamins B6, B12 and folic acid can lower levels ofhomocysteine, an amino acid linked to shrinkage of thebrain in conditions such as Alzheimer’s disease. Previousstudies had shown that patients with mild cognitive im-pairment suffered 50% less brain shrinkage overall if

they took B vitamins.However, the study of 156 patients by researchers at

Oxford University, found that shrinkage was reducedby 90% in areas of the brain most vulnerable inAlzheimer’s patients.

Experts cautioned against drawing any firm conclu-sions from the “early” results and said a balanced dietand exercise “can help to keep our brains healthy aswe get older.”

health news

B Vitamins May Slow The Advance Of Alzheimer’s

Water And Swimming Pool Safety Tips

Ian Lloyd...Continued From Page 8

ily, it never got that far. I'm certain my - now - younglady is terribly embarrassed that I have discussed herbottom issues with a large segment of the popula-tion of British Columbia.

Stomach issues and colic are troubles that alwaysseem to appear at bedtime. Not sure why, I guessparents are always lucky. Babies with healthy lungscry. The term 'colicky' is applied to any baby thatcries for longer than two hours without stopping.Many times, parents associate this with a baby's pos-sible stomach pain. It might not be the case, but itgives parents a place to start. The most commonculprit for digestive and skin issues is intake of milkproducts. Other foods that may cause problems forbreastfed infants are peppers, cucumbers and cru-ciferous vegetables. We always kept a food diary totry and identify food intolerances. The omission ofcertain foods can improves a baby’s health. A newlyemerging thought is that little ones can benefit bygiving them health stomach bacteria. There are now

probiotic formulations specifically designed for in-fants. Ask your Peoples Pharmacist if they stock thesepreparations, they are often stored in a fridge. Wehad great success with chiropractic care for our littleone's colic issues; the results were rapidly noticeable.

Caring for a little one is tough. There is no instruc-tion manual and they are not good at communicatingtheir needs. Luckily that little smile is all that is neededto make it rewarding. When you need help there arelots of places to turn. Your family doctor and PeoplesPharmacist are great sources for information on babycare. You can also look in the BC Health Guide and agreat website is BabyCenter.ca. It is OK to ask for abreak. Even having someone watch the little one foran hour, while you go for a walk or have a bath, cando wonders for your constitution. It will get better, Ipromise.

Written By Ian Lloyd, Pharmacist & Chartered Herbalist, Peoples Pharmacy


Taking Your Health To HeartLifesource Deluxe OneStep MonitorA sleek, easy-to-use bloodpressure monitor withone button operation andadvanced features.

Pharmacistrecommended

for peoplewho like to save.

5999Ea.

JuneFacebookPrize DrawWin A Jamieson prize pack.Simply “like us” and you areentered into the draw.facebook.com/peoplesdrugmart

Biomedic products are the trusted family brandfor Peoples Drug Mart and Peoples Pharmacy.The Biomedic brand offers incredible value andis backed by a 100% satisfaction guarantee.

If you’re suffering from high prices, we do highlyrecommend Biomedic products for a healthybudget.

Dr. Hister...Continued on Page 13

Dr. Hister...Continued From Page 4

largely has to do with increasing age – doesn’teverything? - and/or with an impaired immune sys-tem such as for example, in someone who has anHIV infection or is undergoing cancer therapy) thathidden lurking chicken pox virus springs back asshingles producing a pretty classical-looking rash,which is usually a one-sided “stripe” or a “band” (aband that corresponds to the nerve supply thevirus is affecting), and which is accompanied bypain of varying intensity.Although this shingles rash occurs most often as

a band on the torso, it can in fact appear anywhereincluding the face, where it can be a really trouble-some infection if it threatens the eyes.Once the rash of shingles appears, it’s usually

fairly easy to make the right diagnosis, but often,alas, the rash is preceded by intense pain for a fewdays without any other obvious signs, and that’swhen the diagnosis of shingles is much moredifficult to make because there’s nothing to see yet.If the diagnosis is made quickly, the current the-

ory is that anti-viral medications can result in theoutbreak dying down more quickly than it mightdo if left untreated (anywhere from 2-4 weeks) al-though unfortunately, early treatment with anti-viral drugs does not seem to lower the risk of PHN.So the key thing to stress in this article (and the

