Upload
alexis-chavez
View
149
Download
9
Embed Size (px)
Citation preview
AppGrpID AppGrpDesc AppImageAAG Adult and Geriatric purpleBEM Behavioral Medicine redCHA Child and Adolescent greenCMP Complementary Products greenFRC Forensic and Corrections orangeHRC Human Resource<br> and Career Development blue
AppGrpID ProdLineID SubAppIDAAB MCI APPAAG MCM APPAAG MMP APPAAG RRA ACOAAG BSI APPAAG CTM CNUAAG TON AEDAAG SCL APPAAG CTM CNUAAG CNS CNUAAG LAM CNUAAG TOM CNUAAG HEJ CNUAAG MTO CNUAAG NAB CNUAAG CLO CNUAAG WCS CNUAAG MMS CNUAAG CDS CDEAAG HDI CDEAAG DSC ADSAAG IBC AINAAG DSC AINAAG RTP ACTAAG AUI AMFAAG PGT AADAAG PMT AADAAG EQY AEIAAG EOO ACOAAG MIH ACOAAG EOB ACOAAG CAM ACOAAG UPT ACOAAG HAD ACOAAG SNG ACOAAG PER ACOAAG DDS ACOAAG SST ACOAAG PSB ACOAAG SMT ACOAAG EQE ACOAAG PRI ACOAAG CRI ACOAAG ESR ACOAAG BCG AINAAG PAD AINAAG POM AOUAAG RTP ACTAAG TOM ANEAAG MTO ANE
AAG CLO ANEAAG WCS ANEAAG MMS ANEAAG REH AHEAAG CDS ADEAAG DTS APPAAG HPS APPAAG ISS APPAAG SPS APPAAG CAS APPAAG PSP APPAAG DSS ADSAAG SCV ADSAAG ICG AINAAG SAF AOUAAG SET ACTAAG IEQ ACTAAG PSI ACTAAG QLQ ACTAAG HEL ACTAAG PAN ASCAAG RSH APRAAG TAT APRAAG NAB ACOAAG CBB ACOAAG IER AINAAG CRW AINAAG CRA AADAAG CAA AADAAG RMR AADAAG CIS APPAAG EQI AEIAAG STA ANXAAG PDZ APPAAG SPA ANXAAG EMA ANXAAG DTL ANXAAG TON AEDAAG ABS AEDAAG TOL CNUAAG CAT CNUAAG SPQ ADEAAG SCV ADSAAG CCV ADSAAG CCV ADEAAG DTR ADEAAG DTR ADSAAG CSI ADSAAG QSH AINAAG TPV ACTAAG TIP ACT
AAG FAM AMFAAG DAS AMFAAG PSI AMFAAG SIP ASAAAG SIP ASAAAG CDE ASAAAG AUI ASAAAG TAT APRAAG RSH APRAAG PSP AEIAAG IMP ACOAAG WHA ACOAAG EON ACOAAG DRE ACOAAG DOP ACOAAG CLT ACOAAG EDM ACOAAG EDM ACOAAG CLT ACOAAG PDR ACOAAG TAB ACOAAG IRH ACOAAG AIM ACOAAG BGM ACOAAG EMM ACOAAG PST ACOAAG INT ACOAAG MUM ACOAAG ING ACOAAG MIL ACOAAG COG ACOAAG COG ACOAAG EWA ACOAAG CDE ASAAAG SIP ASAAAG SSS ASAAAG TDM ASCAAG WVS APRAAG AAB ACOAAG DDS ACOAAG IRH ACOAAG INM ACOAAG IMM ACOAAG DEV ACOAAG MUM ACOAAG CCC AADAAG COW AADAAG CMR AADAAG CP2 AADAAG HEA AADAAG KPT AAD
AAG JAD AADAAG CRO AADAAG COA AADAAG TGT AADAAG SPA APPAAG ADO ACOBEM ADO BREBEM BBH BHEBEM REH BREBEM QLQ BQLBEM CRA BPPBEM CRS BPPBEM GAF BPPBEM POM BHEBEM HDI BHEBEM CHP BHEBEM BHH BHEBEM BH2 BHEBEM MBM BHEBEM HSQ BHEBEM MH2 BHEBEM IEQ BHEBEM PPP BHEBEM REH BREBEM RSO RQLBEM RSO BQLBEM SAS BQLBEM QQQ BQLBEM QOL BQLBEM CDS BDEBEM CDI BDEBEM CRA BPPBEM CCC BDEBEM GAF BPPBEM MSC BPPBEM DTS BPPCHA CRS ADDCHA APQ CPPCHA TML CNUCHA BRE CNUCHA GAD CDDCHA HEL CCTCHA FIT CPTCHA HSG CBOCHA UCB CBOCHA ANX CBOCHA OCD CBOCHA SCP CBOCHA ATC CBOCHA OBM CBOCHA STM CBO
CHA LDC CBOCHA PGA CBOCHA EDE CBOCHA HRC CBOCHA SOE CBOCHA AAS CBOCHA TFB CBOCHA WIS CIACHA CTO CIACHA SIT CIACHA WRA CIACHA WRV CIACHA WRT CIACHA ADO CBOCHA SPC CAXCHA STC CPPCHA GAD CDDCHA ADB CBOCHA EQY CEICHA DTL CERCHA GOR CERCHA TLD CERCHA TVP CERCHA PPT CIACHA LDD CIACHA ICP CIACHA CPT ADDCHA CP2 ADDCHA CPW ADDCHA ISO CPPCHA MAC CPPCHA MAP CPPCHA MMA CPPCHA MSC CAXCHA TOL CNUCHA TVP CEDCHA WRA CIACHA FTT CPTCHA CAD ADDCHA KPT ADDCHA COA ADDCHA COA ADDCHA COA ADDCHA TGT ADDCHA PGT ADDCHA WRT CPTCHA PMT ADDCHA CTO CIACHA DIC CPPCHA DDB CDDCHA DTL CED
CHA EDB CERCHA SCB CERCHA SET CCTCHA SIT CIACHA SPC CANCHA STC CPPCHA HSG CIACHA CLS CPPCHA CDECHA ABS CERCHA HDG CIACHA AMP CCTCHA ANB CANCHA APS CPPCHA ASD CDDCHA FAB CPPCHA GIL CDDCHA CDO CIACHA ICP CEDCHA JAD ADDCHA JIR CPPCHA LDD CEDCHA MMI CPPCHA MSC CANCHA POS CPPCHA ISS CPPCHA SPS CPPCHA CAS CPPCHA CADCHA ADO CNUCMP CSW CPSCMP MTQ CPSCMP UNK CPSCMP STO CPSFRC ADO BREFRC TRO FCPFRC FDO FSAFRC BCP FCPFRC LSI FRNFRC PCP FRNFRC PCL FRNFRC TCS FRNFRC ICS FRNFRC PCL FPSFRC PSC FPSFRC JIR FPPFRC VIP FPPFRC AUI FSAFRC SSS FSAFRC WCN FCPFRC PSO FCP
FRC PSM FCPFRC MLL FCPFRC EOF FCPFRC HFP FCPFRC PCC FCPFRC POC FCPFRC FMH FCPFRC PFN FCPFRC CCH FCPFRC CST FCPFRC PEC FCPFRC CCM FCPFRC AFV FCPFRC LSI FRNFRC CIE FCPFRC PCL FPSFRC NIM FPPFRC CSO FPPFRC SAR FPPFRC PDS FPPFRC CLM FCTFRC CPP FCPFRC EEW FCPFRC VCM FCPFRC VAT FCPFRC VRT FCPFRC DAP FCPFRC AMN FCPFRC ANG FCPFRC RAS FCPFRC ASV FCPFRC LBS FCPFRC CRT FCPFRC ASS FCPFRC AAP FCPFRC PS5 FCPFRC AYO FCPFRC CRV FCPFRC FEJ FCPFRC PRO FCPFRC JSO FCPFRC DDS FCPFRC AAS FCPFRC CBT FCPFRC DVI FCPFRC YCA FCPFRC FAS FCPFRC PCO FCPFRC AUI FRSFRC IIB FCPFRC FDO BRE
FRC HOF FCPFRC FDO FRNFRC EWC FCPFRC DVI FCPFRN PCY FPPHRC MST HEIHRC PFC HPEHRC EQI HEIHRC EQI HEIHRC MST HEIHRC EQV HEIHRC PFC EPEHRC PFC EPEHRC IDE EPEHRC NEO EPEHRC CCB HCDHRC CWP HCDHRC GAB EPPHRC EPS EPPHRC SSQ EPPHRC CAB EIAHRC GAM EIAHRC GAM EIAHRC GAB EIAHRC EQE ECPHRC PRL ECPHRC WEI ECPHRC EIT ECPHRC EIE ECPHRC WIF ECPHRC EIT ECPHRC LOP ECPHRC CAI HCDHRC OPI HEIHRC CIS EPEHRC GAM EIATRE TRE ABSTRE TEE CBB
SubAppID SubAppDescAAD ADHDCAD ADHDAAX AnxietyCAX AnxietyCAE Aptitiude, Education and RemediationCPA Assessment AidsABO BooksBBO BooksCBO BooksFBO BooksHBO BooksHCD Career DevelopmentACT Counseling and TherapyCCT Counseling and TherapyFCT Counseling and TherapyADE DepressionBDE DepressionCDE DepressionCDD Developmental DisordersADA DSM-IV AssessmentsAER Education and RemediationCER Education and RemediationAEI Emotional IntelligenceCEI Emotional IntelligenceHEI Emotional IntelligenceAHE HealthBHE HealthAIE Intake EvaluationHIA Intelligence and AptitudeAMF Marriage and FamilyANE NeuropsychologyCNE NeuropsychologyAOM Outcomes MeasuresHPE PersonalityAPP Personality and PsychopathologyCPP Personality and PsychopathologyFPP Personality and PsychopathologyBPP Personality and PychopathologyAPT Projective TechniquesCPT Projective TechniquesFPS PsychopathyBQL Quality of LIfeBRE RehabilitationFRN Risk/NeedsASC SchizophreniaCSP Software PlatformsASA Substance AbuseFSA Substance Abuse
CatID DescriptionABS Adaptive Behavior Scales (ABS)ADB ADHD Guides, Books, and TapesAMP Acheivement Motivation Profile (AMP)ANB Anxiety Books and GuidesAPS Antisocial Process Screening Device (APSD)ASD Asperger Syndrom Diagnostic Scale (ASDS)BRF Behavior Rating Inventory of Executive Function (BRIEF)CAT Category Test (CAT) Computer PorgramCDI Children's Depression Inventory (CDI)CLS Coddington Life Events Scales (CLES)COA Coaching the ADHD StudentCPT Conners' Continuous Performance Test (CPT)CRS Conners' Rating ScalesCRW Clinical Report Writer SoftwareCTO Comprehesive Test of Nonverbal Intelligence (CTONI)DDB Developmental Disorders Books and GuidesDIC Diagnositc Interview for Children and Adolescents - IV (DICA-IV)DTL Detroit Tests of Learning (DTLA)EDB Education Books and GuidesEIB Emotional Intelligence Books, Guides and TapesEQI Emotional Quotient Inventory EQ-i)FFT Fairy Tale Test (FTT)GIL Gilliam ScalesGOR Gray Oral Reading Tests (GORT-4)ICP I Can Problem Solve (ICPS)JAD Journal of Attention Disorders (JAD)JIR Jesness ProductsLDD Learning Disabilities Diagnostic Inventory (LDDI)MMI MMPI-A Interpretive SystemsMSC Multidimensional Anxiety Scale for Children (MASC)PPB Personality and Psychopathology Books and GuidesPPC Psychological Processing Checklist (PPC)SCB Social Competence and Behavior Evaluation Preschool Edition (SCBE)SET Social Effectiveness Therapy (SET)SIT Slossen Intelligence Test - Revised (SIT-R3)SPC Social Phobia and Anxiety Inventory (SPAI)STA State-Trait Anxiety Inventory (STAI)TLD Test of Language Development (TOLD)TML Test of Memory and Learning (TOMAL)TOL Tower of London-DX (TOL)TVP Tests of Visual Perceptual Skills (TVPS)WRA Wide Range Achievement Tests (WRAT)HDI Health Dynamics Inventory (HDI)CHP Coping with Health Injuries and Problems (CHIP)IEQ Ilness Effect Questionnaire (IEQ-MP)RSO Rehabilition Survey of Problems and Coping (R-SOPAC)LSI Level of Service Inventory - Revised (LSI-R)FBO Corrections Books and Complementary ProductsPCL Hare Psychopathy Checklist (PCL)NIM NIMS Observational ChecklistCSO Clarke Sex History Questionnaire (SHQ-R)SAR Spousal Assault Risk Assessment (SARA)PDS Paulhus Deception Scales (PDS)
CLM Controlling Anger and Learning to Manage It (CALM)MST Mayer-Salovey-Caruso Emotional Intelligence Test (MSCEIT)PFC 16 PF Fifth EditionHRB Human Resource Books and Complementary ProductsCRA Conners' Adult ADHD Rating Scales (CAARS)CAA Conners' Adult ADHD Diagnostic Interview for DSM-IV™ (CAADID)EMA Endler Multidimensional Anxiety Scales (EMAS)TON Test of Nonverbal Intelligence (TONI-3) Third EditionCNS Comprehesnvie Norms for an Expanded Halstead-Reitan BatteryLAM Learning and Memory Battery (LAMB)TOM TOMMMTO Memory Test for Older Adults (MTOA)CLO Clock TestWCS Wisconsin Card Sorting Test (WCST)MMS Mini-Mental State Examination (MMSE™)REH Rehabilition Checklist (RCL)CDS Carroll Depression Scales (CDS)DTS Davidson Trauma Scales (DTS)HPS Holden Psychological Screening Inventory (HPSI)ISS Internalized Shame Scale (ISS)SPS Social Problem-Solving Inventory-Revised (SPSI-R)PSP Personality Self Portrait (PSP)DSS DSM-IV™ SoftwareSCV Structured Clinical Interview for DSM-IV ProductsDSC A Clinician's Guide to Diagnosing Dissociative Symptoms and DisordersSAF Symptom Assessment-45 (SA-45)SAS Social Adjustment Scale–Self-Report (SAS-SR)CIS Coping Inventory for Stressful Situations (CISS)PSI Parenting Stress ToolsQLQ Quality of Life Questionnaire (QLQ)HEL Help SeriesFAM Family Assessment Measure (FAM-III)DAS Dyadic Assessment Scale (DAS)PAN Positive and Negative Syndrome Scale (PANSS)TDM TD (Tardive Dyskinesia) MonitorRSH Rorshach Test ProductsTAT Thematic Apperception Test (TAT)AAB Adult Assessment Books and Other Complementary ProductsNAB Neuropsychological Assessment BooksCBB Clinical Reference BooksCSW Software PlatformsCOW CRS-R for WindowsMFE Maintenance fee for License AgreementIET Computerized Aptitude
POM POMCOR Specialty Projects
TRE Theresa
CAA Social Effect. Therapy-Child
AAP ADI-RCAR Customer Service AptitudeAAP Social Communication QuestionnaireBHI Battery for Health Improvement BHI Battery for Health Improvement CAR The Stress ProfileCAR Sales Achievement PredictorQQQ Quality of Life GAB General Ability Measure for Adults TGT A Teacher's Guide to Recognizing Psychological and Behavioral Problems of StudentsFAB Feelings Attitudes and Behaviors Scale for Children (FAB-C)CGI Conners' Global Index (CGI)CPW Conners' Continuous Performance Test II (CPT II) for WindowsCAD Conners' ADHD/DSM-IV Scales (CADS)KPT Conners' Kiddie Continuous Performance Test (K-CPT) for WindowsCDO Social Competence and Behavior Evaluation Preschool Edition (SCBE)PGT A Parent's Guide to Teenage ProblemsPMT Parent Management Training for Attention-Deficit/Hyperactivity DisorderSPC Social Phobia and Anxiety Inventory for Children (SPAI-C)STC State-Trait Anxiety Inventory for Children (STAIC)FDO Forensic Distributed OtherADO 16PF Adolescent Personality Questionnaire (16PF APQ)BRE Behavior Rating Inventory of Executive Function (BRIEF)EQY BarOn Emotional Quotient Inventory: Youth Version (BarOn EQ-i:YV)GAD Gilliam Asperger Disorder Scale (GADS)PPT Psychological Processing Checklist (PPC)WIS WISC-III Report 3.0WRV Wide Range Assessment of Visual Motor Ability (WRAVMA)WRT WRAT-ExpandedSCL Symptom Checklist-90-Revised (SCL-90-R)CAA Child Autism Rating ScaleFAA Malingering Probability ScalesIET Canada and UK - BASIIET Reynolds Intellectual Assessment ScalesAUI Alcohol Use Inventory (AUI)BHI Battery for Health Improvement (BHI)BSI Brief Symptom Inventory (BSI)CAI Career Assessment Inventory (CAI)HSQ Health Status Questionnaire (HSQ)ISO Inventory of Suicide Orientation - 30 (ISO-30)MAC Millon Adolescent Clinical Inventory (MACI)MAP Millon Adolescent Persoanlity Inventory (MAPI)MBH Millon Behavioral Health Inventory (MBHI)MCM Millon Clinical Multiaxial Invnetory - III (MCMI-III)MMA Millon Multiphasic Personality Inventory for Adolescents (MMPI-A)MMP Millon Multiphasic Personality Inventory (MMPI-2)MTQ Microtest Q
HSG Homework Survival Guide: Parent HandoutPDZ Posttraumatic Stress Diagnostic Scale (PDS)CAS Clinical Assessment Scales for the ElderlyCTM Comprehensive Trail-Making Test (CTMT)
MTO Memory Test for Older Adults (MTOA)SPQ SCID Screen Patient Questionnaire (SSPQ) for WindowsCCV Computer-Assisted SCID-Clinician Version (CAS-CV) from WindowsDTR DTREE: The DSM-IV Expert for WindowsCSI Computer-Assisted SCID II Expert System (CAS II ES)ICG An insider's Complete Guide to DSM-IVBCG The Busy Clinician's Guide to DSM-IVPAD Practical Applications of DSM-IV in a Managed Care EnvironmentIER Intake Evaluation Report (IER)QSH QUICKVIEW Social HistoryTPV Turning Points: A Psychoeducational Program for Overcoming an Eating DisorderRTP Relaxation Training ProgramTIP Tropical Island Paradise Relaxation TapeSIP Stress Index for Parents of Adolescents (SIPA)CDE Chemical Dependency Assessment ProfileIMP Impulsivity Theory, Assessment, and TreatmentWHA What Does Everybody Else Know That I Don't?EON Essentials of Neuropsychological AssessmentDRE DSM-IV-TR Handbook of Differential DiagnosisDOP Disorder of Personality" DSM-IV and Beyond, 2nd Ed.CLT Clinician's Electronic Thesaurus Version 5EDO Electronic DSM-IV-TR PlusEDM Electronic DSM-IV-TR PlusEDM Electronic DSM-IV-TR PlusPDR Psychologist' Desk ReferenceTAB The T.A.T., the C.A.T. and the S.A.T. in Clinical UseIRH Interpretive Reasoning and the Halstead-Reitan TestsIRH Interpretive Reasoning and the Halstead-Reitan TestsAIM The MMPI-2: An Interpretive Manual, 2 Ed.AIM The MMPI-2: An Interpretive Manual, 2 Ed.AIM Essentials of MMPI-2 and MMPI-A Interpretation, 2nd Ed.AIM Essentials of MMPI-2 and MMPI-A Interpretation, 2nd Ed.BGM A Beginner's Guide to the MMPI-2EMM Essentials of MMPI-2 AssessmentPST MMPI-2 in Psychological TreatmentINT Internation Adaptations of the MMPI-2MUM Manual for Using the MMPI-2 as a Therapeutic InterventionING Interpretive Guide to the Millon Clinical Multiaxial Inventory Second EditionMIL The Million Clinical Inventories: Clinical and Personality AssessmentCOG Cognitive Therapy for Personality Deisorders: A Schema-Focused ApproachEWA Essentials of WAIS-III AssessmentPSB New Personality Self-Portrait-RevisedCPP Coping with Psychiatic and Psychological TestimonyEEW The Expert Expert Witness: More Maxims and Guidelines for Testifying in CourtAFV Assessment of Family Violence: A Clinical and Legal SourcebookCIE Conducting Insanity EvaluationsBCP Behaviour, Crime and Legal ProcessesIIB Investigative InterviewingHOF Handbook of Offender Assessment and TreatmentTRO Treatment of Offenders with Mental DisordersVCM Violence, Crime and Mentally Disordered OffendersVAT Violent AttachmentsVRT Violence Risk And Threat AssessmentDAP Dealing with Anger Problems: Rational-Emotive Therapeutic Interventions
