Upload
ciat
View
3.787
Download
0
Embed Size (px)
DESCRIPTION
Presentation by Francesca Re Manning for the CIAT KSW 2009
Citation preview
Managing Intellectual Property
Francesca Re Manning, CAS-IPKnowledge Sharing Week, CIAT, 22 May 2009
Challenges
Public good investments in agriculture face challenges• Increased emphasis on market mechanisms
forcing publicly funded organizations to respond to broader economic opportunities
• Heightened awareness of agricultural innovations as intellectual property, thus economic potential of inputs
Changing Context for Intellectual Property• Globalization
– International treaties and conventions– Integration of markets (both commodity and
specialized)–Consolidation in the Private sector leading to
increased leverage of Multinational corporations
Changes
Changes in research management and management of intellectual property• Complexity of research interactions and
partnerships
• Complexity of issues –regulatory, intellectual property, contract law
Managing IP
CIAT must manage its IP and contractual arrangement to ensure• Delivery on its mission
• Public access to its work (public domain)
• Freedom to share research results
What is CAS-IP?
Member of CG System Office; set up by the Centers in 2000
Mission of CAS-IP: enable access and use of CGIAR products for the benefit of the poor through effective management of Intellectual Assets (IP) and information transfer /sharing (Technology Transfer).
Who is Francesca Re Manning?
English qualified solicitor
First Degree in International Law & Human Rights
CIFOR Internship (2005)
CAS-IP full-time lawyer since July 2008• CIAT• CIP• CIMMYT• IFPRI
IP Management
CAS-IP assists CIAT in IP management
HOW?
CAS-IP support to CIAT
Support to Public-Public/Private Partnerships
Strategy
Access to Knowledge and Products
Germplasm & SMTA
Capacity Building
Policy implementation
Food crisis
Hunger
Need for food
research
availibility
Partnerships
commercialization
food scarcity
research
develop newproducts
+
+
-
B
input PPP
distribution PPP
protect your research forfurther use in the public
domain
Urgent Need for Nutritious Food – “Food Crisis”
While maintaining the focus on --Poverty Reduction/Increased Livelihoods
food price
ability tobuy food
per capitafood
adequacy
public sectorresearch
diversity of moreproductive agricultural
inputs
productivity ofagricultural inputs
need for moreproductive agricultural
inputs
total fooddemand
totalpopulation total food
production
farmers' desire toproduce food
adequacy ofagricultural inputs forsmall scale farmers
affordability ofagricultural inputs forsmall scale farmers
-+
-
+
+
+
++
food supplydemand gap
+-
+
+
+
++
privatesector
research
+
+
+
+B
R1
R2
R1 - research improvesfood security through
availability
R2 - research improvesfood security through
access
I P laws,commercialization
public privatepartnerships
Public/Private Partnerships
Contract drafting, review and negotiations• Brachiaria
• Exclusivity • Termination• Milestones• Payment
Public/Private Partnerships
• Waxy Cassava
• Ownership of resulting Intellectual Property o CIAT, the Company or jointly owned?
• Publicationo The Company requires that the results of
the Study shall not be made publicly available for a term of 5 years.= preventing CIAT from creating public goods
• Scope
Strategy
Transparency in publishing PPP contracts
Criteria for selecting contracts • Money?• Strategic fit?• Exceptions allowing exclusivity under GRPC IP
Policy– Exclusivity– Restriction of goods
Strategy
– When it is indispensable for the effective utilization or further improvement of Centres’ intellectual assets, the Centres may grant limited exclusivity for commercialization in a defined market segment, for a limited period of time, provided that the intellectual asset remains available without restriction, at no cost or minimum administrative costs, for research and development in developing countries and ARIs in support of the CGIAR mission.