main message I’ve gathered from those many frus-trated emailers I mentioned earlier) is that you re-ally want to avoid getting shingles in the first place,and happily, there is a way for many of us to sub-stantially lower our risk of both shingles and (espe-cially perhaps) PHN, and that’s via a shinglesvaccine that’s been available in Canada for the lastfew years and which the experts currently recom-mend for anyone over the age of 60, and not leaveit to the usual standard age for being considered asenior, namely age 65.(Which brings me to this aside: that so many -

undoubtedly young - experts keep reducing theage at which they want us to consider ourselves“seniors” so much so, in fact, that if this downwarddefinition trend continues, pretty soon some ex-perts will argue that a senior is anyone just out of

PEOPLES PHARMACISTSHelping People Live Better Lives

We Can HelpWith TrustedCounselling.Taking the time to talk to your

pharmacist, so you fully

understand your medications, is

a very important factor in your

overall health treatment.

We help with personal and

trusted counselling.


Tom LeePharmacist & Owner, New Westminster

We Can Help You WithShingle Vaccinations.Select Peoples locations ad

minister

the vaccination that helps reduce

your risk of shingles.

See page 12 for the list of Peoples

locations that offer this health

service.

Anthony RagePharmacist & Owner, Penticton

We Help SupportThe ALS Society of BC.Peoples is proud to be the

Presenting Sponsor of the BC

& Yukon Walk for ALS. Join the

walks for fun, fitness and the

fight against ALS.

Go to peoplesdrugmart.com

for more information.

Colleen HoggPharmacist & Owner, Quadra Island


ABBOTSFORD1945 McCallum Rd.

ASHCROFT403 Railway Ave.

CHETWYND4733 - 51st Street

COQUITLAM• 1001 Austin Ave• 137-3030 Lincoln Ave.

COURTENAY1350 England Ave.

CRANBROOKEast Kootenay Hospital

KELOWNA200-3591 Elliot Rd.

MACKENZIE700 MacKenzie Blvd.

NAKUSP88 Broadway St.

NELSON405 Hendryx St.

PENTICTON166-1848 Main St.

PORT COQUITLAM2529 Shaughnessy St.

SALMO#107- 4th St.

SOOKE8-6716 Sooke Rd.

SPARWOOD107 Centennial Square

TRAIL1101 Dewdney Ave

VANCOUVER7160 Kerr St.

VICTORIA• 1282 Fairfield Rd.• 3643 Shelbourne St

Shingles VaccinationsThe shingles vaccine protects against herpes zoster, more commonly referredto as shingles. Shingles are caused by the varicella zoster virus, which alsocauses chickenpox. The vaccine is approved by Health Canada. The shinglesvaccine is the best way to protect you from getting shingles. The vaccine hasbeen shown to reduce the risk of getting shingles by 50%. For those who stillget shingles after being immunized, the vaccine can reduce pain, includingthe type of pain that lingers after shingles. Talk to your doctor or Peoples Pharmacist today to find out how to help pro-tect yourself against shingles and if the shingles vaccination is right for you.

Peoples Locations That Adminster The Shingles Vaccination

Check out peoplesdrugmart.com

Choose your local store forquick access for information

Health tips and pharmacyservices to help you live abetter life

Flyer and coupon savings

online prescription refills

Informative health articlesfrom the People First healthmagazine

Dr. Hister...Continued From Page 11

their teens, although when you think about it,that’s pretty much what all teenagers think is trueanyway).Anyway, the good news is that the shingles

vaccine is pretty effective.Thus, according to a recent review of over

700,000 patients that was recently published inPLOS Medicine and which looked at the way theshingles vaccine works in the real world (as op-posed to how it was said to work in studies thatwere used to test it, the kind of studies that oftensignificantly over-estimate the effectiveness of any-thing the researchers are looking at) concludedthat overall, the shingles vaccine is about 50 % ef-fective in reducing the risk of getting shingles andabout 60 % effective at reducing the risk of endingup with PHN, although it’s also important to notethat the researchers in this study did not haveenough data to evaluate the effectiveness of thevaccine in “really old” seniors, and previous stud-ies have indicated that the vaccine becomes lesseffective the older we are when we get immunized.Anyway, here’s the bottom line the way I see it:

even though the shingles vaccine is not completelyeffective, and even though that effectiveness maydrop off in older individuals, and even though itcosts around $200, aside from the cost, there re-ally doesn’t seem to me to be much of a down-side, so at the very least, if you’re an oldie butgoodie and you fit the bill for whom the vaccine isrecommended, you should, I think, seriously con-sider getting this vaccine because you really wantto do all you can to avoid becoming one of thosepeople who email asking me if there’s anythingthat I can recommend for this persistent pain younow have from a bout of PHN.