AMN Anger ManagementANG Anger Disorders: Definition, Diagnosis, and TreatmentANG Anger Disorders: Definition, Diagnosis, and TreatmentRAS The Rorschach Assessment of Aggressive and Psychopathic PersonalitiesASV Antisocial and Violent YouthLBS Lost Boys: Why Our Sons Turn Violent and How We Can Save ThemCRT MMPI, MMPI-2, & MMPI-A in Court: A Practical Guide for Expert Witnesses and Attorneys, 2nd Ed.ASS MMPI-2: Assessing Personality and PsychopathologyAAP MMPI-A Assessing Adolescent PsychopathologyPS5 The Psychology of Stalking: Clinical and Forensic PerspectivesPS5 The Psychology of Stalking: Clinical and Forensic PerspectivesAYO Assessing the Youthful Offender: Issues and TechniquesCRV Criminal Responsibility Evaluations: A Manual For PracticeFEJ Forensic Evaluations of JuvenilesPRO Protocols for the Sex-Abuse EvaluationJSO Juvenile Sexual Offending: Causes, Consequences, and CorrectionsDDS Dual Diagnosis: Counselling the Mentally Ill Substance AbuserAAS Adolescents, Alcohol, and Substance Abuse: Reaching Teens Through Brief InterventionCBT Cognitive Behavioural Treatment of Sexual OffendersDVI Handbook of Domestic Violence Intervention Strategies: Policies, Programs, and Legal RemediesYCA You Can Control Your Anger! 21 Ways To Do ItFAS Forensic Assessment with the Millon InventoriesPCO A Primer on Community Corrections and Criminal Justice Work in CanadaEQV Williams LifeSkills System for Managing Stress & AngerIDE Interest Determinination, Exploration and Assessment System (IDEAS)NEO NEO Personality Inventory-Revised (NEO PI-R)CCB Campbell Interest and Skills Survey (CISS)CWP Canadian Work Preference Inventory (CWPI)EPS Executive Profile Survey (EPS)SSQ Seligman Attributional Style Questionnaire (SASQ)CAB Comprehensive Ability Battery (CAB)EQE The EQ Edge: Emotional Intelligence and Your SuccessPRL Primal LeadershipWEI Working with Emotional IntelligenceEIT Emotional IntelligenceIET Telephone Interview for Cognitive StatusWIF The Wisdom in Feeling: Psychological Processes in Emotional IntelligenceEIT The Handbook of Emotional IntelligenceLOP Learned Optimism: How to Change your Mind and your LifeUNK MHS Professional Tool Suite with MHS SmartLinkSTO Digital StopwatchPTT A Teacher's Guide to Recognizing Psychological and Behavioral Problems of StudentsAPQ 16PF Adolescent Personality Questionnaire (16PF APQ)FIT Fairy Tale Test (FTT)UCB Understanding and Managing Children's Classroom BehaviorANX Anxiety Disorders in Children and AdolescentsOCD OCD in Children and AdolescentsSCP Shy Children, Phobic Adults
CAA Children’s Organizational Skills ScaleRMR Restless Minds, Restless Kids: ADHD in Children & AdolescentsATC Assessment and Treatment of Children Problem: A Clinician's Guide, 2nd EditionOBM Outrageous Behavior Mod: Handbook of Strategic Interventions for Managing Impossible Students
PTG A Parent's Guide to Teenage ProblemsSTM School Violence Threat ManagementLDC Learning Disabilities and Challenging BehaviorsPGA A Parent's Guide to Asperger Syndrome & High-Functioning AutismEDE Emotional Development and Emotional Intelligence: Educational ImplicationsHRC How to Raise a Child with a Hight EQ: A Parent's Guide to Emotional IntelligenceSOE SOS! Help for EmotionsTFB Thinking, Feeling, Behaving: An Emotional Education Curriculum for Children Grades 1-6 and 7-12SPA Startle, Physiological Arousal, Anxiety, and Numbness (SPAN)POS Posttraumatic Stress Diagnostic ScaleCTM Comprehensive Trail-Making Test (CTMT)HEJ Head Injury & ConcussionIBC An Insider's Complete Guide to DSM-IVFDO Forensic Distributed Other CRS Conners RRA Rethinking Risk AssessmentEOO Essential of Outcome AssessmentMIH Motivational Interviewing: Preparing People for ChangeEOB Essentials of Behavioral AssessmentCAM Clinical Assessment of Malingering and DeceptionUPT The Use of Psychological Testing for Treatment Planning and Outcome AssessmentHAD Handbook for the Assessment of Dissociation: A Clinical GuideSNG Shame and GuiltSNG Shame and GuiltPER Perfectionism: Theory, Research, and TreatmentAAP Millon Index of Personality StylesAAP Anger Disorder ScaleSST Social Skills Training for Schizophrenia: A Step-By-Step GuideSMT Stress Management Training: A Group Leader's GuideEQE The EQ Edge: Emotional Intelligence and Your SuccessPRI Principles of Rorschach InterpretationCRI Contemporary Rorschach InterpretationESR Essentials of Rorschach AssessmentMBM Millon Behavioral Medicine Diagnostic (MBMD)MH2 Millon Behavioral Health Inventory (MBHI)PPP Pain Patient Profile (P-3)QOL Quality of Life Inventory (QOLI)CCC Conners' Rating Scales-Revised (CRS-R)GAF GAF Report For Windows: The Global Assessment of Functioning ScalePCP Preparing for Court Testimony Based on the MMPI-2PCP Preparing for Court Testimony Based on the MMPI-2PC2 Hare Psychopathy Checklist-Revised (PCL-R)L: 2nd EditionTCS Testifying and Child Sexual Abuse: A Courtroom GuideICS Interviewing for Child Sexual Abuse: A Forensic GuidePSC Hare P-SCAN Research Version 2 (P-SCAN RV2)VIP Validity Indicator Profile (VIP)SSS Substance Abuse Subtle Screening Inventory (SASSI)WCN Without Conscience: The Disturbing World of the Psychopaths Amoung UsPSO Psychopathy: Antisocial, Criminal, and Violent BehaviorPSM The Psychopathic Mind: Origins, Dynamics, and TreatmentMLL Malingering and Deception in Adolescents: Assessing Credibility in Clinical and Forensic SettingsEOF Essentials of Forensic Psychological AssessmentHFP The Handbook of Forensic Psychology, 2nd Ed.PCC The Psychology of Criminal Conduct, 3rd Ed.
POC The Psychopathology of Crime: Criminal Behavior as a Clinical DisorderFMH Forensic Mental Health Assessment: A CasebookPFN The Practice of Forensic Neuropsychology: Meeting Challenges in the CourtroomCCH The Custody Evaluation Handbook: Research-Based Solutions and ApplicationsCST Competency to Stand Trial Evaluations: A Manual for PracticePEC Psychological Evaluations for the CourtsCCM Crime Classification ManualCMR Conners-March Development Questionnaire (CMDQ)CP2 Conners' Continuous Performance Test II (CPT II) fro WindowsHEA Highly Effective Approaches to Making the Conners' CPT Work in Your Clinical PracticeCRO Conners' Rating Scales (1989 Version)POM Profile of Mood States Bipolar VersionPCY Hare Psychopathy Checklist-Revised: Youth Version (PCL:YV)CRS Conners WVS Walker VisualsDDS Dual Diagnosis: Counselling the Mentally Ill Substance AbuserIRH Interpretive Reasoning and th Halstead-Reitan TestsIMM The MMPI=2: An Interpretive Manual, 2nd Ed.ESS Essentials of MMPI-2 and MMPI-A Interpretation, 2nd Ed.DEV Development and Use of the MMPI-2 Content ScalesBBH Battery For Health IMpriovement 2GAM General Ability Measure for Adults (GAMA)EQI Emotional Regulation ScalesOTH APIOTH AAAOTH ABXOTH ACQOTH ACSOTH ACQOTH ASPOTH AYMOTH BOEOTH CALOTH CAQOTH CAWOTH CAXOTH CCAOTH CCLOTH CCOOTH CCSOTH CCTOTH CFAOTH CFIOTH CLAOTH CMAOTH COKOTH CPAOTH CPQOTH CRROTH CSROTH DHROTH DOMOTH DPBOTH DPC
OTH DPROTH DSOOTH EDIOTH EFPOTH EIEOTH EMPOTH ESPOTH ETTOTH EWCOTH FAAOTH FCIOTH FCMOTH FCNOTH FMDOTH GFPOTH GOLOTH GZTOTH GZTOTH HAMOTH HAPOTH HATOTH HEDOTH HEROTH HSPOTH IASOTH ICDOTH IDOOTH IDSOTH IETOTH IOSOTH IYDOTH LEAOTH MATOTH MCIOTH MHOOTH MISOTH MPSOTH NASOTH NCOOTH NONOTH NSQOTH OPIOTH PBTOTH PCWOTH PMFOTH RNTOTH SCDOTH SCSOTH SHROTH SKPOTH SLPOTH SMROTH SPNOTH TCD
OTH TECOTH TJTOTH TRNOTH WKSFDO Forensic Distributed Other
IDABSADBAMPANBAPSASDBRFCATCDICLSCOACPTCRSCRWCTODDBDICDTLEDBEIBEQIFTTGILGORICPJADJIRLDDMMIMSCPPBPPCSCBSETSITSPCSTATLDTMLTOLTVPWRAHDICHPIEQRSOLSIFBOPCLNIMCSOSARPDS
CLMMSTPFCHRBCRACAAEMATONCNSLAMTOMMTOCLOWCSMMSREHCDSDTSHPSISSSPSPSPDSSSCVDSCSAFSASCISPSIQLQHELFAMDASPANTDMRSHTATAABNABCBBCSWCOWMFECAP
AAPSPP
TRE
SEC
ADICSVSCQBHIBHISTPSAAQQQGABTGTFABCGICPWCADKPTCDOPGTPMTSPCSTCFDOADOBREEQYGADPPTWISWRVWRTSCLCAUMGSBASRISAUIBHIBSICAIHSQISOMACMAPMBHMCMMMAMMPMTQ
HSGPDZCASCTM
MTOSPQCCVDTRCSIICGBCGPADIERQSHTPVRTPTIPSIPCDEIMPWHAEONDREDOPCLTEDOEDMEDMPDRTABIRHIRHAIMAIMAIMAIMBGMEMMPSTINTMUMINGMILCOGEWAPSBCPPEEWAFVCIEBCPIIBHOFTROVCMVATVRTDAP
AMNANGANGRASASVLBSCRTASSAAPPS5PS5AYOCRVFEJPROJSODDSAASCBTDVIYCAFASPCOEQVIDENEOCCBCWPEPSSSQCABEQEPRLWEIEITTISWIFEITLOPUNKSTOPTTAPQFITUCBANXOCDSCP
COSRMRATCOBM
PTGSTMLDCPGAEDEHRCSOETFBSPAPOSCTMHEJIBCFDOCRSRRAEOOMIHEOBCAMUPTHADSNGSNGPERMIPADSSSTSMTEQEPRICRIESRMBMMH2PPPQOLCCCGAFPCPPCPPC2TCSICSPSCVIPSSSWCNPSOPSMMLLEOFHFPPCC
POCFMHPFNCCHCSTPECCCMCMRCP2HEACROPOMPCYCRSWVSDDSIRHIMMESSDEVBBHGAMERSAPIAAAABXACQACSACQASPAYMBOECALCAQCAWCAXCCACCLCCOCCSCCTCFACFICLACMACOKCPACPQCRRCSRDHRDOMDPBDPC
DPRDSOEDIEFPEIEEMPESPETTEWCFAAFCIFCMFCNFMDGFPGOLGZTGZTHAMHAPHATHEDHERHSPIASICDIDOIDSIETIOSIYDLEAMATMCIMHOMISMPSNASNCONONNSQOPIPBTPCWPMFRNTSCDSCSSHRSKPSLPSMRSPNTCD
TECTJTTRNWKSFDO
ProdLineIDABSADBAMPANBAPSASDBRFCATCDICHPCLMCLSCOACPTCRSCRWCSOCTODDBDICDTLEDBEIBEQIFBOFTTGILGORHDIHRBICPIEQHSGJIRLDDLSIMMIMSCMSTNIMPCLPDSPFCPPBPPCRSOSARSCBSETSITSPASTATLD
TMLTOLTVPWRACRACAAEMATONCNSLAMTOMMTOCLOWCSMMSREHCDSDTSDTSHPSISSSPSCASPSPDSSSCVDSCSAFSASCISPSIQLQHELFAMDASPANTDMRSHTATAABNABCBB
TREBH2BH2BH2BH2BHIBHI
GABCOAPDZMTOSPQCCVDTRCSIICGBCGPADIERQSHTPVRTPTIPSIPCDEIMPWHAEONDREDOP
BH2
BHHQQQCOACMTCLTEDOEDMEDMPDRTABIRHAIMESSBGMEMMPSTDEVINTMUMINGMILCOGEWAPSBCPPEEWAFV
CIEBCPIIBHOFTROVCMVATVRTDAPAMNANGRASASVLBSCRTASSAAPPS5AYOCRVFEJPROJSODDSAASCBTDVIYCAFASPCOEQVIDENEOCCBCWPEPSSSQ
CABEQEPRLWEIEITEIEWIFEITLOPUNKSTOPOMFDOFDOCRS
BHHFABCGICPWCADKPTJADMMACOACOATGTPGTPMTSPCSTCFDOADOBREEQYGADPPTWISWRVWRTFTTFTTRRAEOOMIHEOBCAMUPTHADSNGPERDDSSSTSMTEQEPRICRIESRMBMMH2PPPQOLCCCGAFPCPPCPPC2TCSICS
PSCVIPSSSWCNPSOPSMMLLEOFHFPPCCPOCFMHPFNCCHCSTPECCCMBSIRMRCSWCOWCMRCP2HEACROPOMPOMCRS
ProdLineShortDescScales to measure functioning and behavior disorders for children and adultsA selection of books and other complementary products for ADHD in childrenA measure of underachievement for use with adolsecents and adultsA selection of books and other complementary products for anxiety in childrenA means of identifying antisocial traits in childrenAn assessment tool to help identify individuals with Asperger SyndromeAn assessment tool to detect impairment of executive functioningA neurological screening computer programThe complete collection of products in the Children's Depression Inventory line, including paper-and A self-report coping measure for use with adultsPrograms to reduce anger, violence and emotional loss of controlA tool for determining the impact of life events on personal developmentA coaching tool for students with ADHDThe complete line of Conners' CPT software productsThe complete collection of products in the Conners' Rating Scales line, including paper-and pencil prThe complete collection of products that work in the Clinical Report Writer programA self-report sex history questionnaire for adult malesA measure of nonverbal reasoning abilitiesA selection of books for assisting professionals working with children with developmental disordersA computerized diagnotic interview based on DSM-IV for use with childrenA collection of products in the Detroit Tests of Learning familyA selection of Education Books and other complementary products for professionals working with chilA collection of Emotional Intelligence Books and other complementary products for professionals workThe complete collection of products in the BarOn EQ-I familyA collection of books and other complementary products for professionals working in corrections and fA personality assessment tool for children that uses fairy tale characters and questionsScales used to assess Asperger Disorder and AutismA reading test for children and adolscentsAn essential tool for assessing, monitoring, and tracking mental health problems in children and adultA collection of books and other complementary products for Human Resource professionalsA program to assist preschool and elementary aged students with problem solvingA tool for assessing a patient's medical experience from multiple perspectivesHomework Survival Guide: Parent HandoutThe complete collection of Jesness products for adolescent personalityA measure of intrinsic processing disorders in children and adolsecentshe complete collection of products in the Level of Service Inventory line, including paper-and pencil MMPI Interpretive programs for children, adolescents, and adultsAn anxiety scale for children and young adultsAn ability based measure of emotional intelligenceA workbook for organizing and recording obserations of parent-child interactions ideal for use in custThe complete collection of products in the Hare Psychopathy Checklist line, including paper-and pencA tool to measure one's tendency to give desirable responsesA self-report personality measureA collection of Personality and Psychopathology books for professionals working with childrenA measure of psychological processing difficulties in young childrenA tool for measuring the impact of injuries and trauma on adultsA questionnaire to assist in determining likelihood of domestic violenceA measure of competence and behavior for preschool childrenA programs for assisting children and adults with social effectivenessAn intelligence test for children and adultsPhobia and anxiety scales for children and adultsAnxiety scales for children and adultsLanguage development tests for children
A measure of general and specific memory problemsA measure of executive planning and problem solving for children and adultsTests of visual perceptual skills for children of all agesA collection of aptitude tests for children of all agesThe complete collection of CAARS products for adult ADHDA structured interview that aids in diagnosing ADHD adultsA measure of state anxiety, trait anxiety, and perception of situational threatA language-free, motor-reduced measure of intelligenceA set of score corrections for popular testsA tool for assessing both specificity and sensitivity to diverse memory problemsA tool for distinguishing between malingered and true memory impairmentsA measure of verbal and visuospatial learning and memory performance in older adultsHelps differentiate between normal elderly and those suffering from dementiaA neuropsychological measure for individuals aged 6 – 89A tool for assessing cognitive functioning in adultsA collection of rehabilitation and coping productsThe complete collection of products in the CDS family, including paper and softwareThe complete collection of products in the DTS family, including paper and softwareThe complete collection of products in the DTS family, including paper and softwareThe complete collection of products in the HPSI family including paper and softwareA measure of internalized shame and the negative response patterns that result from itA tool for assessing an individual’s problem-solving style and ability to generate solutionsA comprehensive test of acute psychopathology in the elderlyA self-report instrument designed to illustrate personality stylesA collection of software based on the DSM-IV™A collection of paper products based on the SCIDA collection of DSM-IV™ products to complement your practiceThe complete collection of SA-45 productsThe complete collection of SAS productsA tool for measuring three types of coping stylesStress Management tools for parentsA tool to assesses quality of life indicatorsThe complete collection of modules in the computerized Help SeriesThe complete collection of products in the FAM product lineThe complete collection of products in the DAS product lineA 30-symptom rating scale for assessing schizophreniaA tool for assisting in generating a diagnosis and classifying the course of the movement disorderThe complete collection of Rorshach test productsA projective test for use in the assessment of children, adolescents, and adultsA collection of books and other complementary products for professionals assessing adultsA collection of neurpsychology books and other complementary productsA collection of clinical reference books
Theresa Battery for Health Improvement 2 Battery for Health Improvement 2 Battery for Health Improvement 2 Battery for Health Improvement 2 Battery for Health Improvement Battery for Health Improvement
General Ability Measure for Adults Comprehensive Ability Battery Posttraumatic Stress Diagnostic Scale (PDS)Memory Test for Older Adults (MTOA)SCID Screen Patient Questionnaire (SSPQ) for WindowsComputer-Assisted SCID-Clinician Version (CAS-CV) from WindowsDTREE: The DSM-IV Expert for WindowsComputer-Assisted SCID II Expert System (CAS II ES)An insider's Complete Guide to DSM-IVThe Busy Clinician's Guide to DSM-IVPractical Applications of DSM-IV in a Managed Care EnvironmentIntake Evaluation Report (IER)QUICKVIEW Social HistoryTurning Points: A Psychoeducational Program for Overcoming an Eating DisorderRelaxation Training ProgramTropical Island Paradise Relaxation TapeStress Index for Parents of Adolescents (SIPA)Chemical Dependency Assessment ProfileImpulsivity Theory, Assessment, and TreatmentWhat Does Everybody Else Know That I Don't?Essentials of Neuropsychological AssessmentDSM-IV-TR Handbook of Differential DiagnosisDisorder of Personality" DSM-IV and Beyond, 2nd Ed.