Centres will only enter into agreements concerning contractual rights that restrict the use of the resulting products in ways that are inconsistent with the policy, when the intellectual asset the Centre is producing will result in significant improvements to food security and or poverty alleviation in the countries where it can be used
Germplasm
Proprietary questions• How do we determine whether we have FTO?• Who owns the germplasm?• What are the rights of the owner?• How do we respect those right• Can we use it for breeding and research?• Can we sell it to others? Can we claim it as ours?
International Treaty on Plant Genetic Resources for Food and Agriculture (ITPGRA)
• Germplasm in public domain, governed by Multilateral System (ML)
• under the management of ITPGRA (Annex 1)• food and feed uses
Convention on Biological Diversity (CBD)• All other uses
International Obligations
Greys Areas
Public-private contracts and SMTA• Commercialization when material can no longer be
used for breeding, a mandatory payment to the ITPGRFA fund
Additional terms and conditions over material under development?
If want to give some material to a small farmer?
Payment and benefit- sharing regime
CAS-IP assists CIAT with these questions
Increase Access to Knowledge and Products
Defensive Publications
The “Enola” Patent• CIAT filed for a re-examination in 2001• We are awaiting a decision by the U.S.
Circuit Court for Federal Appeals• Expensive and time consuming
CIAT has signed an agreement with the EPO to put publication in the NPL
Increase Access to Knowledge
Is the work protected by copyright?• Gives the owner of the right to control how a creative
work is used– In most countries rights last for life of author + 70 years
Who owns copyright at CIAT?
Does CIAT seek and obtain authorisation to use others’ copyright, eg photos, flowcharts?
How does CIAT deal with “adaptation” of its works, ie translations? keeping the quality
Who is the owner?
What are the Options for Sharing?
Disclaim copyrights –e.g. U.S. Federal copyright Law has a provisional that exempts all publications by Government employees and agencies from copyright
License openly with standardized licenses–e.g. “Creative Commons” licenses, “Open Access” arrangements with publishers, and Open Source licenses
What are the Options for Sharing?
Negotiate “Open Licenses” with publishers
“Fair Use” or “Fair Dealing” Sharing options (exceptions) incorporated into Copyright Laws• Cover exceptions for:
– Personal use
– Educational Use
Creative Commons
Creative Commons (CC) – skipping the intermediaries but have upfront uses
From All Rights Reserved to Some Rights Reserved
The owner chooses a combination of conditions to licence his/her work from 6 CC types
Creative Commons
Creative Commons
Attribution Non-Commercial No Derivatives• This license is the most restrictive of the six main licenses,
allowing redistribution. This license is often called the “free advertising” license because it allows others to download your works and share them with others as long as they mention you and link back to you, but they can’t change them in any way or use them commercially.
Open Source Licensing for Software Code
Different sharing philosophy from CC License
Tend to have “reach through”/”viral” aspects that mandate successive developments of source code to be available for additional improvement
Open Source Initiative certifies Software Licenses as “Open Source” when the licence meets its standards.
CC and OS Licensing Problems
Compatibility
Applicability in specific jurisdictions
Interpretation of License in view of the Law
Enforcement
• (Also applies to IPRs, generally)
Separation of economic rights and moral rights
Moral Rights
In every Open Access tool Recognition is key
Why? • Moral incentive• Responsibility
Right to claim authorship – discernable?FAO copyrights ownership
• Moral rights of authors
Capacity Building National Partners Initiative (NPI): an International Society of IP Practitioners
Participating Centres
IRRIICRISATCIPCIMMYTIFPRIWARDABioversityCIFORILRIICRAFAVRDCCIAT
In Conclusion
Manage your IP • Know what you sign and commit to• Read the agreements and understand them so that you can
negotiate and review the clauses• Ensure material under ITPGRFA transferred via SMTA• Know what knowledge right to keep and control, or right to
“give away” and share• Police any licensed IPRs• Integrate IP policy with CIAT’s mission to benefit expected
end-users• Instruct researchers as “expert witnesses” in cases of
infringement or other inquiries.
Thank you!