Dr. Art Hister can be heard on CKNW and other Corus Radio Net-work stations on House Calls on Saturdays at 10 AM, as well as seenon Global TV news on Saturday mornings at 9:20.

PEOPLES PHARMACISTSHelping People Live Better Lives

We Can Help WithMedication Reviews.Medication reviews are in-de

pth

consultations that improve health

outcomes by helping resolve any

issues that may have arisen due to

your medication. Ask about the

medication review service.


Mario Bruno BossioPharmacy Manager, Victoria

We Can HelpWith MedicationCompounding.Medication compounding allows

pharmacists to create custom

medications to suit your specific

health needs. Talk to a Peoples

Pharmacist about medication

compounding.

Chris FormosaPharmacist & Owner, White Rock

We Can Help ReduceEveryday StrainOn Your Busy Legs.Select Peoples Drug Mart and

Peoples Pharmacy locations offer

compression stocking and fitting

services, which help treat painful

venous leg disorders.

Check with your local Peoples

for this health service.

Ranbir HeirPharmacist & Owner, Sparwood

�ar�e�e Boot R.H.N

It is easy to eat healthy when you are in control of thekitchen, but dining out can often be a troublesome andtricky venture for a health conscious connoisseur. Restau-rants want to sell food that will keep you coming back andthis typically means comfort food; they are going to tantalizeyour taste buds with salt, sugar, refined carbohydrates andplenty of fat for good measure. But eating out does not haveto sabotage your health; you can learn to make healthierchoices and still revel in the fact that you don’t have to dothe dishes afterwards.

If your first standard for what constitutes a good restaurantare the humongous portion sizes, then we have a lot of workto do here. The only thing I recommend to super size in arestaurant is the water. Portion distortion has become aWestern dietary nightmare. Even if you take a pass on thecomplimentary breadbasket, your meal is likely going to bemuch larger than you actually need. Before you start eatingthe meal, ask for a take out box and put half of the food inthere; out of sight out of mind lessens temptation and youalready have your lunch made for tomorrow. If there is achoice between a large or small portion, order the small. Ioften find the appetizers are a perfectly adequate meal size.If you are afraid it won’t be enough, then order a small salad– dressing on the side please. That way you can control how much you need.

Scout out your local restaurants beforehand so you canfamiliarize yourself with their menu and know if the food isgoing to suit your dietary needs. You can often find menusonline and some of the major chains will have nutritional in-formation as well. I have been avoiding gluten and dairyproducts for a couple years so consequently Italian restau-rants are not my first choice anymore. Still, if I find myselfwith no other option, it is usually possible to find somethingthat works as long as my server is willing to work with me.Asking questions about the food on the menu is always agood idea. Don’t be afraid to ask them to prepare it to suityour needs. If you are on the road and not familiar with the

local eateries, stay away from fast food outlets and all youcan eat buffets; while they sometimes offer healthy choices,temptation to overeat may win over your resolve.

Restaurant menus do not list nutrition facts, which makesit all too easy to impulse eat. You might have had the bestof intentions to just have a salad for lunch but then decidethe linguini would not be such a bad choice. A lunchtimeserving of linguini Alfredo could add 600 - �00 empty calo-ries to your daily total; most of the calories come from car-bohydrates and fat. This is not a good bang for yournutritional buck. If you decide that you absolutely must havepasta, a small serving with tomato sauce is going to be thebetter choice.

Substitute healthier choices for low nutritional density,calorie-laden food; the next time you are out for breakfast,try passing on the hash browns and bacon; ask for fruit in-stead. A baked potato is going to be healthier than frenchfries but be mindful that the butter and sour cream will not.Order a side of steamed vegetables, brown rice or quinoa ifthey are available; if you are going to eat bread, opt for fibrerich whole grain varieties over white. Key healthy words tolook for on a menu are broiled, baked, boiled, grilled,steamed and poached; stay away from anything fried,breaded, battered, creamed or smothered. When it comesto starters, soup broths are a good bet as they give asated feeling without tons of calories.