Battery for Health Improvement 2
Battery for Health Improvement Quality of Life Comprehensive Ability Battery Comprehensive Trail-Making Test (CTMT)Clinician's Electronic Thesaurus Version 5Electronic DSM-IV-TR PlusElectronic DSM-IV-TR PlusElectronic DSM-IV-TR PlusPsychologist' Desk ReferenceThe T.A.T., the C.A.T. and the S.A.T. in Clinical UseInterpretive Reasoning and the Halstead-Reitan TestsThe MMPI-2: An Interpretive Manual, 2 Ed.Essentials of MMPI-2 and MMPI-A Interpretation, 2nd Ed.A Beginner's Guide to the MMPI-2Essentials of MMPI-2 AssessmentMMPI-2 in Psychological TreatmentDevelopment and Use of the MMPI-2 Content ScalesInternation Adaptations of the MMPI-2Manual for Using the MMPI-2 as a Therapeutic InterventionInterpretive Guide to the Millon Clinical Multiaxial Inventory Second EditionThe Million Clinical Inventories: Clinical and Personality AssessmentCognitive Therapy for Personality Deisorders: A Schema-Focused ApproachEssentials of WAIS-III AssessmentNew Personality Self-Portrait-RevisedCoping with Psychiatic and Psychological TestimonyThe Expert Expert Witness: More Maxims and Guidelines for Testifying in CourtAssessment of Family Violence: A Clinical and Legal Sourcebook
Conducting Insanity EvaluationsBehaviour, Crime and Legal ProcessesInvestigative InterviewingHandbook of Offender Assessment and TreatmentTreatment of Offenders with Mental DisordersViolence, Crime and Mentally Disordered OffendersViolent AttachmentsViolence Risk And Threat AssessmentDealing with Anger Problems: Rational-Emotive Therapeutic InterventionsAnger ManagementAnger Disorders: Definition, Diagnosis, and TreatmentThe Rorschach Assessment of Aggressive and Psychopathic PersonalitiesAntisocial and Violent YouthLost Boys: Why Our Sons Turn Violent and How We Can Save ThemMMPI, MMPI-2, & MMPI-A in Court: A Practical Guide for Expert Witnesses and Attorneys, 2nd Ed.MMPI-2: Assessing Personality and PsychopathologyMMPI-A Assessing Adolescent PsychopathologyThe Psychology of Stalking: Clinical and Forensic PerspectivesAssessing the Youthful Offender: Issues and TechniquesCriminal Responsibility Evaluations: A Manual For PracticeForensic Evaluations of JuvenilesProtocols for the Sex-Abuse EvaluationJuvenile Sexual Offending: Causes, Consequences, and CorrectionsDual Diagnosis: Counselling the Mentally Ill Substance AbuserAdolescents, Alcohol, and Substance Abuse: Reaching Teens Through Brief InterventionsCognitive Behavioural Treatment of Sexual OffendersHandbook of Domestic Violence Intervention Strategies: Policies, Programs, and Legal RemediesYou Can Control Your Anger! 21 Ways To Do ItForensic Assessment with the Millon InventoriesA Primer on Community Corrections and Criminal Justice Work in CanadaWilliams LifeSkills System for Managing Stress & AngerInterest Determinination, Exploration and Assessment System (IDEAS)NEO Personality Inventory-Revised (NEO PI-R)Campbell Interest and Skills Survey (CISS)Canadian Work Preference Inventory (CWPI)Executive Profile Survey (EPS)Seligman Attributional Style Questionnaire (SASQ)
Comprehensive Ability Battery (CAB)The EQ Edge: Emotional Intelligence and Your SuccessPrimal LeadershipWorking with Emotional IntelligenceEmotional IntelligenceEmotional Intelligence in Everyday LifeThe Wisdom in Feeling: Psychological Processes in Emotional IntelligenceThe Handbook of Emotional IntelligenceLearned Optimism: How to Change your Mind and your LifeMHS Professional Tool Suite with MHS SmartLinkDigital StopwatchProfile of Mood States Bipolar Version Forensic Distributed Other Forensic Distributed Other Conners
Battery for Health Improvement An emotional and behavior assessment for childrenA brief 10-item measure of general psychopathology effective for monitoring treatment and changeAssessment software that helps identify attention problems and measures treatment effectivenessA brief measure using DSM-IV™ to screen for children at risk for ADHDAssessment software to help identify attention problems and measurement of treatment effectivenessJournal of Attention Disorders (JAD)Minnesota Multiphasic Personality Inventory for Adolescents (MMPI-A)Program for adult coaches to help attention-deficient studentsProgram for adult coaches to help attention-deficient studentsA Teachers Guide to student behaviorA Parent's Guide to Teenage ProblemsParent Management Training for Attention-Deficit/Hyperactivity DisorderSocial Phobia and Anxiety Inventory for Children (SPAI-C)State-Trait Anxiety Inventory for Children (STAIC)Antisocial Process Screening Device (APSD)Antisocial Process Screening Device (APSD)Behavior Rating Inventory of Executive Function (BRIEF)BarOn Emotional Quotient Inventory: Youth Version (BarOn EQ-i:YV)Gilliam Asperger Disorder Scale (GADS)Psychological Processing Checklist (PPC)WISC-III Report 3.0Wide Range Assessment of Visual Motor Ability (WRAVMA)WRAT-ExpandedFairy Tale Test (FTT)Fairy Tale Test (FTT)Rethinking Risk AssessmentEssential of Outcome AssessmentMotivational Interviewing: Preparing People for ChangeEssentials of Behavioral AssessmentClinical Assessment of Malingering and DeceptionThe Use of Psychological Testing for Treatment Planning and Outcome AssessmentHandbook for the Assessment of Dissociation: A Clinical GuideShame and GuiltPerfectionism: Theory, Research, and TreatmentDual Diagnosis: Counselling the Mentally Ill Substance AbuserSocial Skills Training for Schizophrenia: A Step-By-Step GuideStress Management Training: A Group Leader's GuideThe EQ Edge: Emotional Intelligence and Your SuccessPrinciples of Rorschach InterpretationContemporary Rorschach InterpretationEssentials of Rorschach AssessmentMillon Behavioral Medicine Diagnostic (MBMD)Millon Behavioral Health Inventory (MBHI)Pain Patient Profile (P-3)Quality of Life Inventory (QOLI)Conners' Rating Scales-Revised (CRS-R)GAF Report For Windows: The Global Assessment of Functioning ScalePreparing for Court Testimony Based on the MMPI-2Preparing for Court Testimony Based on the MMPI-2Hare Psychopathy Checklist-Revised (PCL-R)L: 2nd EditionTestifying and Child Sexual Abuse: A Courtroom GuideInterviewing for Child Sexual Abuse: A Forensic Guide
Hare P-SCAN Research Version 2 (P-SCAN RV2)Validity Indicator Profile (VIP)Substance Abuse Subtle Screening Inventory (SASSI)Without Conscience: The Disturbing World of the Psychopaths Amoung UsPsychopathy: Antisocial, Criminal, and Violent BehaviorThe Psychopathic Mind: Origins, Dynamics, and TreatmentMalingering and Deception in Adolescents: Assessing Credibility in Clinical and Forensic SettingsEssentials of Forensic Psychological AssessmentThe Handbook of Forensic Psychology, 2nd Ed.The Psychology of Criminal Conduct, 3rd Ed.The Psychopathology of Crime: Criminal Behavior as a Clinical DisorderForensic Mental Health Assessment: A CasebookThe Practice of Forensic Neuropsychology: Meeting Challenges in the CourtroomThe Custody Evaluation Handbook: Research-Based Solutions and ApplicationsCompetency to Stand Trial Evaluations: A Manual for PracticePsychological Evaluations for the CourtsCrime Classification ManualBSI AudiocassetteRestless Minds, Restless Kids: ADHD in Children & AdolescentsCRS-R for WindowsCRS-R for WindowsConners-March Development Questionnaire (CMDQ)Conners' Continuous Performance Test II (CPT II) fro WindowsHighly Effective Approaches to Making the Conners' CPT Work in Your Clinical PracticeConners' Rating Scales (1989 Version)Profile of Mood States Bipolar Version Profile of Mood States Bipolar Version Conners
ProdLineNameAdaptive Behavior Scales (ABS)ADHD Guides, Books, and TapesAcheivement Motivation Profile (AMP)Anxiety Books and GuidesAntisocial Process Screening Device (APSD)Asperger Syndrom Diagnostic Scale (ASDS)Behavior Rating Inventory of Executive Function (BRIEF)Category Test (CAT) Computer PorgramChildren's Depression Inventory (CDI)Coping with Health Injuries and Problems (CHIP)Controlling Anger and Learning to Manage It (CALM)Coddington Life Events Scales (CLES)Coaching the ADHD StudentConners' Continuous Performance Test (CPT)Conners' Rating ScalesClinical Report Writer SoftwareClarke Sex History Questionnaire (SHQ-R)Comprehesive Test of Nonverbal Intelligence (CTONI)Developmental Disorders Books and GuidesDiagnositc Interview for Children and Adolescents - IV (DICA-IV)Detroit Tests of Learning (DTLA)Education Books and GuidesEmotional Intelligence Books, Guides and TapesEmotional Quotient Inventory EQ-i)Corrections Books and Complementary ProductsFairy Tale Test (FTT)Gilliam ScalesGray Oral Reading Tests (GORT-4)Health Dynamics Inventory (HDI)Human Resource Books and Complementary ProductsI Can Problem Solve (ICPS)Ilness Effect Questionnaire (IEQ-MP)Homework Survival Guide: Parent HandoutJesness ProductsLearning Disabilities Diagnostic Inventory (LDDI)Level of Service Inventory - Revised (LSI-R)MMPI Interpretive SystemsMultidimensional Anxiety Scale for Children (MASC)Mayer-Salovey-Caruso Emotional Intelligence Test (MSCEIT)NIMS Observational ChecklistHare Psychopathy Checklist (PCL)Paulhus Deception Scales (PDS)16 PF Fifth EditionPersonality and Psychopathology Books and GuidesPsychological Processing Checklist (PPC)Rehabilition Survey of Problems and Coping (R-SOPAC)Spousal Assault Risk Assessment (SARA)Social Competence and Behavior Evaluation Preschool Edition (SCBE)Social Effectiveness Therapy (SET)Slossen Intelligence Test - Revised (SIT-R3)Social Phobia and Anxiety Inventory (SPAI)State-Trait Anxiety Inventory (STAI)Test of Language Development (TOLD)
Test of Memory and Learning (TOMAL)Tower of London-DX (TOL)Tests of Visual Perceptual Skills (TVPS)Wide Range Achievement Tests (WRAT)Conners' Adult ADHD Rating Scales (CAARS)Conners' Adult ADHD Diagnostic Interview for DSM-IV™ (CAADID)Endler Multidimensional Anxiety Scales (EMAS)Test of Nonverbal Intelligence (TONI-3) Third EditionComprehesnvie Norms for an Expanded Halstead-Reitan BatteryLearning and Memory Battery (LAMB)TOMMMemory Test for Older Adults (MTOA)Clock TestWisconsin Card Sorting Test (WCST)Mini-Mental State Examination (MMSE™)Rehabilition Checklist (RCL)Carroll Depression Scales (CDS)Davidson Trauma Scales (DTS)Davidson Trauma Scales (DTS)Holden Psychological Screening Inventory (HPSI)Internalized Shame Scale (ISS)Social Problem-Solving Inventory-Revised (SPSI-R)Clinical Assessment Scales for the Elderly (CASE)Personality Self Portrait (PSP)DSM-IV™ SoftwareStructured Clinical Interview for DSM-IV ProductsA Clinician's Guide to Diagnosing Dissociative Symptoms and DisordersSymptom Assessment-45 (SA-45)Social Adjustment Scale–Self-Report (SAS-SR)Coping Inventory for Stressful Situations (CISS)Parenting Stress ToolsQuality of Life Questionnaire (QLQ)Help SeriesFamily Assessment Measure (FAM-III)Dyadic Assessment Scale (DAS)Positive and Negative Syndrome Scale (PANSS)TD (Tardive Dyskinesia) MonitorRorshach Test ProductsThematic Apperception Test (TAT)Adult Assessment Books and Other Complementary ProductsNeuropsychological Assessment BooksClinical Reference Books
Theresa Battery for Health Improvement 2, NCS Battery for Health Improvement 2 Battery for Health Improvement 2 Battery for Health Improvement 2 Battery for Health Improvement (BHI) Battery for Health Improvement (BHI)
A brief, nonverbal test that provides an estimate of an individual's general intellectual ability Measures abilities relevant to job performance Posttraumatic Stress Diagnostic Scale (PDS)Memory Test for Older Adults (MTOA)SCID Screen Patient Questionnaire (SSPQ) for WindowsComputer-Assisted SCID-Clinician Version (CAS-CV) from WindowsDTREE: The DSM-IV Expert for WindowsComputer-Assisted SCID II Expert System (CAS II ES)An insider's Complete Guide to DSM-IVThe Busy Clinician's Guide to DSM-IVPractical Applications of DSM-IV in a Managed Care EnvironmentIntake Evaluation Report (IER)QUICKVIEW Social HistoryTurning Points: A Psychoeducational Program for Overcoming an Eating DisorderRelaxation Training ProgramTropical Island Paradise Relaxation TapeStress Index for Parents of Adolescents (SIPA)Chemical Dependency Assessment ProfileImpulsivity Theory, Assessment, and TreatmentWhat Does Everybody Else Know That I Don't?Essentials of Neuropsychological AssessmentDSM-IV-TR Handbook of Differential DiagnosisDisorder of Personality" DSM-IV and Beyond, 2nd Ed.
Battery for Health Improvement 2, NCS
Battery for Health Improvement assesses quality of life indicators Measures abilities relevant to job performance Comprehensive Trail-Making Test (CTMT)Clinician's Electronic Thesaurus Version 5Electronic DSM-IV-TR PlusElectronic DSM-IV-TR PlusElectronic DSM-IV-TR PlusPsychologist' Desk ReferenceThe T.A.T., the C.A.T. and the S.A.T. in Clinical UseInterpretive Reasoning and the Halstead-Reitan TestsThe MMPI-2: An Interpretive Manual, 2 Ed.Essentials of MMPI-2 and MMPI-A Interpretation, 2nd Ed.A Beginner's Guide to the MMPI-2Essentials of MMPI-2 AssessmentMMPI-2 in Psychological TreatmentDevelopment and Use of the MMPI-2 Content ScalesInternation Adaptations of the MMPI-2Manual for Using the MMPI-2 as a Therapeutic InterventionInterpretive Guide to the Millon Clinical Multiaxial Inventory Second EditionThe Million Clinical Inventories: Clinical and Personality AssessmentCognitive Therapy for Personality Deisorders: A Schema-Focused ApproachEssentials of WAIS-III AssessmentNew Personality Self-Portrait-RevisedCoping with Psychiatic and Psychological TestimonyThe Expert Expert Witness: More Maxims and Guidelines for Testifying in CourtAssessment of Family Violence: A Clinical and Legal Sourcebook
Conducting Insanity EvaluationsBehaviour, Crime and Legal ProcessesInvestigative InterviewingHandbook of Offender Assessment and TreatmentTreatment of Offenders with Mental DisordersViolence, Crime and Mentally Disordered OffendersViolent AttachmentsViolence Risk And Threat AssessmentDealing with Anger Problems: Rational-Emotive Therapeutic InterventionsAnger ManagementAnger Disorders: Definition, Diagnosis, and TreatmentThe Rorschach Assessment of Aggressive and Psychopathic PersonalitiesAntisocial and Violent YouthLost Boys: Why Our Sons Turn Violent and How We Can Save ThemMMPI, MMPI-2, & MMPI-A in Court: A Practical Guide for Expert Witnesses and Attorneys, 2nd Ed.MMPI-2: Assessing Personality and PsychopathologyMMPI-A Assessing Adolescent PsychopathologyThe Psychology of Stalking: Clinical and Forensic PerspectivesAssessing the Youthful Offender: Issues and TechniquesCriminal Responsibility Evaluations: A Manual For PracticeForensic Evaluations of JuvenilesProtocols for the Sex-Abuse EvaluationJuvenile Sexual Offending: Causes, Consequences, and CorrectionsDual Diagnosis: Counselling the Mentally Ill Substance AbuserAdolescents, Alcohol, and Substance Abuse: Reaching Teens Through Brief InterventionsCognitive Behavioural Treatment of Sexual OffendersHandbook of Domestic Violence Intervention Strategies: Policies, Programs, and Legal RemediesYou Can Control Your Anger! 21 Ways To Do ItForensic Assessment with the Millon InventoriesA Primer on Community Corrections and Criminal Justice Work in CanadaWilliams LifeSkills System for Managing Stress & AngerInterest Determinination, Exploration and Assessment System (IDEAS)NEO Personality Inventory-Revised (NEO PI-R)Campbell Interest and Skills Survey (CISS)Canadian Work Preference Inventory (CWPI)Executive Profile Survey (EPS)Seligman Attributional Style Questionnaire (SASQ)