So you have chosen the broth and pared your meal choicedown to a manageable and healthy size. We all know whathappens next right? Along comes your server with that allknowing grin asking if you would care to see the dessertmenu. If you can’t just shake your head and say, “checkplease,” then your next best strategy is to order the leastdamaging sweet on the menu and share it between your fel-low diners. Accompany that with a non-fat decaf latte orchai and you will not feel deprived. If you do feel deprived,then treat yourself and follow that with a long walk. Balanceis always the key. Good Health to You!

TIPS FOR HEALTHYDINING OUT


A moist salmon fillet topped with a crunchy berry salsa. A tastyway to get a healthy dose of essential fatty acids and antioxidants.

2 lbs (900 g) fresh salmon fillets, skin removed1 Tbsp (15 mL) prepared mustard2 Tbsp (30 mL) brown sugar1⁄4 tsp (1 mL) salt1⁄4 tsp (1 mL) pepper1⁄4 tsp (1 mL) diced fresh rosemary1⁄4 cup (60 mL) cranberry juice1⁄4 cup (60 mL) + 1 Tbsp (15 mL) softened butter, divided2 Tbsp (30 mL) raspberry vinegar1⁄2 cup (125 mL) boiling water1⁄2 cup (125 mL) dried cranberries1⁄2 cup (125 mL) chopped almonds1 tsp (5 mL) chopped fresh thyme2 Tbsp (30 mL) maple syrup1 tsp (5 mL) poppy seedsCut salmon fillet into 5 equal pieces according to weight. In a small bowl combine mustard, brown sugar, salt,pepper, rosemary and cranberry juice. Smooth mixture over salmon and allow to marinate for 30 minutes.In a heavy bottomed pot, bring water and vinegar to a boil. Stir in cranberries and remove from heat. Coverwith plastic wrap and allow to steep for 20 minutes.Preheat a grill or broiler. Remove salmon fillets from marinade, and set remaining marinade aside. Brush asmall section of hot grill with soft butter and gently place a fillet of salmon over top. Repeat with remainingfillets and adjust heat to medium-high. Cook for 2 minutes, then rotate salmon 90 degrees to acquire crosspattern grill marks. Cook for another 2 minutes, then flip salmon over and cook until it is firm with a moistcentre, about 3 to 5 minutes. Remove from heat and keep warm.Melt 1 Tbsp (15 mL) butter in a medium sized heavy bottomed sauce pan over medium-high heat. Add al-monds and allow to slightly brown. Add 2 Tbsp (30 mL) marinade. Lower heat and add rehydrated cran-berries, thyme, maple syrup and poppy seeds. Generously spoon mixture over each fillet and serve.Tip:Grilling salmon is a delicate process. Be sure to brush the grill and the fish with butter continually duringthe cooking process to prevent the salmon from sticking to the grill.1 serving: 490 Calories; 30 g Total Fat (13 g Mono, 3 g Poly, 11 g Sat); 95 mg Cholesterol; 27 g Carbohydrate; 2 g Fibre; 30 g Protein; 740 mg Sodium

Grilled Crandrizzle Salmon

peoplesdrugmart.com

Grilled Crandrizzle Salmon

Recipes For Good Health PEOPLES DRUG MART & PEOPLES PHARMACY LOCATIONS

The articles published in People First are for the general information of thereader. While effort is made to reflect accepted medical practice and knowl-edge, articles should not be relied upon for the treatment or managementof any specific medical concern or problem and People First accepts no li-ability for reliance on the articles. For proper diagnosis and medical care,you should always consult your family physician promptly. Opinions ex-pressed in sponsored articles by, Dr. Art Hister, Ian Lloyd, and DarleneBooth are paid editorials and are not necessarily shared by Peoples DrugMart stores or Peoples Drug Mart (B.C.) Ltd.Some advertised products are not available in all stores. We reserve the rightto substitute products or limit quantities. Prices effective while quantities last.Sale in retail quantities only.

*Points awarded on net pre-tax purchases. Certain re-strictions apply (check with your local Peoples DrugMart or Peoples Pharmacy for a complete list ofnon-eligible medications, services & products).