Comprehensive Ability Battery (CAB)The EQ Edge: Emotional Intelligence and Your SuccessPrimal LeadershipWorking with Emotional IntelligenceEmotional IntelligenceEmotional Intelligence in Everyday LifeThe Wisdom in Feeling: Psychological Processes in Emotional IntelligenceThe Handbook of Emotional IntelligenceLearned Optimism: How to Change your Mind and your LifeMHS Professional Tool Suite with MHS SmartLinkDigital StopwatchAssessment that measures affective mood state fluctuation Other Forensic Distributed Products Forensic Distributed Other
Battery for Health Improvement Feelings Attitudes and Behaviors Scale for Children (FAB-C)Conners' Global Index (CGI)Continuous Performance Test II (CPT II) for WindowsConners' ADHD/DSM-IV Scales (CADS)Kiddie Continuous Performance Test (K-CPT) for WindowsJournal of Attention Disorders (JAD)Minnesota Multiphasic Personality Inventory for Adolescents (MMPI-A)Coaching the ADHD StudentCoaching the ADHD StudentA Teacher's Guide to Recognizing Psychological and Behavioral Problems of StudentsA Parent's Guide to Teenage ProblemsParent Management Training for Attention-Deficit/Hyperactivity DisorderSocial Phobia and Anxiety Inventory for Children (SPAI-C)State-Trait Anxiety Inventory for Children (STAIC)Antisocial Process Screening Device (APSD)Antisocial Process Screening Device (APSD)Behavior Rating Inventory of Executive Function (BRIEF)BarOn Emotional Quotient Inventory: Youth Version (BarOn EQ-i:YV)Gilliam Asperger Disorder Scale (GADS)Psychological Processing Checklist (PPC)WISC-III Report 3.0Wide Range Assessment of Visual Motor Ability (WRAVMA)WRAT-ExpandedFairy Tale Test (FTT)Fairy Tale Test (FTT)Rethinking Risk AssessmentEssential of Outcome AssessmentMotivational Interviewing: Preparing People for ChangeEssentials of Behavioral AssessmentClinical Assessment of Malingering and DeceptionThe Use of Psychological Testing for Treatment Planning and Outcome AssessmentHandbook for the Assessment of Dissociation: A Clinical GuideShame and GuiltPerfectionism: Theory, Research, and TreatmentDual Diagnosis: Counselling the Mentally Ill Substance AbuserSocial Skills Training for Schizophrenia: A Step-By-Step GuideStress Management Training: A Group Leader's GuideThe EQ Edge: Emotional Intelligence and Your SuccessPrinciples of Rorschach InterpretationContemporary Rorschach InterpretationEssentials of Rorschach AssessmentMillon Behavioral Medicine Diagnostic (MBMD)Millon Behavioral Health Inventory (MBHI)Pain Patient Profile (P-3)Quality of Life Inventory (QOLI)Conners' Rating Scales-Revised (CRS-R)GAF Report For Windows: The Global Assessment of Functioning ScalePreparing for Court Testimony Based on the MMPI-2Preparing for Court Testimony Based on the MMPI-2Hare Psychopathy Checklist-Revised (PCL-R)L: 2nd EditionTestifying and Child Sexual Abuse: A Courtroom GuideInterviewing for Child Sexual Abuse: A Forensic Guide
Hare P-SCAN Research Version 2 (P-SCAN RV2)Validity Indicator Profile (VIP)Substance Abuse Subtle Screening Inventory (SASSI)Without Conscience: The Disturbing World of the Psychopaths Amoung UsPsychopathy: Antisocial, Criminal, and Violent BehaviorThe Psychopathic Mind: Origins, Dynamics, and TreatmentMalingering and Deception in Adolescents: Assessing Credibility in Clinical and Forensic SettingsEssentials of Forensic Psychological AssessmentThe Handbook of Forensic Psychology, 2nd Ed.The Psychology of Criminal Conduct, 3rd Ed.The Psychopathology of Crime: Criminal Behavior as a Clinical DisorderForensic Mental Health Assessment: A CasebookThe Practice of Forensic Neuropsychology: Meeting Challenges in the CourtroomThe Custody Evaluation Handbook: Research-Based Solutions and ApplicationsCompetency to Stand Trial Evaluations: A Manual for PracticePsychological Evaluations for the CourtsCrime Classification ManualBSI AudiocassetteRestless Minds, Restless Kids: ADHD in Children & AdolescentsCRS-R for WindowsCRS-R for WindowsConners-March Development Questionnaire (CMDQ)Conners' Continuous Performance Test II (CPT II) fro WindowsHighly Effective Approaches to Making the Conners' CPT Work in Your Clinical PracticeConners' Rating Scales (1989 Version)Assessment that measures affective mood state fluctuation Assessment that measures affective mood state fluctuation x
Description ID16PF books 16B16PF LEADR Report 16L16PF MTQ 16Q16PF Select 16S16PF World 16WAngie and Andy AAAAssessing Attention/Deficit Hyperactivity Disorder AADMMPI-A Assessing Adolescent Psychopathology AAPAdolescents, Alcohol, and Substance Abuse: Reaching Teens Through Brief Interventions AASAdaptive Behavior Scale (AAMR ABS-S:2) ABCAbusive Personality: Violence ABPThe Abusive Personality ABXACCESS Program ACCACCEPTS Program ACPACQ Software ACQConsulting - (Organizational) ACSAssessment of Chronic Pain ACXACQ Paper Version ACZAcademic Performance Inventory ADAADHD: A Handbook for Diagnosis and Treatment ADBADHD in Adults and Children ADHADI-R ADIADAPT KIT ADKAdult Psych. & Diagnosis ADOAnger Disorder Scale ADSAdverse Effects of Psych.Drug ADVADD Workbook ADWADHD in the Young Child ADYAlternative Ed Delivery System AEIAssessment of Family Violence: A Clinical and Legal Sourcebook AFVAn Assessment Guide To Geriatric Neuropsychology AGGADHD: Assessment and Treatment AHDAiding Older Adults (S/C) AIDThe MMPI-2: An Interpretive Manual AIMA Kibitz with David AKDAttention Deficit Disorder and Learning Disabilities ALDMTQ Annual Maintenance Fee AMFAnger Management AMNAchievement Motivation Profile (AMP) AMPAnger Disorders: Definition, Diagnosis, and Treatment ANGAnn Bibl MMPI/MMPI-2 in Pers & ANNADHD and the Nature of Self Co ANSAnxiety Disorders in Children and Adolscents ANXAreas of Change AOCAccomodation Plan Form APFAdult Personality Inventory API16 PF Adolescent Personality Questionnaire (APQ) APQAntisocial Process Screening Device (APSD) APSAsperger Syndrome Diagnostic Scale (ASDS) ASDAdult ASAP-ASI Computer Progra ASPMMPI-2: Assessing Personality and Psychopathology ASSAntisocial and Violent Youth ASVAssessment and Treatment of Childhood Problems ATC
At Ease ATEAssess & Treat Depress Child/A ATIAlcohol Use Inventory (AUI) Paper AU2Alcohol Use Inventory (AUI) Mail-In AU4AUI - MTA AU5Alcohol Use Inventory (AUI) MTQ AU6A Visit with Maria AVMA Visit with Sara AVSAngry Young Men AYMAssessing the Youthful Offender: Issues and Techniques AYOCanada and UK - BASI BASBrief Battery For Health Improvement 2 (BBHI 2) BBHBusy Clinician's Guide to DSM-IV BCLBehavior, Crime and Legal Processes BCPBender Report BENBeginner's Guide to MMPI-2 BGMBattery For Health Improvement (BHI) Paper BH2Battery For Health Improvement (BHI) Audiocassette BH3Battery For Health Improvement (BHI) Scoring BH4Battery For Health Improvement (BHI) MTQ BH6Battery for Health Improvement 2 BHHBiofeedback BIO16PF BIR BIRBehavioral Interv. for Young C BIYBOEI Product BOEBest Practices in Sch Psych BPIBricklin Perceptual Scales BPSBehavior Rating Inventory of Executive Function BRIBrief Symptom Inventory (BSI) & BSI-18 Paper BS2Brief Symptom Inventory (BSI) Audiocassettes BS3Brief Symptom Inventory (BSI) Mail-in Scoring BS4BSI MTA BS5BSI MTQ BS6Career Assessment Inventory (CAI) Paper CA2Career Assessment Inventory (CAI) Scoring CA4CAI MTA CA5Career Assessment Inventory (CAI) MTQ CA6Conners' Adult ADHD Rating Scales (CAARS) CAAComprehensive Ability Battery (CAB) CABCoaching the ADHD Student CADClinical Assessment Scales for the Elderly (CASE) CAECoaching the ADHD Student CAHConners' Adult ADHD Diagnostic Interview for DSM-IV™ (CAADID) CAICALMER CALClinical Assessment of Malingering and Deception CAMComputerized Aptitude CAPCAQ - IPAT CAQCAS-RV CARCASS CASCategory Test (CAT) Computer Program 6.0 for DOS CATChild Autism Rating Scale CAUCAARS Software CAWCAS - IPAT CAXCognitive-Behavioral Strategies in Crisis Intervention CBS
Cognitive Behavioural Treatment of Sexual Offenders CBTCCAI CCAThe Custody Evaluation Handbook: Research-Based Solutions and Applications CCHThe Clinical Child Interview CCICAST CCKCrime Classification Manual CCM16PF Cattell Compreh. Personality Interp. (CCPI) CCP16 PF Couples Counselling Report (CCR) CCRChild Custody CCSChemical Dependency Assessment Profile CDEChildren's Depression Inventory (CDI) CDICarroll Depression Scales (CDS) CDSDescription - CDI Version 5 Software CDVContinuing Edcation Record CERCanadian Forces Aptitude Test CFACFIT Scale CFICLINICIAN'S GUIDE CGDComprehensive Guide to Interpersonal Psychotherapy CGIClin. Guide to Neuropsych. Ass CGNCoping With Health Injuries and Problems (CHIP) CHIClinical Handbook of Psychotropic Drugs, 12th Ed. CHPConducting Insanity Evaluations CIECoping Inventory for Stressful Situations (CISS) CISClin. Analysis Quest CL2CLA CLAClock Drawing CLDCoddington Life Events Scales (CLES) CLEClin Intervw Using DSM-IV CLICALM and CALMER CLMClock Test CLOClinician's Thesaurus CLTCampbell Interest and Skill Survey (CISS) Paper CM2Campbell Interest and Skill Survey (CISS) Mail-in CM4Campbell Interest and Skill Survey (CISS) MTQ CM6CLI CM7COS CM8TDS CM9Custom Applications CMACorrection Manager CMPConners-March Development Questionnaire (CMDQ) CMRChildren's Needs-II CNIChild Neuropsych. CNQComprehesnvie Norms for an Expanded Halstead-Reitan Battery CNSA Compendium of Neuropsychological Tests CNTCognitive Therapy for Personality Disorders COGCO-SKILLS COKMMPI-2 Content Comp CONChildren’s Organizational Skills Scale COSChronic Pain CPACoping with Psychiatric and Psychological Testimony CPPCPQ - IPAT CPQI Can Problem Solve (Kindergarten and Primary) CPSConners' Continuous Performance Test II (CPT II) CPTConners' Continuous Performance Test II (CPT II) CPW
CAQ - Paper CQ2CAQ - Scoring CQ4CREVT CREContemporary Rorschach Interpretation CRIConners' Rating Scales (1989 Version) CROConners' Rating Scales-Revised (CRS-R) CRSMMPI, MMPI-2, & MMPI-A in Court: A Practical Guide for Expert Witnesses and Attorneys, 2nd Ed. CRTCriminal Responsibility Evaluations: A Manual For Practice CRVClinical Report Writer CRWCADDI CRXChild Sex Abuse Audio CSAComputer-Assisted SCID-Clinician Version (CAS-CV) CSCSCID II Patient Questionnaire and Computer-Assisted SCID II Expert System CSISCID II PQ CSPClarke Sex History Questionnaire for Males-Revised (SHQ-R) CSQCompetency to Stand Trial Evaluations: A Manual for Practice CSTCustomer Service Aptitude CSVConners' Rating Scales-Revised (CRS-R) Software CSWSTAI-C Software Manual CSXCognitive Therapy-Couples CTCComprehensive Trail-Making Test (CTMT) CTMComprehensive Test of Nonverbal Intelligence (CTONI) CTOChildren in a Violent Society CVSCanadian Work Preference Inventory (CWPI) CWPDAB-2 DABDealing with Anger Problems: Rational-Emotive Therapeutic Interventions DAPDyadic Assessment Scale (DAS) DASDiagnostic Interview for Children and Adolescents-IV (DICA-IV) DCRDSM-IV Clincial Vignettes DCVDriven to Distraction DDIDual Diagnosis: Counseling the Mentally Ill Substance Abuser DDSDevelopment & Use of MMPI-2 Content Scales DEVDevelopment History Report DHRDisorders Of Personality: DSM-IV™ and Beyond, 2nd Ed. DOPDSM-IV Primary Care Version DPCDPRS DPRDSM-IV Manual DRADSM-IV Reference Manuals DREDetroit Tests of Learning Aptitude (DTLA) DTLDTREE: the DSM-IV™ Expert DTRDavidson Trauma Scales (DTS) DTSDevelopmental Test of Visual Perception (DTVP-2) DTVHandbook of Domestic Violence DVIEQ-360 Transfer/cancellation Fee E3WEmotional Development and Emotional Intelligence EDEEDI-2 EDIElectronic DSM-IV-TR™ Plus EDMThe Expert Expert Witness: More Maxims and Guidelines for Testifying in Court EEWEssen of Forensic Psych EFPEmotional Intelligence in Everyday Life EIEEmotionally Intell. Parenting EIPEmotional Intelligence Books EITEndler Multidimensional Anxiety Scales (EMAS) EMAEssentials of MMPI-2 Assessment EMM
EMP EMPEssentials of Behavioral Assessment EOBEssentials of Forensic Psychological Assessment EOFEssentials of Neuropsychological Assessment EONEssentials of Outcome Assessment EOOExecutive Profile Survey (EPS) EPSBarOn Emotional Quotient-360 (BarOn EQ-360) EQ3EQ-I 125 EQ5The EQ Edge: Emotional Intelligence and Your Success EQEEQ-i Fax Charge EQFBarOn Emotional Quotient-Inventory (BarOn EQ-i®) EQIBarOn Emotional Quotient Inventory: Short (EQ-i:S) EQSBarOn EQ-i Version 5 for Windows EQVEQI Workshop EQWBarOn EQ-i:Youth Version (EQ-i:YV) EQYEmotional Regulation Scales ERSESPQ ESPEssentials of Rorschach Assessment ESREssentials of MMPI-2 Interp ESSEffective Treatments for PTSD ETTEffective Use of the GAF EUGEssentials of WAIS-III™ Assessment EWAExpert Wit. in Child Abuse EWCEQ-I:YV Workshop Cancellation Fee EYWSleep Tonight Audio FAAFeelings Attitudes and Behaviors Scale for Children (FAB-C) FACFamily Assessment Measure (FAM-III) FAMForensic Assessment with the Millon Inventories FASFeeding the Brain FBNFax Charge - IPAT FCIFax-Charge - MHS FCMFax-Charge - NCS FCNForensic Distributed Other FDOForensic Evaluation of Juveniles FEJFairy Tale Test (FTT) FITMHS Forms Design FMDForensic Mental Health Assessment: A Casebook FMHActual Freight Charges FREShipping and Handling FRGForm A,B,C or D Mch.Score FRMFeeling Right When Things Go W FRTGilliam Asperger Disorder Scale (GADS) GADGAF Report GAFGeneral Ability Measure for Adults (GAMA) GAMGilliam Autism Rating Scale (GARS) GARGoals for Kids GFKGFPI Manual GFPGonna Do A Little Music GLMGOLPH MTA GOLGray Oral Reading Tests-4 (GORT-4) GRTGSR/TEMP2X GSRGZTS paper GZ2GZTS Scoring GZ4GZTS MTA GZ5
GZTS MTQ Interpretive Report-U GZ6Handbook for the Assessment of Dissociation: A Clinical Guide HADHAMIT HAMHeadache Poster HAPH.A.T. Testing Kit HATHealth Dynamics Inventory (HDI) HDIHandbook of DSM-IV Disorders HDSHighly Effective Approaches to Making the CPT work in your Practice HEAHELP (DOS) HEDHead Injury & Concussion Series HEJHelp Series HELHermann HERThe Handbook of Forensic Psychology, 2nd Ed. HFPHandbook of Offender Assessment and Treatment HOFHolden Psychological Screening Inventory (HPSI) HPSHSQ HQQHow to Raise a Child with a High EQ HRC16PF Human Resources Development Report (HRDR) HRDHelp-Regard HREHalstead-Reitan: A Guide HRGThe Homework Survival Guide HSGHSPQ - IPAT HSPHealth Status Questionnaire (HSQ 2.0) HSQHelp-Stress HSTHelp-Think HTHHow to Use Time-Out Effectivel HTUHyperactivity Handbook HYPIPAT Anxiety Scale IASAn Insider's Guide to DSM-IV IBCICD ICDInterpretive Guide to the MCMI ICMI Can Problem Solve (Preschool) ICPInterviewing for Child Sexual Abuse: ICSIDEAS IDEIPAT Depression Scale IDSIllness Effects Quesionnaire-Multi-Perspective (IEQ-MP) IEQIntake Evaluation Report (IER) IERInt.Guide for Eval. IGEInvestigative Interviewing IIBImagery and Disease IMAMMPI & MMPI-2 Interpretation IMCImpulsivity: Theory, Assessment, and Treatment IMPInfo packs INFInterpretive Guide to the MCMI INGCase Studies-Interpreting the INMMMPI-A Interpretive System Version 2 INSInternational Adaptations of the MMPI-2 INTOnSite System IOSInterpersonal Psychotherpy Dep IPDI Can Problem Solve (Elementary) IPSISO-30 MTQ IQQInterpretive Reasoning & the Halsread-Reitan Tests IRHInventory of Suicide Orientation-30 (ISO-30) ISOISO-36 ISQ