Some stores may use a manual system with a different reward level.

peoplesdrugmart.com

www.facebook.com/peoplesdrugmart

Healthy Family Recipes Cookbooksare available at participating

PEOPLES DRUG MART & PEOPLES PHARMACYReprinted from Healthy Family Recipes ©

Company's Coming Publishing Limited

1 serving: 490 Calories; 30 g Total Fat (13 g Mono, 3 g Poly, 11 g Sat); 95 mg Cholesterol; 27 g Carbohydrate; 2 g Fibre; 30 g Protein; 740 mg Sodium

Healthy Family Recipes Cookbooksare available at participating

PEOPLES DRUG MART & PEOPLES PHARMACYReprinted from Healthy Family RecipesCompany's Coming Publishing Limited

LOWER MAINLANDVANCOUVER• 7160 Kerr St.

434-2656• 571 West 57thAve.

324-2258• 683 Denman Street683-6933

BURNABY• 4218 Dawson St.

299-6677NEW WESTMINSTER• 825 McBride Ave.

525-2474PORT COQUITLAM• 2529 Shaughnessy

941-2413COQUITLAM• 137-3030 Lincoln Ave.

464-1033• 1001 Austin Ave.

936-0024ABBOTSFORD• 1945 McCallum Rd.

859-2351

LOWER MAINLANDSURREY• Ocean Park

1285116th Ave.536-7611

• 10212 - 152nd St.580-7457

WHITE ROCK• 1463 Johnston Rd

531-4636

VICTORIA• 3825 Cadboro Bay Rd.

477-2131• 15-1594 Fairfield

598-9232• 1282 Fairfield Rd.

595-5997• 2642 Quadra St.

383-1188• 3643 Shelbourne St.

477-1881• #102-2020 RichmondRd.

370-1166

VANCOUVER ISLAND• SOOKE

8-6716 Sooke Rd.642-2226

VANCOUVER ISLANDGOLD RIVER• 375 Nimpkish Drive

283-9042UCLUELET• 1892 Peninsula Rd.

726-2733COURTENAY• 102-1350 England

334-9311CAMPBELL RIVER• #101-2276S.IslandHwy.

923-7311• #984 Shoppers Row

287-8311QUADRA ISLAND• 5-654 Harper Road

285-2275

VANCOUVER ISLANDPORT McNEILL• 1584 Broughton St.

956-3126PORT HARDY• 100-8950 Granville St.

949-9522

CENTRAL NORTHMACKENZIE• 700 Mackenzie

997-5460

THOMPSON OKANAGANKELOWNA• 1715 Ellis St.

712-2484• #104–330 Hwy. 33

491-1999• 200-3591 Elliot Rd.

768-7645• 101-5315 Main St.

764-4222

THOMPSON OKANAGANPENTICTON• 166-1848 Main St.

493-7200LYTTON• 531 Main Street

455-6685ASHCROFT• 403 Railway Ave. E.

453-2553CHASE• 825 Shuswap Ave.

679-3553SCOTCH CREEK• 3874 Squilax-Anglemont

955-0601

KOOTENAYSREVELSTOKE• 555 Victoria Rd

837-5191GOLDEN• 1104 -10th Ave S.

344-6821

KOOTENAYSTRAIL• 1101 Dewdney Ave.

364-1993SALMO• 107 - 4th St.

357-9444NELSON• 405 Hendryx St.

352-3121SPARWOOD• 107 Centennial Sq.425-2015

NAKUSP• 88 Broadway St.

265-2228CRANBROOK• East Kootenay Hospital

13 -24th Ave. North420-4133

PEACE RIVERCHETWYND• 4733 - 51st Street

788-3393

SAVE

20%Off Sugg

ested

Retail Price

Buy a Star Of Hope for $2 anda Star with your name will bedisplayed to show your support.

Buy a Star for $10 and receive a

BeaStar!

and receive a

Help Support TheALS Societyof BC

June1- 30

PEOPLES DRUG MART

Buy a Star Of Hope for $2Buy a Star Of Hope for $2Buy a Star Of Hope for $2Buy a Star Of Hope for $2Buy a Star Of Hope for $2a Star with your name will bea Star with your name will bea Star with your name will bedisplayed to show your support.

Buy a Star Of Hope for $2 anda Star with your name will bedisplayed to show your support.

PEOPLES DRUG MART

StarsofHope

FREEKitchen Towel3Pack

Documents

Pdm314 health optimized