Internalized Shame Scale (ISS) ISSIf You Drink IYDJournal of Attention Disorders (JAD) JADJesness Inventory (JI) & Behavior Checklist (JBC) JESJesness Inventory-Revised (JI-R) JIRJuvenile Sexual Offending: Causes, Consequences, and Correction JSOConners' Kiddie Continuous Performance Test(K-CPT) KPTLearning and Memory Battery (LAMB) LAMLost Boys: When Our Sons Turn Violent and How We Can Save Them LBSLunch Break with Tony LBTLearning Disabilities and Challenging Behaviors LDCLearning Disabilities Diagnostic Inventory (LDDI) LDDLaw Enforcement & Dev. Manual LEALongterm Goals Plan Sht LGPLadies... Let's Chat LLCLearning to Master Chronic Pai LMPLearned Optimism LOPLevel of Service Inventory-Revised (LSI-R) LSILife/Time Manager LTMMillon Adolescent Clinical Inventory (MACI) Paper MA2Millon Adolescent Clinical Inventory (MACI) Audio MA3Millon Adolescent Clinical Inventory(MACI) Mail-in MA4MACI MTQ MA6Managing ADHD in Children MACMan Att Dis in Child Late Adol MADMan.Att.Dis in Adol. & Adults MANMultidimensional Anxiety Scale for Children (MASC) MASMAT MATMaximizing Third Party Reimbur MAXMillion Behavioral Medicine Diagnostic (MBMD) MBMMCMI-II - Paper MC2MCMI-II Audiocassette MC3MCMI-II Scoring MC4MCMI-II MTA MC5MCMI-II MTQ MC6Mastering Chronic Pain MCPMedication Effects Rating Scal MEDMaintenance fee for License Agreement MFEMalingering Probability Scales MGSMillon Behavioral Health Inventory (MBHI) Paper MH2Millon Behavioral Health Inventory (MBHI) Audio MH3Millon Behavioral Health Inventory (MBHI) Mail-in MH4MBHI MTA MH5Millon Behavioral Health Inventory (MBHI) MTQ MH6Mental Hlth Guide to Man Care MHGMMPI - Paper MI2MMPI Audiocassette MI3MMPI _ Scoring MI4MMPI MTA MI5MMPI MTA MI6Motivational Interviewing: Preparing People for Change MIHThe Millon Clinical Inventories MILMillon Index of Personality Styles MiPMisc Distributor Video MIS
MMPI-A - Paper ML2MMPI-A Audiocassette ML3MMPI-A - Scoring ML4MMPI-A - MTA ML5MMPI-A - MTQ ML6Malingering and Deception in Adolescents: Assessing Credibility in Clinical and Forensic Settings MLLMillon Clinical Multiaxial Inventory III Paper MM2Millon Clinical Multiaxial Inventory III Audiotape MM3Millon Clinical Multiaxial Inventory III Mail-in MM4MCMI-III MTA MM5MCMI-III MTQ MM6MMPI-2 in Managed Care MMCWeiner-Harmon Obvious Subs MMIMMPI-2 Adult Interpretive System MMPMini-Mental State Examination (MMSE™) MMSMedical Mgmt Training Video MMTMillon Adolesc Personality Inventory (MAPI) Paper MP2Millon Adolesc Personality Inventory (MAPI) Audio MP3Millon Adolesc Personality Inventory(MAPI) Mail-in MP4MAPI - MTA MP5MAPI - MTQ MP6MPS Research Version Forms MPSMMPI-2 - Paper MR2MMPI-2 Audiocassette MR3MMPI-2 - Scoring MR4MMPI-2 - MTA MR5MMPI-2 - MTQ MR6MMPI-2 Forensic Interpretive Report MR8Mayer-Salovey-Caruso Emotional Intelligence Test MSCMSCEIT Trainer Workshop MSWMemory Test for Older Adults (MTOA) MTOMICROTEST Q Base MTQManual for Using the MMPI-2 MUMNeuropsychological Assessment NASHyperactive Children Grown Up NCGNCS Licensing Fee NCONEO Personality Inventory-Revised (NEO PI-R) NEONeurological Evaluation Pamphlet Series NESNeurolaw NEUNeuropsychological Eval. of He NHINIMS Observational Checklist (NOC) NIMNone NONNeuroticism Scale Bklts NSBNSQ - IPAT NSQOutrageous Behavior Mod OBMOCD in Children and Adolscents OCDOccupational Outlook Handbook OOHOptimizing Intelligences OPIProfile of Mood States: Bipolar Version (POMS-Bi) P02Practical Applications of DSM-IV PADA Parent's Guide to Asperger Syndrome PAGThe Parental Alienation Synd. PALPositive and Negative Syndrome Scale (PANSS) PANPaper Office PAO
Positive and Negative Syndrome Scale (PANSS) PASPsych Assistant PAUProblem Solving Therapy PBTHare Psychopathy Checklist-Revised (PCL-R) 2nd Ed. PC2The Psychology of Criminal Conduct, 3rd Ed. PCC16PF Personal Career Development Profile (PCDP) PCDHare Psychopathy Checklist-Revised (PCL-R) PCLPrimer on Community Correction PCOPreparing For Court Testimony PCPThe Perfect Chart PCWHare Psychopathy Checklist Youth PCYPsychologists’ Desk Reference PDRPaulhus Deception Scales (PDS) PDXPsychological Evaluations for the Courts PECPerfectionism: Theory, Research, and Treatment PER16PF Scoring PF416 PF Fifth Edition PFC16PF French PFFPreparing for a Forensic M.H. PFMThe Practice of Forensic Neuropsychology: Meeting Challenges in the Courtroom PFNParent Guide To Asperger & High-Functioning Autism PGAPractitioner’s Guide to Clinical Neuropsychology PGCPsychManager Full PMFParent Management Training for ADHD PMTPatient or Pretender Book POBThe Psychopathology of Crime: Criminal Behavior as a Clinical Disorder POCPOMS Product POMPatient or Pretender Audio POPPosttraumatic Stress Diagnostic Scale (PDS) POSPatient or Pretender Video POVPain Patient Profile (P-3) PP3Parent PerceptionChild Profile PPCPeoplePRO PPOPsychological/Psychiatric Status Interview (PPSI) PPSPsychological Processing Checklist (PPC) PPTPrinciples of Rorschach Interpretation PRIPrimal Leadership PRLProtocols for the Sex-Abuse Evaluation PROThe Psychology of Stalking PS5New Personality Self-Portrait–Revised PSBHare P-SCAN Research Version (Hare P-SCAN) PSCAntisocial Process Screening Device (APSD) PSDParenting Stress Index (PSI) French PSFProblem Solver Guide for Students with ADHD PSGPsychological/Social History Report (PSH) PSHParenting Stress Index (PSI) PSIThe Psychopathic Mind: Origins, Dynamics, and Treatment PSMPsychopathy: Antisocial, Criminal, and Violent Behavior PSOPersonality Self Portrait (PSP) PSPThe Psychology of Stalking: Clinical and Forensic Perspectives PSSMMPI-2 In Psychological Treatment PSTPsychware Sourcebook: Fourth E PSYA Parent's Guide to Teenage Problems PTGPost Traumatic Stress Disorder PTS
A Teacher's Guide to Recognizing Psychological and Behavioral Problems PTTPutting on the Brakes PUBPut Yourself in Their Shoes PYTQuality of Life Inventory (QOLI) QL6Quality of Life Questionnaire (QLQ) QLQQuality of Life Inventory (QOLI) QOLQuieting Reflex Train. For Adu QRTQuickview Social History QSHThe Rorschach Assessment of Aggressive and Psychopathic Personalities RASRehabilition Checklist (RCL) REHRehabilation Education and Coping Series RHCRorschach Interpretation Assistance Program (RIAP4) RIAReynolds Intellectual Assessment Scales RISRestless Minds, Restless Kids RMRRemembering When.. RMWRental Income RNTRethinking Risk Assessment RRARorshach Tools RSHRehabilitation Survey of Problems and Coping (R-SOPAC) RSORorschach QuikGuide RSQRaising a Thinking Child RTCRelaxation Training Program RTPRorschach Vol I Basic Foudtn RV1Rorschach Vol II Interpretion RV2Rorschach Vol III Assessment RV3Checklists for Report Writer RWCSymptom Assessment-45 (SA-45) SA4Sales Achievement Predictor SAASpouse Abuse Assess. & Treat SABSpousal Assault Risk Assessment Guide (SARA) SARSocial Adjustment Scale–Self-Report (SAS-SR) SASSocial Competence & Behavior Evaluation (SCBE) SBESCID-D Audiotape Set SCAA Clinician's Guide to Diagnosing Dissociative Symptoms and Disorders SCBSharing Christmas Cheer SCCAstructured Clinical Interview for DSM-IV Disociative Disorders (SCID-D) SCDSymptom Checklist-90-Revised (SCL-90-R) SCLShy Children, Phobic Adults SCPSocial Communication Questionnaire SCQSCS SCSTips and Techniques for Using the SCID-D SCTStructured Clinical Interview for DSM-IV SCVSelf-Description Inventory SDISDS SDSSocial Effectiveness Therapy - Child SECSocial Effectiveness Therapy (SET) SETPsychManager and PsychManager Lite SHRShrink Tech Support Training SHTStress Index for Parents of Adolescents (SIPA) SIPSlossen Intelligence Test-Revised (SIT-R3) SITSteves Keynote Presentations SKPSpeech & Language Devel. Chart SLDSleep Tonight Audio SLPStrategic Marketing SMA
The Stranger in Mirror SMRStress Management Training: A Group Leader’s Guide SMTShame and Guilt SNGSOS! Help for Emotions SOESOS - Parents SOHSocial Phobia and Anxiety Inventory (SPAI) SPASocial Phobia and Anxiety Inventory for Children (SPAI-C) SPCSPAN SPNSocial Problem-Solving Inventory-Revised (SPSI-R) SPSSCID Screen Patient Questionnaire-Extended (SSPQX) SSESeven Steps to Homework Succes SSHSession Summary SSISCID Screen Patient Questionnaire (SSPQ) SSPSeligman Attributional Style Questionnaire (SASQ) SSQSubstance Abuse Subtle Screening Inventory (SASSI) SSSSocial Skills Training for Schizophrenia: A Step-By-Step Guide SSTState Trait Anxiety Inventory (STAI) STAState-Trait Anxiety Inventory for Children (STAIC) STCSchool Violence Threat Management STMStorytelling, Narrative, and t STNDigital Stopwatch STOThe Stress Profile STPSuicide Risk SURThe T.A.T., C.A.T. and S.A.T. in Clinical Use TABTactical Psychotherapy TACAssess.& Treat.of Adol.Sex Off TASThematic Apperception Test (TAT) TATTeaching the Child with ADHD TCATreat t of Chronic Depression TCDTestifying about Child Sexual Abuse TCSTaking Charge of ADHD TDATD (Tardive Dyskinesia) Monitor TDMTermination Discharge Summary (TDS) TDSThe Executive Brain TEBTechnical Assistance Fee TECThinking, Feeling, Behaving TFBTalking, Feeling, Doing Game TFDTherap.Guide to the MMPI & MMP THETestifying in Court TICTropical Island Paradise TIPTelephone Interview for Cognitive Status TIST-JTA TJTTest of Language Development-Intermediate (TOLD-I:3) TLDTest of Language Development-Primary (TOLD-P:3) TLPTest of Memory and Learning (TOMAL) TMLThink Straight! Feel Great! TNKTower of London (TOL-DX) TOLTest of Memory Malingering (TOMM) TOMTest of Nonverbal Intelligence (TONI-3) Third Edition TONTreating PTSD: Cog.Behav.Strat TPSTurning Points TPVMHS Translation Sales TRNTreatment of Offenders with Mental Disorders TROTraumatic Stress TRS
Therapy of Substance Abuse TSATVI TVITest of Visual-Perceptual Skills (TVPS-R) TVPUnderstanding and Managing Children's Classroom Behavior UCBUCCES UCCMHS Professional Tool Suite with SmartLink™ UNKUnderstanding Violence UNVThe Use of Psychological Testing for Treatment Planning and Outcome Assessment UPTMMPI: Use With Spec Population USSViolent Attachments VATViolence, Crime and Mentally Disordered Offenders VCMValidity Indicator Profile (VIP) VIPVMI-4 VMIVR: Celeb. African-Amer. Cult. VRCVR: Favorite Things VRFViolence Risk and Threat Assessment VRTWAIS_R Report WAIWithout Conscience: The Disturbing World of the Psychopaths Among Us WCNWisconsin Card Sorting Test (WCST) WCSWorking with Emotional Intelligence WEIWhat Does Everybody Else Know That I Don’t? WHAWisdom In Feeling WIFK-WIIS Checklst WIIWilliams Lifeskills WILWISC-III™ Report WISWorkshops/Training WKSWhy Men Batter Women WMBWord & Number Assess WNAWeekly Progress Rpt WPRWide Range Achievement Test (WRAT) WRAWide Range Assessment of Visual Motor Ability (WRAVMA) WRVWalker Visuals WVSYou Can Control Your Anger! 21 Ways To Do It YCAYou Can Control Your Feelings YCCA Yankee Doodle Dandy Time YDDYouth Level of Service/Case Management Inventory (YLS/CMI) YLS
ProdLinIDCATPFCPFCAPIAPIAAAADBAAPAASABSFDOABXCDOCDOACQACSFDOACQCDOADBADBADICDOADOADSADOCDOCDOCDOAFVNABADBADOIMMFDOADBMTQAMNAMPANGADOCDOANXACQCDOAPIAPQAPSASDASPASSASVATC
HEDCDOAUIAUIAUIAUIFDOFDOAYMAYOBASBBHDSCBCPADOBGMBHIBHIBHIBHIADOFDOPFCFDOBOECDOFDOBREBSIBSIBSIBSIBSICAICAICAICAICRACABCOACASCADCAACALAABIETCAQCSRCRRCATCAUCAWCAXAAB
CBTCCACCHCDOFDOCCMPFCPFCCCSCDECDICDSCDIDOMCFACFISCDAABFDOCHPCBBCIECISCAQCLACLTCLSDSOCLMCLOCBBCCBCCBCCBCCLCCOCCTCMACSWCMRCDOCDOCNSNABCOGCOKADOCOSCPACPPCPQICPCPTCPW
CAQCAQIDOCRICRSCRSCRTCRVCRWCRRFDODSSDSSCSICSOCSTCSVCRSSTCFDOCTMCTOFDOCWPIDODAPDASDICDSOCDODDSDEVDHRAABDPCDPRDSOCBBDTLDSSDTSDTLDVIEQIEDEEDICBBEEWEFPEIEEQIEITEMAEMM
EMPAABEOFNABAABEPSEQIEQIEQEEQIEQIEQIEQIEQIEQYERSESPESRESSETTDSOAABEWCEQIFAAFABFAMFASCDOFCIFCMFCNFDOFEJFITFMDFMHNONMISPFCFDOGADGAFGAMGILCADGFPFDOGOLGORDOMGZTGZTGZT
GZTAABHAMHAPHATHDIDSOCPTHEDHEJHELHERHFPHOFHPSHSQHRCPFCHEDFDOHSGHSPHSQHEDHEDCDOCDOIASDSCICDADOICPICSIDEIDSIEQCRWADOIIBADOADOAABMHOINGADOMMIINTIOSFDOICPISOIRHISOISO
ISSIYDJADJIRJIRJSOCPTLAMLBSFDOLDCLDDLEACADFDOFDOLOPLSIMHOMACMACMACMACADBCDOCDOMSCMATDSOMBMMCIMCIMCIMCIMCIFDOCDOMFEMGSMH2MBHMBHMBHMBHDSOMMIMMIMMIMMIMMIAABMILMIPDOM
MMAMMAMMAMMAMMAMLLMCMMCMMCMMCMMCMADOMMIMMIMMSCDOMAPMAPMAPMAPMAPMPSMMPMMPMMPMMPMMPMMPMSTMSCMTOMTQMUMNASCDONCONEONABFDOFDONIMNONADONSQOBMOCDADOOPIPOMDSCDPBCDOPANDSO
FDOHEDPBTPCLPCCPFCPCLPCOPCPPCWPCLCBBPDSPECAABPFCPFCPFCFDOPFNPGANABPMFPMTFDOPOCPOMFDOPOSFDOPPPFDOCSWCRWPPTPRIPRLPROPS5AABPCLAPSPSIADBCRWPSIPSMPSOPSPFBOPSTDSOPTGADO
PTTCDOCDOQOLQLQQOLFDOQSHRASREHREHRSHRISRMRFDORNTAABRSHRSORSHEQIRTPNONNONNONDSOSAFSAAFDOSARSASCDOSCDDSCFDOSCVSCLSCPSCQSCSDSCSCVADOADOSECSETCSWSHRSIPSITSKPIDOSLPDSO
SMRAABAABSOECDOSPASPCSPNSPSDSSCDOCRWDSSSSQSSSAABSTASTCEDBFDOSTOSTPADOAABADOFDOTATCDOTCDTCSADBTDMCRWNABTECTFBCDOADOFDOTIPTISTJTTLDTLDTMLFDOTOLTOMTONADOTPVTRNTROFDO
DSOADOTVPUCBFDOCSWFDOAABADOVATVCMVIPCDOFDOFDOVRTADOWCNWCSWEIAABWIFIDOEQICRWWKSFDOADOCADWRAWRAWVSYCAFDOFDOLSI
RPTGrpID AppCatIDLSI HRCPSC HRCYCA HRCFDO FDOHSG HRCPTG HRCBCL HRCPCL HRCMSC HRCCST HRCVRT HRCJSO HRCSAR HRCPSD HRCASD HRCCAT HRCCDI HRCNAS HRC16L 16LCPT CPTAPQ APQISO ISOPS5 PS5ESS ESSEQI HRCCDV CDVBRI HRCCLM HRCEQE HRCPRL HRCWEI HRCJES HRCDVI DVIEIT HRCWCN HRCPSO HRCHDI HRCCHI HRCIEQ HRCIRH IRHAIM AIMBGM BGMRSO HRCPFC HRCPSM HRCMLL HRCEOF HRCHFP HRCPCC HRCPOC HRCFMH HRCPFN HRCPCY PCY
FIT FITML3 ML3SSS SSSML4 ML4MA4 MA4DTV DTVPP3 PP3FAS FASEQ3 EQ3EPS EPSDTV DTVCCP CCP16L 16LBH2 BH2BH2 BH2MH2 MH2CA2 CA2MTQ MTQACZ ACZBH3 BH3BH4 BH4BH6 BH6CA4 CA4CA5 CA5CA6 CA6MA2 MA2BH2 BH2AU2 AU2HSQ HSQHSQ HSQMH3 MH3GAD GADHQQ HQQMH6 MH6BBH BBHMH4 MH4AU4 AU4AU5 AU5AU6 AU6KPT KPTPGA PGACSX CSXCTM CTMMP2 MP2UCD UCDWCS WCSDRE DRE16L 16L16L 16L16L 16L16L 16L16L 16L16L 16L16L 16L
MP4 MP4CSP CSP
SSE SSESSE SSEPCO PCOLOP LOPABP ABPSSE SSEEQV EQVWIL WILPSF PSFPEC PECESS ESSPSF PSFBS3 BS3MR8 MR8HEJ HEJWVS WVSDEV DEVPOM POMBEN BENCSC HRCNON NONCCH HRCCCM HRCCPP HRCEEW HRCAFV HRCCIE HRCEEC HRCBCP HRCIIB HRCHOF HRCTRO HRCVCM HRCVAT HRCDAP HRCEMM EMMANG HRCRAS HRCASV HRCLBS HRCCRT HRCASS HRCAAP HRCPSS HRCAYO HRCCRV HRCFEJ HRCPRO HRCDDS HRCPAD HRCCBT HRC
ABC HRCAAD HRCADB HRCPCP HRCYLS HRCTCS HRCICS HRCNIM HRCCSQ HRCPDX HRCEQS HRCADH HRCAHD HRCALD HRCMAC HRCPMT HRCPSG HRCPTT HRCRMR HRCTDA HRCAMP HRCANX HRCSCP HRCCLE HRCCAD HRCHEA HRCCMR HRCCRO HRCWIS HRCCRS HRCCSW HRCCTO HRCHRE HREPAG HRCDTL HRCAAS HRCDCR HRCLDC HRCOBM HRCSTM HRCTFB HRCUCB HRCEDE HRCHRC HRCSOE HRCEQY HRCFAC HRCGAR HRCGRT HRCCPS HRCICP HRCIPS HRCLDD HRCMAS HRC
PPT PPTIDE IDEINS HRCATC HRCOCD HRCSPC HRCSTC HRCTLD HRCTLP HRCTML HRCTVP HRCWRA HRCWRV HRCCAA HRCCAI HRCSTA HRCSPA HRCTON HRCMR2 MR2MM2 MM2ML2 ML2BS2 BS2SSP SSPEMA HRCCNS HRCTOL HRCNES HRCMMS HRCREH HRCLAM HRCRHC HRCIER HRCMTO HRCBS4 BS4PRI PRITOM HRCCDS HRCTDS HRCSSI HRCMR2 MR2ML2 ML2ML2 ML2DTS HRCISS HRCSPS HRCPPS HRCMUM MUMMIL MILEQV EQVDVI DVIHPS HRCRIA HRCSCB HRCSIP HRC
ML2 ML2ING INGMMP HRCCAE HRCPSP HRCSCD HRCSCT HRCIBC HRCNEO NEOEIE EIEDTR HRCGAF HRCPSH HRCCIS HRCCDE HRCSA4 HRCSAS HRCSET HRCMR2 MR2ML2 ML2ML2 ML2ML2 ML2SCL SCLCLO CLOSCV SCVML6 ML6COG COGMBM MBMQOL QOLPSI HRCQLQ HRCRTP HRCTIP HRCDAS HRCTDM HRCRSQ HRCWHA HRCJIR JIRHEL HRCFAM HRCCWP CWPWIF WIFPAN HRCRSH HRCTAT HRCIMP HRCCNT HRCAGG HRCPGC HRCEON AAGML2 ML2MH5 MH5PST PSTPRI PRI
TEB HRCCHP HRCDOP HRCEDM HRCCLT HRCPDR HRCMIH HRCEOB HRCCGI HRCCAM HRCEOO HRCUPT HRCHAD HRCPER HRCCM2 CM2SSQ SSQSTO STOBS3 BS3CBS HRCSNG HRCSST HRCTAB HRCEWA HRCPSB HRCSMT HRCAMN HRCCRI HRCESR HRCSHR CMPCSI HRCPPO CMPML2 ML2MA3 MA3INT INTPC2 PC2VIP VIPCAB CABUNK CMPCMP CMPML2 ML2ML2 ML2MP3 MP3CAW CAWAMF AMFFMD FMDQSH QSHSBE SBESIT SITTPV TPVRRA RRAAIM AIMBHH BHHPOS POSGAM GAM
CPW CPWAPS APSCCR CCRMR3 MR3MM3 MM3MM4 MM4CCR CCRFRM FRMMR8 MR8CCR CCRPCD PCDMR4 MR4JAD JAD16B 16BEQ5 EQ5MR4 MR4PFF PFFPFF PFFPF4 PF4HRD HRDPCD PCDBIR BIRSPN SPNCRW CRWP02 P02HRD HRDJIR JIRCAW CAW
longDes
<p>The instruments of choice for the clinical assessment of psychopathy are the Hare PCL–R™ 2nd Ed. and the scre<p>Apply the principles of Rational Emotive Behavior Therapy to the personal and worldwide problexxx<p>The Homework Survival Guide provides pointers for organizing homework sessions, breaking assi<p>Stock your office with these brochures to educate parents on high-risk adolescent behaviors. Pare<p>This videotape, presented by the DSM-IV™ editor, is an update of the major features of DSM-IV™.
<p>This field-tested manual includes reviews of competency measures, ethical issues, case examples<p>With complex concepts conveyed clearly and illustrated with a wealth of personal anecdotes, thi<p>Sexual abuse is an epidemic and a serious problem. This revised edition provides a comprehensi<p>The Spousal Assault Risk Assessment Guide (SARA) is a quality-control checklist that determines th<p>In recent years, societal concerns over the dramatic rise in juvenile crime—especially violent crime—has reaff
<p>The client-completed Category Test Computer Program 6.0 (CAT) is a completely revised version of<p>The CDI self-report, symptom-oriented scale has a first-grade reading level and is designed for <p>This 3rd edition incorporates significant new insights and research findings about brain-behavior relationsh
<p>Top writers and researchers in criminal psycopathy discuss threats, pursuit characteristics, psych
<p>Based on over 20 years of research by Dr. Reuven Bar-On and tested on over 85,000 individuals wo
<p>The BRIEF™ assessment was designed to assess executive functioning in a youth’s home and school environments. I<p>The CALM Program teaches male participants to monitor and understand their emotions in order to <p>With real-life anecdotes of EI factors interacting at work, home, and in social situations, this <p>This volume illustrates the importance of emotional intelligence for life success. The authors arg<p>The author of the international bestseller Emotional Intelligence demonstrates why emotional inte
<p>This comprehensive work is a guide to the latest in treatment and prevention of domestic violence, focusing
<p>One of the world’s experts in psychopathy provides his answers to many questions: Are psychop<p>The authors, with other leaders in the field of psychiatry, provide a collection of research tha<p>The HDI assessment is designed to accurately and efficiently assess, monitor, and document mental<p>Current conceptions relating psychological variables to health recognize the key role of coping p<p>The IEQ-MP assessment uses four separate questionnaires to assess a patient’s medical experience fr<p>This advanced clinical manual balances the practical concerns of test interpretation and neuropsy<p>Valuable details on the MMPI-2 restandardization and its content and supplementary scales. It details interpr<p>A basic introduction to the MMPI-2, this book is generously illustrated with case material and is<p>The R–SOPAC self-report is a thorough symptom survey in which clients rate a broad range of phys
<p>Of the personality trait disorders, the antisocial personality is one of the most troubling, paradox<p>This book provides forensic psychologists and clinicians with interviewing techniques/strategies;<p>With interpretive and administrative guidelines for widely used assessment tools including ASPE<p>This 2nd Edition is an essential resource for professionals who want to develop or enhance their <p>With lecture notes, readings, and research for an advanced undergraduate psychology course in cri<p>With sociological, genetic, neurochemical, brain-imaging, and psychophysiological evidence, Rai<p>This book illustrates the principles of conducting forensic mental health assessment and explore<p>This book outlines several important issues for clinical neuropsychologists involved in forensic pr
<h1>Training Videos</h1><p>The training video series presents a nontechnical approach to using the LSI–R™ inventory. An ideal tool for training correctional staff, it covers the theoretical rationale, two decades of research, and scoring procedures. Practice LSI–R™ scoring procedures by watching an LSI–R™ interview and completing the LSI–R™ inventory before a rating explanation is given. Volume I: Theoretical rationale, Volume II: Summary of research and evidence, Volume III: Interview and scoring demonstration.</p>
<li>Noncriminal nonpsychiatric</li> </ul><p>The PCL:SV assessment is a cost-effective way to determine whether specific cutoff scores warrant administration of the full PCL-R to increase reliability and ensure validity of scores. The PCL:SV assessment consists of 12 items yielding a total score and 2 factor scores. These 2 factor scores are analogous to the 2 factors on Hare PCL-R.</p><p>The PCL:SV Manual does not replace the Hare PCL-R Manual, but supplements it. The PCL:SV tool should not be used unless you are familiar with the theory and research documented in the complete Hare PCL-R Manual.</p>
</p>
<p>The Single Administration report allows you to select measures for inclusion. The Multi-Administration report allows you to compare the results of up to 4 administrations for the same client—-an ideal tool for monitoring treatment efficacy. (Sample reports are available at www.mhs.com.)</p><p>The CPT II software is an unlimited-use program; therefore, users can administer, score, and generate any report an unlimited number of times. However, if the program is installed on a network, the number of users of the program at one time is limited to the number of installations purchased. (Contact MHS for multiple installations pricing.) The Preview Version allows you to fully access the program 3 times to try it out. It also includes access to the new K-CPT software for 4 to 5 years olds. The CPT II installation comes with free client-management software.</p><li>Coping/Managing Difficulty Scale</li></ul><p>The ISO-30 interpretive report provides objective, easy-to-read documentation of suicidal risk and outlines suggestions for patient management based on risk classification.</p>
<p>The JBC QuikEntry feature enables you to quickly obtain results after entering an individual’s responses from a paper-and-pencil administration. The Windows™ version of JBC comes with a complimentary copy of PsychManager Lite™ or Correction Manager™. (Sample reports are available at www.mhs.com.)</p>
<h1>Emotional Intelligence</h1> <p><i>Daniel Goleman, Ph.D.</i></p> <p>On the bestseller list for over 2 years, this fascinating and persuasive book argues that the current narrow view of human intelligence ignores a crucial range of abilities that influence success in life</p><h1>The Handbook of Emotional Intelligence</h1> <p><i>Edited by Reuven Bar-On, Ph.D. & James D. A. Parker, Ph.D.</i></p> <p>A stellar panel of academics, researchers, and practitioners present conceptual models, evaluate the best methods of assessment, and offer guidelines for applying EI principles in many settings. Learn how social, emotional, and practical intelligence help us navigate our social world.</p>
<p>The QuikScore™ Form allows easy scoring and profiling, and an optional state-of-the-art scoring template booklet can be used to make scoring even faster. The QuikScore™ Form can be used with English or French (Canadian) test booklets which are sold separately.</p><h1>16PF5: Overcoming Obstacles to Interpretation</h1><p>This book provides insight into the depth and comprehensiveness of the 16PF Fifth Edition. It combines detailed, practical advice with relevant examples and suggestions based on user's experiences. Focusing on complex profiles, the author covers each of the key stages of assessment and explains how to obtain a clear understanding of the data, tackle confusing score combinations, provide effective feedback, and successfully integrate results with data from additional sources.</p><h1>16PF® Interpretation in Clinical Practice: A Guide to the Fifth Edition</h1><p>This book combines individual factor descriptions, common factor combinations, numerous representative case illustrations, and empirical research. It emphasizes how the 16PF® assessment can enhance clinical decision-making to save valuable clinician time.</p>
<p>The FTT assessment is a clinical assessment tool that uses projection techniques to assess childre
<p>This battery of eight subtests measures different but interrelated visual-perceptual and visual-motor abilities. E<p>The Pain Patient Profile™ (P-3™) test is a brief self-report screening inventory designed to measure psychologic<p>Focusing on the MCMI and the MACI assessments, this book begins with an overview of the Millon inventories and
<p>The EPS self-report assesses whether an individual has the personality attributes to succeed as a senior manag<p>This battery of eight subtests measures different but interrelated visual-perceptual and visual-motor abilities. E<p>The 16PF® Fifth Edition adds a number of enhancements to this widely used personality scale. The language has
<p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that <p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that
<p>The MICROTEST Q™ Assessment System Software will accurately and efficiently score, report, and store informa
<p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that <p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that <p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that
<p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that
<p>The GADS scale is designed to evaluate children with unique behavioural problems who may have Asperger Disord
<p>The K-CPT program follows the same basic paradigm as the popular Conners' CPT II, but with some ke<p>This book teaches parents how to work with a child's talents and difficulties to help him/her interact more fully
<p>The Comprehensive Trail-Making Test (CTMT) is a new assessment based on time-tested techniques. The CTMT assess
asdfasdfas
<p>The normative sample consists of 805 adolescent males and 815 adolescent females from eight communities in the U.S. and one in Canada. The sites were chosen to maximize the probability of obtaining a balanced sample of subjects according to geographic region, rural/urban residence, and ethnic background. New validity scales were developed to refine the clinician’s assessment of test-taking attitudes.</p><p>Connecting Clinician and Client is a 1-hour video with interpretations of SASSI results followed by feedback demonstrations for both adult and adolescent cases.</p><p>Three profiles are provided. T-scores are plotted, and raw and T-scores are listed for Validity, Clinical, and Content Scales. A supplementary score report presents raw scores, T-scores and response percentage for the Harris-Lingoes Subscales and the Si Subscales.</p><p>This report provides an in-depth analysis of results, including the patient’s personality patterns, issues of concern, and potential clinical symptoms. Diagnostic suggestions are made using both DSM-III-R and DSM-IV codes. Noteworthy responses help provide clues for follow-up interviews based on item responses. Recommended treatment strategies are also included.</p>
<p>With the EQ–360™ Online, you can assess clients around the world without the costly and cumbersome task of shipping response sheets and item booklets to them. Simply phone MHS to register. Your clients will then be able to login to a secure website and complete their assessment entirely online. Responses are emailed back to MHS where they are scored to produce complete, cost-effective reports. Use of the EQ–360™ Internet research version requires Microsoft Internet Explorer 5 or Netscape Navigator 4.7.</p>
<p>Used in medical and counselling settings by psychologists and psychiatrists working with patients in hospitals, clinics, and private practices, the MBHI self-report is particularly useful to evaluate and screen physically ill, injured, or surgical patients to help identify psychosomatic complications or help predict response to illness or treatment; to help assess stress-related worker’s compenstation claims; to develop effective rehabilitation programs for claims related to physical injuries; and to evaluate and screen individuals in specialty clinics/programs (e.g., pain, stress, headache) with problems that may stem from a psychological disorder or unidentified stressor.</p><p>The <b>Vocational Version</b> of the Career Assessment Inventory™ is an interest inventory used to identify occupational interests of individuals who plan to enter careers immediately after high school or community college and who are pursuing occupations that require less than two years of post-secondary education. Used by counsellors, psychologists, and personnel professionals for career guidance, adult career development, and human resource development, it helps students focus on the patterns of interest that are important in making educational and occupational choices; and helps clients in vocational rehabilitation settings to explore career options.</p>
<p>The <b>Vocational Version</b> of the Career Assessment Inventory™ is an interest inventory used to identify occupational interests of individuals who plan to enter careers immediately after high school or community college and who are pursuing occupations that require less than two years of post-secondary education. Used by counsellors, psychologists, and personnel professionals for career guidance, adult career development, and human resource development, it helps students focus on the patterns of interest that are important in making educational and occupational choices; and helps clients in vocational rehabilitation settings to explore career options.</p>
<p>The <b>Vocational Version</b> of the Career Assessment Inventory™ is an interest inventory used to identify occupational interests of individuals who plan to enter careers immediately after high school or community college and who are pursuing occupations that require less than two years of post-secondary education. Used by counsellors, psychologists, and personnel professionals for career guidance, adult career development, and human resource development, it helps students focus on the patterns of interest that are important in making educational and occupational choices; and helps clients in vocational rehabilitation settings to explore career options.</p><p>The MACI items comprise 27 scales within three categories. It also contains modifying indices that help identify test-taking attitudes as well as confused or random responding.</p>
<p>The self-report format enables clinicians to collect an individual’s perceptions about his/her use of alcohol and compare them with the interviewer’s perceptions and those of family members and other individuals.</p><li>Energy/Fatigue</li> </ul><li>Energy/Fatigue</li> </ul><p>Used in medical and counselling settings by psychologists and psychiatrists working with patients in hospitals, clinics, and private practices, MBHI is particularly useful to evaluate and screen physically ill, injured, or surgical patients to help identify psychosomatic complications or help predict response to illness or treatment; to help assess stress-related worker’s compenstation claims; to develop effective rehabilitation programs for claims related to physical injuries; and to evaluate and screen individuals in specialty clinics/programs (e.g., pain, stress, headache) with problems that may stem from a psychological disorder or unidentified stressor.</p>
<li>Energy/Fatigue</li> </ul><p>Used in medical and counselling settings by psychologists and psychiatrists working with patients in hospitals, clinics, and private practices, MBHI is particularly useful to evaluate and screen physically ill, injured, or surgical patients to help identify psychosomatic complications or help predict response to illness or treatment; to help assess stress-related worker’s compenstation claims; to develop effective rehabilitation programs for claims related to physical injuries; and to evaluate and screen individuals in specialty clinics/programs (e.g., pain, stress, headache) with problems that may stem from a psychological disorder or unidentified stressor.</p></p>The BBHI 2 assessment is ideal for treatment monitoring and treatment outcomes measurement. This instrument offers healthcare professionals a quick and comprehensive picture of a patient’s situation.</p><p>Used in medical and counselling settings by psychologists and psychiatrists working with patients in hospitals, clinics, and private practices, MBHI is particularly useful to evaluate and screen physically ill, injured, or surgical patients to help identify psychosomatic complications or help predict response to illness or treatment; to help assess stress-related worker’s compenstation claims; to develop effective rehabilitation programs for claims related to physical injuries; and to evaluate and screen individuals in specialty clinics/programs (e.g., pain, stress, headache) with problems that may stem from a psychological disorder or unidentified stressor.</p><p>The self-report format enables clinicians to collect an individual’s perceptions about his/her use of alcohol and compare them with the interviewer’s perceptions and those of family members and other individuals.</p>
<p>The self-report format enables clinicians to collect an individual’s perceptions about his/her use of alcohol and compare them with the interviewer’s perceptions and those of family members and other individuals.</p>
<p>The MAPI Clinical Interpretive report provides a narrative interpretation of an adolescent’s personality and behavioural patterns and includes a profile of base rate scores for all MAPI scales.</p>
<h1>Wisconsin Card Sorting Test: Computer Version 3 for Windows® (WCST:CV3) Research Edition</h1><p>WCST:CV3 is an unlimited-use client-completed Windows program that assists with administering and scoring the WCST test. Administer the test on the screen or enter the client's item responses from a previous WCST administration. If you enter responses from a previous WCST administration, the data evtry screen presents only the possible, valid responses to each card to prevent data-entry errors. The software records any other dimension matches. For administration on the screen, a set of coloured keytops representing the 4 WCST stimulus cards can be attached to your keyboard, or the respondents can point and click the mouse to indicate the appropriate choice.</p><p>The software automatically scores the responses and then generates a 4-page report that may be printed or saved in Rich Text Format. The report includes</p> <ul><li>Demographics and test performance variables</li><li>WCST raw scores and demographically corrected standard scores (T-scores, percentile scores, and percentile ranges) for major WCST variables for clients aged 6 to 89</li><li>Scales for individuals aged 20 to 89 are compared to normative scores derived from an adult sample matched by age to 1995 U.S. Census projections</li></ul> <p><h1>Wisconsin Card Sorting Test-64 Card Version (WCST-64)</h1></p> <p>The WCST-64 version uses only the first 64 WCST cards so the administration time is shorter, yet the task requirements of the standard version are retained. The WCST-64 assessment also eliminates variability in the number of cards administerd to facilitate straightforward comparisons of individual test results with normative and validity data.</p><p><h1>WCST-64 Computer Version Scoring Program for Windows® (WCST-64:SP) Research Edition</h1></p><p>This unlimited-use Windows® program provides all the scoring and reporting features of the full WCST-64:CV; however, it does not administer the WCST-64 cards on the screen.</p><h1>DSM-IV-TR™ Case Book</h1><p>Through clinical vignettes, this book facilitates the transition from the concepts and terminology of DSM-IV-TR™ to actual clinical situations. It has been updated to include information from DSM-IV-TR™.</p><p><b>2002, 624 pages</b></p>
<p>Copublished with the American Psychiatric Association. With the SCID II PQ for Windan unlimited num
<p>This text is used as an introduction to corrections and justice work. With a focus on Community Corrections, i<p>This comprehensive 2nd edition outlines a proven strategy for combating depression. Moderately
<p>This parent-completed screening and diagnostic instrument was developed on the basis that the total stress a pare<p>This revised work provides the most thorough discussion of legal, research, and clinical issues f<p>Interpretive strategies for the MMPI-2 and MMPI-A assessments. Includes recent research on ethnic/cultural backg<p>This parent-completed screening and diagnostic instrument was developed on the basis that the total stress a pare
<p>Head-injury clients will appreciate these 6 pamphlets summarizing symptoms and interventions. The pamphlets su
<p>This expert in the field of custody evaluation warns against “the negative incident model.” Inste<p>This project by the FBI’s National Center for the Analysis of Violent Crime won the 1994 Award for<p>Required reading for psychiatrists and psychologists who provide expert testimony, this three-vo<p>This practical and entertaining description of forensic court psychology reveals the typical ploys <p>This 2nd edition includes empirically driven approaches to the clinical evaluation of violence i<p>Mental health and legal professionals involved in insanity cases need a solid foundation in curr<p>Read what lawyers, social workers, and psychologists say about the roles and limits of expert testimony in<p>This is a detailed overview of psychological knowledge and its forensic applications and implicat<p>A must-have for police training/practice, therapists, lawyers, psychologists, and psychiatrists <p>An up-to-date review of current knowledge and best practice in the rehabilitation and treatment <p>With administrative and legal issues in mind, this book addresses therapeutic work with inpatien<p>With details necessary to understand the vexing behavior of mentally disordered offenders, this<p>Most known violence occurs among those who are emotionally or technically attached. Diverse case<p>Expert guidance for using RET to help your clients overcome anger, this book includes case vig<p>This book provides professionals with easy-to-follow advice and guidance on how to administer, score, and inte<p>This practice-oriented volume reviews many of the facts and theories of anger; provides a basic <p>A rich and comprehensive account of the inner workings of male and female aggressive and psych<p>A variety of edited articles from 70+ professional journals spanning the past 15 years are summa<p>No matter where we live, our children go to school with troubled boys capable of getting guns a<p>Ideal for those who testify using psychological assessment and those who challenge inadequate a<p>This 3rd edition incorporates what has been learned about the revised MMPI-2 in the years since <p>This 2nd edition provides an overview of the author’s Structural Summary approach to MMPI-A int<p>Top writers and researchers in criminal psychopathology discuss threats, pursuit characteristics, psychiatric d<p>This book discusses the utility and limitations of psychological assessments in the juvenile just<p>Integrating research, ethics, assessment methodology, and recent case law, this is a practical gu<p>Anchored both in state-of-the-art developmental research and in clinical experience, this is an <p>Presenting criteria for differentiating between true and false sex-abuse accusations, this book g<p>Updated for today’s health care climate, this 2nd edition uses a 12-step concept, integrating sub<p>This three-volume audiotaped series is an excellent way to further your knowledge of DSM-IV™ <p>While sexual offenders typically have a personal history of abuse, most of them would prefer to li
<p>The MAPI Clinical Interpretive report provides a narrative interpretation of an adolescent’s personality and behavioural patterns and includes a profile of base rate scores for all MAPI scales.</p>
<p>The report options include the Summary of Responses report that paraphrases each question asked and gives the client’s responses and the Diagnostic report, an adaptation of SSPQ’s Concise and Long reports. This report lists diagnoses that are likely, unlikely, and contradictory. Results from the SSPQ-X software can be imported into DTREE: The DSM-IV™ Expert.</p><p>Users of this unlimited-use program can administer, score, and generate any of the available reports an unlimited number of times. However, if the program is installed on a network, the number of users of the program at one time is limited to the number of “installations” that have been purchased (call for multiple installations pricing). The preview version includes the Software Manual and allows you to assess and produce reports for three clients. Both the preview and full versions of the program run on PsychManager™ or PsychManager Lite™, which comes free with the SSPQ-X software.</p><p>The report options include the Summary of Responses report that paraphrases each question asked and gives the client’s responses and the Diagnostic report, an adaptation of SSPQ’s Concise and Long reports. This report lists diagnoses that are likely, unlikely, and contradictory. Results from the SSPQ-X software can be imported into DTREE: The DSM-IV™ Expert.</p><p>Users of this unlimited-use program can administer, score, and generate any of the available reports an unlimited number of times. However, if the program is installed on a network, the number of users of the program at one time is limited to the number of “installations” that have been purchased (call for multiple installations pricing). The preview version includes the Software Manual and allows you to assess and produce reports for three clients. Both the preview and full versions of the program run on PsychManager™ or PsychManager Lite™, which comes free with the SSPQ-X software.</p>
<p>The report options include the Summary of Responses report that paraphrases each question asked and gives the client’s responses and the Diagnostic report, an adaptation of SSPQ’s Concise and Long reports. This report lists diagnoses that are likely, unlikely, and contradictory. Results from the SSPQ-X software can be imported into DTREE: The DSM-IV™ Expert.</p><p>Users of this unlimited-use program can administer, score, and generate any of the available reports an unlimited number of times. However, if the program is installed on a network, the number of users of the program at one time is limited to the number of “installations” that have been purchased (call for multiple installations pricing). The preview version includes the Software Manual and allows you to assess and produce reports for three clients. Both the preview and full versions of the program run on PsychManager™ or PsychManager Lite™, which comes free with the SSPQ-X software.</p><li>Resolving conflict at home and at work</li></ul>
The Interpretive report is based on age-appropriate nonpatient norm groups. Adolescent norms are used for 13 to 17 year olds, and nonpatient adult norms are used for subjects over 17.</p><p>This report is a tailored forensic report designed to help you make the interpretive adjustments necessary in forensic applications of the test. These reports, authored by MMPI-2 expert Dr. James Butcher, have been normed on thousands of cases from various forensic settings. They provide interpretive guidance and support decisions in child custody, personal injury, pre-trial criminal, general corrections, and competency/commitment settings. </p>
<P>A large normative database was developed at the nonclinical "See and Tell - An Interactive Photographic Exhibit" in 1978. Walker Visuals have since been refined through dialog with psychiatrists, psychologists, and social workers. The manual provides clinical case examples and normative responses of several hundred respondents. Components include optional QuikScore™ Forms, which allow direct comparison to normative responses and a Self-Assessment form to monitor change over time and capture clinically relevant information.</p>
<p>The Preview includes the Software Manual and allows you to interview and produce reports for three clients. The CAS-CV software comes with PsychManager Lite™, a free client management program.</p>
<h1>Adaptive Behavior Scale–School Edition (AAMR ABS–S:2) Second Edition</h1><p>The ABS-S:2 assess<p>This book provides child healthcare professionals and educators with a comprehensive set of e<p>This 2nd edition incorporates recent findings on the nature, diagnosis, assessment, and treatme<p>This is a must-have for mental health professionals who give testimony involving the MMPI/MMPI-2. <p>The Youth Level of Service/Case Management Inventory (YLS/CMI) helps probation officers, youth wor<p>This videotape describes the roles of professional and child witnesses in sexual abuse cases. The manual provi<p>Learn how to gauge children’s ability to report events accurately, which questions to ask/avoid, how to use ana<p>The NIMS Observational Checklist (NOC) is a workbook for organizing and recording observations o<p>This self-report examines conventional and deviant sexual behaviors ranging from common sexual di<p>The Paulhus Deception Scales (PDS), formerly known as the Balanced Inventory of Desirable Respo<p>The BarOn EQ-i:S™ assessment is designed to measure emotional intelligence when a detailed asses<p>The acclaimed author of Conners’ Rating Scales integrates ADHD assessment, research, and treatm<p>In this audiotaped ADHD workshop, Dr. Conners (author of the Conners’ scales and clinician and researcher
<p>This 2nd edition includes a proven multidisciplinary approach to ADHD diagnosis and treatment. <p>This coauthor of CASS provides parent training information for professionals to help parents of<p>Busy teachers and parents will appreciate these tips and powerful strategies for improving atten<p> Provide this resource where teachers congregate—they will learn to recognize behavior disorders, <p>In this CINDY award-winning video, leading specialists in childhood behavioral disorders are joine<p>Filled with strategies for parents of ADHD children, this edition includes steps to manage ADHD <p>This convenient self-report inventory is an ideal way to evaluate underachieving or unmotivated s<p>Experts in the field of anxiety share their theoretical perspectives on research and clinical pra<p>Drawing from clinical experience and extensive literature reviews, the authors discuss the impact of the dev<p>Used by psychiatrists, pediatricians, and other mental health professionals for over 20 years, th<p>This coaching program for adult coaches helps attention-deficient students enhance their time-mana
<p>An expert-endorsed treatment standard, the parent-completed CMDQ was specially designed to save
<p>The clinician-entered WISC-III™ Report 3.0 provides an automated interpretation of Wechsler Intell<p>The leading choice of experts, the Conners’ Rating Scales–Revised (CRS–R) are the result of 30 <p>The CRS–R software presents the CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, and CASS:S items on your co<p>The CTONI assessment is an unbiased measure of nonverbal reasoning abilities in individuals for
<p>This book teaches parents how to work with a child’s talents and difficulties to help him/her interact more fully<h1>DTLA-Primary Second Edition (DTLA-P:2)</h1><p>The DTLA-P:2 assessment is particularly useful wi<p>This book reviews a range of empirically supported approaches to dealing with alcohol and other <p>The DICA-IV program is a software version of the Diagnostic Interview for Children and Adolescent<p>The authors identify the foundational, symbolic, and conceptual building blocks of learning suc<p>These methods for managing oppositional-defiant students can help prevent heated confrontations<p>This well-researched guide is filled with practical advice and good ideas on how to manage threa<p>These two manuals provide school psychologists, social workers, educators, counselors, and other<p>This popular and comprehensive book provides strategies for evaluating and managing children wi<p>Today, the perspective of Salovey and Mayer has motivated scientists, educators, parents, and o<p>All parents want their children to be confident, successful, and happy. Achieving these goals is based just as <p>A self-help program for managing anxiety, anger, and depression, this book is both entertaining and educational
<p>The GARS assessment helps identify, diagnose, and estimate the severity of autism. The items are <p>The widely used GORT-3 has been revised and renormed. The GORT–4 assessment provides an object<p>This instructional program for children from in kindergarten and primary grades is both educational<p>This instructional program for preschool-aged children is both educational and rehabilitative. Supp<p>This instructional program for children in intermediate elementary grades is both educational and r<p>The LDDI scale is a reliable and valid norm-referenced inventory composed of six independent scales<p>The MASC assessment is an empirically derived instrument that provides a reliable and valid asses
Softcover, 1993, 246 pages</b></p>
</p><p>Save $8.00 on this product when you purchase CPT II and KCPT</p>
<h1>Conners' Adult ADHD History Form</h1><p>Send the Conners' Adult ADHD History Form to your clients prior to their first visit or have them complete it at their initial consultation. It covers historical information that is of clinical importance in assessing an adult for ADHD and lets you evaluate your client's handwritten responses to questions about current problems, employment, family, past school history, relevant medical information, medications, and other areas.</p>
<h1>Web Administration</h1><p>Assess clients anywhere in the world at any time. Your clients access a secure website and complete the FAB-C Online. Using the MHS Online Scoring Organizer, you can check the status of your clients' administrations, then send them to MHS to be scored. Reports are promptly returned to you.</p>
<p>Basic psychological processing disorders involve difficulty understanding or using language and may<p>The IDEAS test is a short, self-scored interest inventory designed to be an introduction to career exploration
<p>With problem-focused chapters, literature reviews, and guidelines with case studies, this text helps professi<p>A systematic guide to assessment, treatment planning, and skill-based cognitive-behavioral intervention for t<p>The SPAI–C assessment is a 26-item empirically derived self-report inventory. The SPAI–C self-report helps clin<p>The State-Trait Anxiety Inventory for Children (STAIC)—the “How I Feel” questionnaire—contains t<p>Proven to be neutral to race and gender, and one of the most popular tests of spoken language u<p>Used to identify children with language disorders and to isolate particular types of disorders,
<p>Wide Range Assessment of Visual Motor Ability (WRAVMA) provides a Visual-Motor Integration Comp
<p>The CAADID structured interview aids the process of diagnosing Adult ADHD. The interview is divided
<p>The TONI–3 assessment is a major revision of the popular Test of Nonverbal Intelligence. It is a nor
<p> This interpretive aid provides test score corrections based on age, gender, and education for 54 tests includ<p>Although similar to the original Tower of London (Shallice, 1982) developed for assessing adult cl<p>This series of 10 pamphlets is designed to give feedback on neuropsychological assessment results
<p>The Rehabilitation Checklist (RCL) will help you to accurately determine the needs of clients recover
<p>This textbook integreates structural, thematic, behavioral, and sequence analysis into systematic guidelines fo
<p>Although many self-esteem and self-concept assessment products are helpful in measuring an individ
<p>This manual provides a step-by-step procedure, with case examples, for using the MMPI-2 assessment as a therap<h1>The Millon Clinical Inventories: Clinical and Personality Assessment</h1><p>This comprehensive text examines t
<p>The clinician-completed RIAP4 Plus™ for Windows® assists the clinical psychologist in scoring and <p>Ideal training tapes for detecting dissociative disorders using SCID-D. Guidelines and examples i<p>This screening and diagnostic instrument identifies stressful areas in parent/adolescent interactio
The Examiner’s Manual reports extensively on the standardization, reliability, and validity of the TOMAL assessment. It also presents information on scoring and interpreting the profiles of subtests as well as detailing methods for contrasting the various composite scores.</p>The TVPS (n-m):R and TVPS (n-m)UL-R assessments are quick and easy to administer, and take only 3 to 5 minutes to score. Test results are reported as perceptual ages, standard scores, scaled scores, percentiles and stanines for each of the seven subtests, along with perceptual quotients, percentiles, and median perceptual ages for the combined scores of all seven subsets. The total test results have been converted to a perceptual quotient and percentile rank.</p><p>The TVPS (n-m):R and TVPS (n-m) UL-R assessments are designed for use by psychologists, learning specialists, optometrists, occupational therapists, remedial specialists, speech and language pathologists, educators, and other professionals.</p><p>The WRAT-Expanded assessment measures</p><ul>Reading Comprehension</li> <li>Mathematics</li> <li>Nonverbal Reasoning (available on Form G only)</li></ul>
<p>The CAARS V.5 for Windows® software combines the reliability and validity of the CAARS paper-and-pencil forms with the automatic scoring and detail of computer-generated Profile and Interpretive Reports. Each format (self-report or observer) is available in three versions: long, short, and screening. </p>
<p>Administer the STAI assessment on your computer. The results are displayed in a report which is generated immediately on completion. STAI software comes with a Getting Started Guide and PsychManager Lite™. </p><p>The SPAI assessment helps distinguish those who may have difficulty in work settings requiring high levels of social interaction (e.g., sales positions) and social performance (e.g., speeches). In clinical settings, it can help monitor treatment change and detect those who may suffer from maladaptive social anxiety. </p>
<p>The MMPI-2 Hand-Scoring Kit (includes MMPI-2 Test Manual, MMPI-2 Test Booklets (1 Hardcover or 10 Softcover), 50 Hand-Scoring Answer Sheets, 50 Validity and Clinical Scales Profile Forms, 50 Content Scales Profile Forms, 50 Content Component Scales Profile Forms, 50 Supplementary Scales Profile Forms, Basic Scales Answer Keys, Content Scales Answer Keys, Content Component Scales Answer Keys, and Supplementary Scales Answer Keys)</p><p>Twenty-four scales are included in the MCMI-III™: 14 personality pattern scales that co-ordinate with DSM-IV™ Axis II disorders, and 10 clinical syndrome scales related to DSM-IV™ Axis I disorders. In addition, three modifying indices and a validity index detect careless, confused, or random responding.</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>The BSI–18 score also provides a Global Severity Index (GSI), which gives a quantitative estimate of a respondent’s current level or depth of psychological dysphoria. The GSI summarizes the overall level of psychological distress to help measure the outcome of a treatment program based on reduced symptom severity.</p><p>With automatic branching, questions are skipped when symptoms are not endorsed. Three report options are included: Complete Summary of Responses, Concise Summary of Possible Diagnoses, and Long Summary of Diagnoses. SSPQ reports can be imported into a word processing program to provide documentation for billing, managed care, or to be integrated with forensic reports, peer reviews, consultations, and clinical records.</p> <h1>SCID Screen Patient Questionnaire–Extended (SSPQ–X) for Windows®</h1><p>Customer requests shaped the development of the SSPQ-X software. Practitioners wanted an efficient vehicle for collecting detailed SCID-related information (with more detailed information than that provided by the SSPQ assessment), and they wanted to reduce the number of false positives. The SSPQ-X assessment contains 589 questions and has a more elaborate branching algorithm than the SSPQ program. The same major areas of Axis I are covered as with the SSPQ.</p> <p>The report options include the Summary of Responses report that paraphrases each question asked and gives the client’s responses and the Diagnostic report, an adaptation of SSPQ’s Concise and Long reports. This report lists diagnoses that are likely, unlikely, and contradictory. Results from the SSPQ-X software can be imported into DTREE: The DSM-IV™ Expert.</p><p>Users of this unlimited-use program can administer, score, and generate any of the available reports an unlimited number of times. However, if the program is installed on a network, the number of users of the program at one time is limited to the number of “installations” that have been purchased (call for multiple installations pricing). The preview version includes the Software Manual and allows you to assess and produce reports for three clients. Both the preview and full versions of the program run on PsychManager™ or PsychManager Lite™, which comes free with the SSPQ-X software.</p><h1>SCID II Patient Questionnaire (SCID II PQ) for Windows</h1><p>Copublished with the American Psychiatric Association. With the SCID II PQ for Windows®, clients can respond to the personality-related questions on your computer screen, or you can input clients’ responses from the paper-and-pencil questionnaire. Use of the SCID II PQ results before a CAS II ES administration enables you to focus on problems specifically identified by the client. The SCID II PQ covers the following DSM-IV™ Axis II areas:</p><br><ul> <li>Paranoid, Schizoid, and Schizotypal Personality Disorders </li> <li>Antisocial, Borderline, Histrionic, and Narcissistic Personality Disorder </li> <li>Avoidant, Dependent, Obsessive-Compulsive, and Personality Disorders Not Otherwise Specified </li> <li>Passive-Aggressive (Negativistic) and Depressive Disorders </li></ul> <p>Two types of reports can be generated: a Dimensional Score (Summary of Responses) Report and a Question-by-Question Report organized according to specific disorders.</p> <p>The SCID II PQ software comes with PsychManager Lite™, a free client management program. You can administer and produce reports an unlimited number of times; however, if the SCID II PQ software is installed on a network, the number of users at one time is limited to the number of “installations” purchased. (Contact MHS for multiple installations pricing.)</p><p>Although EMAS-SAS can be used alone, administering it along with EMAS ensures evaluation of six facets of trait anxiety: social evaluation, physical danger, ambiguous situation, daily routines, separation, and self-disclosure (to family and to friends). EMAS-SAS is Handscored using a scoring template. </p>
<p>The MMSE tool is one of the most widely used clinical instruments for detecting and assessing the severity of cognitive impairment and monitoring cognitive changes over time. It requires minimal training to administer. Its brief administration time makes it ideal for both routine and repeated assessment of cognitive function.</p>
<p>Patient profiles and a variety of other tables and graphs (eg., trial-by-trial, raw scores, cumulative percentiles) can be generated, printed, or saved as RTF files (sample reports are available at www.mhs.com.) The LAMB Score software comes with free client management software.</p><p>The philosophical approach of the material is to support active rehabilitation through understanding, removal of fears, healthy lifestyle management, and coping skills development. The coping approach conveys the notion of living as active and as meaningful a lifestyle as possible, despite ongoing symptoms. Written in an easy-to-read, nontechnical style, the leaflets supplement interdisciplinary or psychological treatment.</p><p>Complete the program checklist during or following your evaluation, then enter evaluation results into the program. Generate a narrative report that concisely and professionally organizes your evaluation findings. Your report may be printed or saved as a text file for use with most word processing programs. </p> <p>The IER program operates within the Clinical Report Writer program, which comes free with your purchase of this and any other product in the CRW family. This handy program generates reports that allow you to evaluate, record, and interpret a wide range of patient problems. CRW runs on Windows® 3.11, Windows® 95, and Windows® 98. </p>
<p>The Profile report presents raw scores and normalized T-scores for each of the nine symptom scales and three indices. For adults, T-scores are reported using nonpatient, outpatient, and inpatient norms. For adolescents, T-scores are reported using adolescent nonpatient norms. The Profile report is useful for mental health professionals who only require test scores for monitoring change.</p>
<p>The CDS V.5 and MHS SmartLink™, a free client-management program, offer instantaneous scoring and report generation, enhanced client-searching capabilities, flexible multiuser security, and scalability for growth to networks of any size. The CDS V.5 software can also be customized for enterprise-wide use with existing client-management systems.</p><p>The TDS software operates with the Clinical Report Writer (CRW) program, which comes free with your purchase of this and any other products in the CRW family. CRW generates reports that allow you to evaluate, document, and interpret a wide range of client problems. CRW runs on Windows® 3.11, Windows® 95, and Windows® 98. </p><p>The Session Summary software operates within the Clinical Report Writer (CRW) program, which comes free with your purchase of this and any other products in the CRW family. This handy program generates reports that allow you to evaluate, record, and interpret a wide range of client problems. CRW runs on Windows® 3.11, Windows® 95, and Windows® 98. </p><p>The MMPI-2 Hand-Scoring Kit (includes MMPI-2 Test Manual, MMPI-2 Test Booklets (1 Hardcover or 10 Softcover), 50 Hand-Scoring Answer Sheets, 50 Validity and Clinical Scales Profile Forms, 50 Content Scales Profile Forms, 50 Content Component Scales Profile Forms, 50 Supplementary Scales Profile Forms, Basic Scales Answer Keys, Content Scales Answer Keys, Content Component Scales Answer Keys, and Supplementary Scales Answer Keys)</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>Developed by Jonathan Davidson, cochair of the DSM-IV™ PTSD Task Force and renowned as one of the leading authorities in the field, DTS has shown good test-retest and split-half reliability; internal consistency; and concurrent, construct, and predictive validity.</p> <br> <h1> Startle, Physiological Arousal, Anxiety, and Numbness (SPAN)</h1> <p>Based on the DTS assessment, this 4-item questionnaire screens for critical indicators of Posttraumatic Stress Disorder. Respondents are asked to refer to a particular traumatic event or series of events and designate symptom severity within the past week using a 5-point rating scale. The SPAN scale is ideal for use in primary care offices, multidiscipline clinics, and for research purposes. A total score is used to indicate which clients could be referred for more comprehensive screening and follow-up, including a DTS administration. </p>
<p>The SPSI–R:L version provides a more comprehensive picture of an individual’s problem-solving strengths and weaknesses through the use of four additional subscales that assess different stages of the problem-solving process, such as solution implementation. The SPSI–R:S version is useful for measuring social problem solving when respondents are completing a large test battery or when time is limited. </p><p>The PPSI software operates within the Clinical Report Writer program, which comes free with your purchase of this and any other products in the CRW family. This handy program generates reports that allow you to evaluate, record, and interpret a wide range of patient problems. CRW runs on Windows® 3.11, Windows® 95, and Windows® 98. </p>
<li>Resolving conflict at home and at work</li></ul>
<p>This newest edition focuses on the latest empirical research and discusses the multitude of studies that have
<p>The CASE™ assessment was formulated to identify DSM-IV™ Axis I disorders in less than one third t
<p>Familiarize yourself with the administration, scoring, and interpretation of SCID-D-Revised. Includes guideline<p>This video tells the “inside story” on DSM-IV™, including the rationale behind the resulting changes
<p>An informative, comprehensive review of scientific research in EI. This book addresses key issues
<p>The GAF Report for Windows® helps assess clients on the DSM-IV™ Global Assessment of Functioning
<p>The Clock Test quickly assesses visual-spatial construction, visual perception, and abstract conce<p>With a systematic probe for symptoms that might otherwise be overlooked, the Structured Clinical
<p>This practical "how-to" manual describes how to adapt short-term cognitive therapy techniques to more effective
<p>This short-term training is suited for clients who suffer from psychological disorders with anxiety components.<p>With this realistic, guided imagery, relax your clients while teaching them how to relax. Includes five clinically
<p>This pocket-sized reference conveniently summarizes the main diagnostic categories and scoring codes for the<p>Sensitively discusses the subtleties of manners, communication, subtext, and interpersonal relati
<p>Despite the emphasis on measuring EQ, little has been written about the psychological underpinni
<h1>Rorshach Psychodianostic Test Plates</h1><p>Printed and published in Switzerland, this is the complete set o<p>Designed to reveal an individual’s perception of interpersonal relationships, the Thematic Apperception Test (TAT<p>This book examines impulsive conduct with several new risk assessment tools and contributions fr<p>This 2nd edition incorporates new research findings about brain-behavior relations. New chapters <p>This book fills the gap in research on the aged. The authors discuss all the measures that detec<p>This book fills the need for an accessible overview of neuropsychological tests and techniques<p>Quickly acquire the knowledge you need to administer, score, and interpret the neuropsychological tests that wil
<p>This book is ideally suited for the critical task of treatment planning. James Butcher, a recognized authori<p>This textbook integreates structural, thematic, behavioral, and sequence analysis into systematic guidelines fo
<p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p>
Respondents login to the PSP website where they complete the assessment. Assessments are sent to MHS to be scored and reports are promptly returned to you. </p>
<p>The NEO PI-R™ assessment provides a systematic assessment of emotional, interpersonal, experiential, attitudinal, and motivational styles. It includes 5 domain scales: neuroticism, extraversion, openness, agreeableness, and conscientiousness.</p><h1>NEO Five-Factor Inventory (NEO–FFI™)</h1> <p>The NEO-FFI™ assessment is a shortened version of the NEO PI–R that provides a quick, reliable, and accurate measure of five domains of adult personality (neuroticism, extraversion, openness, agreeableness, and conscientiousness). Let NEO–FFI™ help you understand your client's basic emotional, interpersonal, experiential, attitudinal, and motivational styles. The NEO–FFI™ assessment is useful when time is limited and global information on personality is considered sufficient.</p><h1> NEO Peofessional Development Report (NEO PDR™)</h1> <p>The NEO PDR™ assessment addresses those personal characteristics that have the highest potential for yielding job-relevant information for management planning and for promoting individual growth and development. Each administration renders two professional development reports—the Management Planning Report and the Individual Planning Report. The Individual Planning Report focuses on unique characteristic behaviors and attitudes related to job performance, and the Management Planning Report provides information about an individual's carrer potential and appropriate placement.</p>
<p>The DTREE’s Case Summary Report provides a complete picture of the diagnostic assessment, including rationale for ruling in or out diagnoses. The Positive Dx report provides a snapshot of the diagnostic results. DTREE reports can be used for managed care, treatment planning, peer reviews, substance abuse programs, forensic reports, and billing programs. </p><p>You can administer, score, and generate DTREE reports an unlimited number of times; however, if the DTREE software is installed on a network, the number of users at one time is limited to the number of installations that have been purchased (contact MHS for multiple installations pricing). The DTREE software comes with PsychManager Lite™, a free client management program.</p>
<p>The PSH for Windows® is an unlimited-use program. However, if it is installed on a network, the number of users of the program at one time is limited to the number of installations purchased. The PSH Preview Version includes the software manual and allows you to interview and produce reports for three clients. The PSH software comes with PsychManager Lite™, a free client management software package.</p>
<p>The CDAP computer program operates within the Clinical Report Writer program, which comes free with your purchase of this and any other products in the CRW family. This handy program generates reports that allow you to evaluate, record, and interpret a wide range of client problems. CRW runs on Windows® 3.11, Windows® 95, and Windows® 98. </p>
<p>Intended for use by psychiatrists, psychologists, social workers, and other mental health professionals, the SAS-SR assessment is psychometrically sound and can be used for clinical and research purposes across diverse settings. </p><p>The SET program has 28 sessions over 16-weeks, consisting of group and individual sessions that reduce anxiety and improve social skills/functioning. The accompanying workbook contains weekly assignments that help the client react to or initiate social contact. It also contains exercises in flexibility, exposure to anxiety-inducing situations, and social role-playing. Individual sessions include “flooding” (either imaginal or in vivo) to address fear-inducing situations unique to each client. The manual is a complete guide to implementation, tips, clinical management, and exposure techniques.</p><p>The MMPI-2 Hand-Scoring Kit (includes MMPI-2 Test Manual, MMPI-2 Test Booklets (1 Hardcover or 10 Softcover), 50 Hand-Scoring Answer Sheets, 50 Validity and Clinical Scales Profile Forms, 50 Content Scales Profile Forms, 50 Content Component Scales Profile Forms, 50 Supplementary Scales Profile Forms, Basic Scales Answer Keys, Content Scales Answer Keys, Content Component Scales Answer Keys, and Supplementary Scales Answer Keys)</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>SCL-90 Analogue™ is an observer rating scale that provides a brief, standardized method for collecting observer data on a patient’s psychological symptomatic distress in terms of the 9 primary symptom dimensions measured by the SCL-90-R and the BSI self-report. It is useful in the initial evaluation of patients or to measure patient progress during and after treatment, as well as for any application where SCL-90-R or BSI is used. Designed for health professionals without in-depth training or knowledge of psychopathology, SCL-90 Analogue is easy to score using a 100 mm ruler. SCL-90 Analogue takes 1–3 minutes to complete. </p>
<p>The <b>Interpretive Report</b> provides a detailed analysis of the patient’s potential strengths and weaknesses and an interpretation for each of the five Domains, plus Noteworthy Responses that alert the clinician to potential problem areas. The Management Guide serves as a summary, helping to identify problems that may call for psychological referral and/or medication. A one-page, tear-off Healthcare Provider Summary to help facilitate communication between the psychologist and medical staff is also included. The <b>Profile Report</b> provides a graphic representation of the prevalent scores for all the content scales, plus a rating for the likelihood of a problem with the Response Patterns and Negative Health Habits. </p><li>Nonmedical personal in counselling settings</li></ul><p>The PSI3 Plus unlimited-use software allows you to enter item responses from the paper-and-pencil Standard PSI or PSI Short Form, or to administer an assessment on your computer screen when you purchase administrations on a key diskette (sold separately). The program automatically scores the item responses and generates a report. For the standard PSI (including the optional Life Stress items), the 7 to 9 page report includes a PSI Profile and Score Summary information on validity; a clinical description of the respondent’s perception of his or her personal stress with regard to the child; recommendations relative to diagnosis, treatment planning, and management; and test items to be reviewed by the professional. For the PSI Short Form, the 2 to 3 page report includes the PSI Profile and Score Summary sections. The system requirements are an MS DOS (or compatible) computer with two disk drives, an EGA/VGA color monitor, 640K memory, and DOS 2.1 or higher.</p><p>The QLQ Online is a quick and easy alternative to the paper-and-pencil version. It allows respondents to access the questionnaire from any computer with an internet connection.</p>
<p>The TD Monitor includes the Modified Webster and the Modified AIMS and descriptive case examples for key points. </p>
<p>Client-searching capabilities, automatic scoring, fast report generation, and easy access from your Windows desktop make JI-R V.5 software an invaluable time saver. The desktop software offers flexible multiuser security and scalability for growth to networks of any size. JI-R V.5 software comes with MHS Smarlink, a client-management program.<p>The HELP-Think™ program is an interactive software program to supplement psychotherapy and counseling. Using cognitive-behavioral principles and interactive exercises to foster awareness, motivate for positive change, and provide practical strategies for rapid, effective, and long lasting personal change, HELP-Think™ helps clients identify and change their irrational beliefs, distorted thoughts, and negative automatic thinking. It includes 9 client-completed sessions: understanding your thinking, pathways to change, the human experience, getting clear, the pessimist within, change and growth, mental reflexes, gaining control, and our progress report.</p><p>Profile Reports can be immediately generated on completion of either the Long or Brief administration of FAM III. Long version Profile Reports provide graphs for T-scores obtained on the seven subscales as well as narratives that explain the meaning of the scores obtained on all the scales. Profile Reports for Brief FAM are approximately two pages long and provide an overall T-score and individual item responses. Client management software—PsychManager Lite™ or Correction Manager™—comes free with your purchase of the FAM-III program. </p><li>Social</li></ul>
<p>The IQ-PANSS observer questionnaire evaluates phenomenological presentation in a reliable and valid manner. Through item definitions, statements, and questions, the IQ-PANSS ensures that all information related to behavioral presence, frequency, and the client’s responsiveness is obtained during interviews with family members, healthcare providers, or other informants.</p><p>Please call MHS for workshop information.</p>
<p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p>
<p>Filled with case histories and anecdotes, this book teaches how the frontal lobes enable our com<p>This practical reference contains concise, easy-to-use tables comparing drugs within a class. Ea<p>This revised theoretical framework moves from a learning theory biosocial framework to a more ev<p>The Electronic DSM-IV-TR™ Plus is Windows®-based and contains unabridged hyperlinked text. It<h1>Clinician’s Thesaurus</h1><p>This 5th edition offers guidelines for shaping raw data into a co<p>This book covers the entire spectrum of practice issues and current knowledge from diagnostic cod<p>Outlining the theoretical background and practical uses of motivational interviewing (MI), this r<p>Quickly get the knowledge to confidently administer, score, and interpret behavioral assessment<p>IPT now includes disorders of behavior, personality, and mood. Practitioners in today’s managed<p>This new edition of the award-winning original expands on recovered childhood memories, integr<p>Ensure that you receive third-party payment for services rendered! This book offers crucial information and a<p>This 2nd edition addresses the need for psychological testing for treatment planning and outcome<p>Trainees, clinicians, and researchers alike will benefit from these guidelines for the systematic<p>Perfectionism can be a maladaptive personality trait. This volume focuses on how and why the n
<p>This economical stopwatch has a large LCD digital readout and accurately measures to 1/100th of a
<p>This revision presents an ideal treatment approach for crises in focused, time-limited cognitive t<p>This book provides insights about the conceptualization and measurement of shame and guilt, thei<p>In many settings use this curriculum to teach social skills to groups of schizophrenia clients. <p>The leading source of training for clinicians interested in using thematic apperception techniques<p>The WAIS-III™ is a more sophisticated and complex instrument than its predecessors. This book is<p>With strategies on how to modify the character traits that keep your clients from reaching their ful<p>This book contains exercises, visual aids, stress analysis forms, data surveys, and intervention t<p>This comprehensive and detailed anger management program is an indispensable resource for clin<p>This book is the most ambitious effort yet to integrate the empirical approach of John Exner with<p>A concise reference for those who want to use the Rorschach with confidence, this book is ideal<p>Your professional and personal organizer, PsychManager™ combines assessment tools, patient and p<p>Copublished with the American Psychiatric Association. With the SCID II PQ for Windows®, clients can respond t<p>For use by human resource professionals and consultants, PeoplePro™ consolidates basic inform
<p>This extensive ttext details the traslation and use of the MMPI-2 worldwide, including normative data and re
<p>This is a valuable case-management tool for anyone in the corrections field. With PsychManager
<p>The CAARS V.5 for Windows™ software combines the reliability and validity of the CAARS paper-and-pencil forms w<p>The MICROTEST Q™ Assessment System Software will accurately and efficiently score, report, and store informa
<p>The newly revised editon of the Slosson Intelligence Test–Revised remains a quick and reliable ind<p>This video series, which is based on successful psychoeducational classes, has been designed as a first-stage i<p>This book is an innovative approach for clinicians, judges, and those who work with the mentally<p>Valuable details on the MMPI-2 restandardization and its content and supplementary scales. It details interpr
<p>CISS® Individual Profile reports provide descriptions of each scale, presentation of scores both numerically and graphically, and narrative comments to facilitate self-interpretation. The Campbell Interest/Skill Pattern Worksheet is also available to help individuals focus on their parallel interest and skill scores and provides an aid for action planning.</p><p>This short online questionnaire produces an SASQ Score Report with an Overall Optimism score, a Reaction to Adversity score, and a Success score. The Reaction and Success scores are further broken down into three subscale scores: Permanence, Pervasiveness, and Personalization. This questionnaire is ideal for use as a screening tool during the interview process, and, because optimism can be learned, as a quick way to identify areas that need improvement in current employees.
The Interpretive report is based on age-appropriate nonpatient norm groups. Adolescent norms are used for 13 to 17 year olds, and nonpatient adult norms are used for subjects over 17.</p>
<p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>The MACI items comprise 27 scales within three categories. It also contains modifying indices that help identify test-taking attitudes as well as confused or random responding.</p>
<p>Percentile and <i>T</i>-score tables are provided for male and female offenders, for male forensic psychiatric patients who have been assessed with the standard PCL–R™ procedure (interview plus file information), and for male offenders and forensic psychiatric patients whose assessments are based solely on file reviews. New research findings derived from confirmatory factor analysis and item response theory are presented along with the implications of these findings for research, clinical, and forensic purposes.</p>
<li>Comprehensive Ability Battery 5: Organizing Ideas, Production of Ideas, Verbal Fluency, Originality, Tracking, Drawing</li></ul><p/>
<p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>The MAPI Clinical Interpretive report provides a narrative interpretation of an adolescent’s personality and behavioural patterns and includes a profile of base rate scores for all MAPI scales.</p>
<p>The QUICKVIEW Social History collects patient information in several key areas: demographics; marital history; developmental history; legal history; educational history; family of origin; occupational history/financial status; military history; and symptom screen (Physical and Psychological).</p><p>The SCBE scales measure a full range of behaviors and emotions, including anxiety and depression, and is reliable for outcome assessment in experimental intervention programs.</p>
<p>BHI 2 provides useful information for the assessment of and treatment planning for people with injuries and helps measure the impact of physical, environmental, and psychological factors on treatment and recovery. Results help evaluate a patient’s emotional readiness for surgery or for vocational training/job placement. BHI 2 results can support other assessments in cases involving workers compensation, automobile injuries, and long-term disability. They also serve as a means of monitoring treatment progress and outcomes.</p><p>The Profile report is designed to provide objective, easy-to-read documentation about the presence and severity of PTSD symptoms. The report also documents whether or not a person is experiencing any functional impairment as a result of their symptoms. All the information in the report can be easily built into a treatment plan and communicated as needed.</p><li>Provides a total score that correlates highly (.75) with a WAIS-R™ full scale IQ, plus four subscales</li>
<p>This restandardized and updated version of the highly popular and effective Conners' CPT 3.0 has been completel<p>In recent years, societal concerns over the dramatic rise in juvenile crime—especially violent cr<p>The 16PF® Fifth Edition adds a number of enhancements to this widely used personality scale. The language has
<p>The 16PF® Fifth Edition adds a number of enhancements to this widely used personality scale. The language has
<p>The 16PF® Fifth Edition adds a number of enhancements to this widely used personality scale. The language has
<p>As research in the field of attention grows, so does your need to keep up with the latest develop
<p>The revisions to the MMPI-2 assessment include a contemporary normative sample; an expanded validity indicators section in the validity and clinical scales profile; new PSY-5 supplementary scales profile; revised general supplementary scales profile; re-ordered scales; an updated manual for administration, scoring, and interpretation; and new Restructured Clinical Scales.</p><p>Twenty-four scales are included in the MCMI-III™: 14 personality pattern scales that co-ordinate with DSM-IV™ Axis II disorders, and 10 clinical syndrome scales related to DSM-IV™ Axis I disorders. In addition, three modifying indices and a validity index detect careless, confused, or random responding.</p><p>This report is an incisive assessment of inmate personalities that can lead to better, more cost-effective decision-making. Based on norms developed in correctional settings, the Corrections Report presents information to help psychologists and prison administrators make security, management, and treatment decisions faster and more accurately. Its most distinguishing feature is a one-page correctional summary. All clinical information in the complete report is summarized in a one-page overview of nine areas critical to corrections: Reaction to Authority, Potential for Violence, Escape Risk, Impulsivity Proneness, Sexual Predation/Victimization, Disposition to Malinger, Response to Crowding/Isolation, Suicidal Tendencies, and Amenability to Treatment/Rehabilitation.</p>
<p>This report is a tailored forensic report designed to help you make the interpretive adjustments necessary in forensic applications of the test. These reports, authored by MMPI-2 expert Dr. James Butcher, have been normed on thousands of cases from various forensic settings. They provide interpretive guidance and support decisions in child custody, personal injury, pre-trial criminal, general corrections, and competency/commitment settings. </p>
<h1>Personal Career Development Profile (PCDP)</h1><p>The PCDP report shows how respondents' personal strengths can lead to career success and provides respondents with insights into their personality as it relates to their career.</>p<p>This report provides rating scales on work-related dimensions including openness to evaluation, addiction potential, social facility, and stress tolerance.</p>
<p>This report provides rating scales on work-related dimensions including openness to evaluation, addiction potential, social facility, and stress tolerance.</p>
<h1>Human Resources Development Report (HRDR)</h1><p>The HRDR report assesses leadership, management, and occupational growth potential by analysing the personality dimensions associated with success in a broad range of managerial settings.</p><h1>Personal Career Development Profile (PCDP)</h1><p>The PCDP report shows how respondents' personal strengths can lead to career success and provides respondents with insights into their personality as it relates to their career.</>p
<h1>Human Resources Development Report (HRDR)</h1><p>The HRDR report assesses leadership, management, and occupational growth potential by analysing the personality dimensions associated with success in a broad range of managerial settings.</p><p>Client-searching capabilities, automatic scoring, fast report generation, and easy access from your Windows desktop make JI-R V.5 software an invaluable time saver. The desktop software offers flexible multiuser security and scalability for growth to networks of any size. JI-R V.5 software comes with MHS Smarlink, a client-management program.
ImagePathLSI.gif
<p>The instruments of choice for the clinical assessment of psychopathy are the Hare PCL–R™ 2nd Ed. and the screYCA.gif
HSG.gifPTG.gifBCL.gifPCL.gifMSC.gifCST.gifVRT.gifJSO.gifSAR.gif
<p>In recent years, societal concerns over the dramatic rise in juvenile crime—especially violent crime—has reaffASD.gifCAT.gifCDI.gif
<p>This 3rd edition incorporates significant new insights and research findings about brain-behavior relationsh
CPT.gif
PS5.gif
EQI.jpg
<p>The BRIEF™ assessment was designed to assess executive functioning in a youth’s home and school environments. ICLM.gifEQE.gifPRL.gifWEI.gifJES.gif
<p>This comprehensive work is a guide to the latest in treatment and prevention of domestic violence, focusing EIT.gifWCN.gifPSO.gifHDI.gifCHI.gifIEQ.gifIRH.gif
<p>Valuable details on the MMPI-2 restandardization and its content and supplementary scales. It details interprBGM.gifRSO.gif
PSM.gifMLL.gifEOF.gifHFP.gifPCC.gifPOC.gifFMH.gifPFN.gifPCLYV.gif
<p>The ISO-30 interpretive report provides objective, easy-to-read documentation of suicidal risk and outlines suggestions for patient management based on risk classification.</p>
<p>The QuikScore™ Form allows easy scoring and profiling, and an optional state-of-the-art scoring template booklet can be used to make scoring even faster. The QuikScore™ Form can be used with English or French (Canadian) test booklets which are sold separately.</p><h1>16PF5: Overcoming Obstacles to Interpretation</h1><p>This book provides insight into the depth and comprehensiveness of the 16PF Fifth Edition. It combines detailed, practical advice with relevant examples and suggestions based on user's experiences. Focusing on complex profiles, the author covers each of the key stages of assessment and explains how to obtain a clear understanding of the data, tackle confusing score combinations, provide effective feedback, and successfully integrate results with data from additional sources.</p><h1>16PF® Interpretation in Clinical Practice: A Guide to the Fifth Edition</h1><p>This book combines individual factor descriptions, common factor combinations, numerous representative case illustrations, and empirical research. It emphasizes how the 16PF® assessment can enhance clinical decision-making to save valuable clinician time.</p>
FIT.gif
MACI.gif<p>This battery of eight subtests measures different but interrelated visual-perceptual and visual-motor abilities. E<p>The Pain Patient Profile™ (P-3™) test is a brief self-report screening inventory designed to measure psychologic<p>Focusing on the MCMI and the MACI assessments, this book begins with an overview of the Millon inventories and
EQ3.gif<p>The EPS self-report assesses whether an individual has the personality attributes to succeed as a senior manag<p>This battery of eight subtests measures different but interrelated visual-perceptual and visual-motor abilities. E<p>The 16PF® Fifth Edition adds a number of enhancements to this widely used personality scale. The language has
<p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that <p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that
<p>The MICROTEST Q™ Assessment System Software will accurately and efficiently score, report, and store informa
<p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that <p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that <p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that
<p>The BHI is a 202-item self-report questionnaire designed to identify psychological and psychosocial factors that
<p>The GADS scale is designed to evaluate children with unique behavioural problems who may have Asperger Disord
KPT.gif<p>This book teaches parents how to work with a child's talents and difficulties to help him/her interact more fully
<p>The Comprehensive Trail-Making Test (CTMT) is a new assessment based on time-tested techniques. The CTMT assess
WCS.gif
<p>The normative sample consists of 805 adolescent males and 815 adolescent females from eight communities in the U.S. and one in Canada. The sites were chosen to maximize the probability of obtaining a balanced sample of subjects according to geographic region, rural/urban residence, and ethnic background. New validity scales were developed to refine the clinician’s assessment of test-taking attitudes.</p><p>Connecting Clinician and Client is a 1-hour video with interpretations of SASSI results followed by feedback demonstrations for both adult and adolescent cases.</p><p>Three profiles are provided. T-scores are plotted, and raw and T-scores are listed for Validity, Clinical, and Content Scales. A supplementary score report presents raw scores, T-scores and response percentage for the Harris-Lingoes Subscales and the Si Subscales.</p>
<p>Used in medical and counselling settings by psychologists and psychiatrists working with patients in hospitals, clinics, and private practices, the MBHI self-report is particularly useful to evaluate and screen physically ill, injured, or surgical patients to help identify psychosomatic complications or help predict response to illness or treatment; to help assess stress-related worker’s compenstation claims; to develop effective rehabilitation programs for claims related to physical injuries; and to evaluate and screen individuals in specialty clinics/programs (e.g., pain, stress, headache) with problems that may stem from a psychological disorder or unidentified stressor.</p><p>The <b>Vocational Version</b> of the Career Assessment Inventory™ is an interest inventory used to identify occupational interests of individuals who plan to enter careers immediately after high school or community college and who are pursuing occupations that require less than two years of post-secondary education. Used by counsellors, psychologists, and personnel professionals for career guidance, adult career development, and human resource development, it helps students focus on the patterns of interest that are important in making educational and occupational choices; and helps clients in vocational rehabilitation settings to explore career options.</p>
<p>The <b>Vocational Version</b> of the Career Assessment Inventory™ is an interest inventory used to identify occupational interests of individuals who plan to enter careers immediately after high school or community college and who are pursuing occupations that require less than two years of post-secondary education. Used by counsellors, psychologists, and personnel professionals for career guidance, adult career development, and human resource development, it helps students focus on the patterns of interest that are important in making educational and occupational choices; and helps clients in vocational rehabilitation settings to explore career options.</p>
<p>The <b>Vocational Version</b> of the Career Assessment Inventory™ is an interest inventory used to identify occupational interests of individuals who plan to enter careers immediately after high school or community college and who are pursuing occupations that require less than two years of post-secondary education. Used by counsellors, psychologists, and personnel professionals for career guidance, adult career development, and human resource development, it helps students focus on the patterns of interest that are important in making educational and occupational choices; and helps clients in vocational rehabilitation settings to explore career options.</p><p>The MACI items comprise 27 scales within three categories. It also contains modifying indices that help identify test-taking attitudes as well as confused or random responding.</p>
<p>The self-report format enables clinicians to collect an individual’s perceptions about his/her use of alcohol and compare them with the interviewer’s perceptions and those of family members and other individuals.</p>
<p>Used in medical and counselling settings by psychologists and psychiatrists working with patients in hospitals, clinics, and private practices, MBHI is particularly useful to evaluate and screen physically ill, injured, or surgical patients to help identify psychosomatic complications or help predict response to illness or treatment; to help assess stress-related worker’s compenstation claims; to develop effective rehabilitation programs for claims related to physical injuries; and to evaluate and screen individuals in specialty clinics/programs (e.g., pain, stress, headache) with problems that may stem from a psychological disorder or unidentified stressor.</p>
<p>Used in medical and counselling settings by psychologists and psychiatrists working with patients in hospitals, clinics, and private practices, MBHI is particularly useful to evaluate and screen physically ill, injured, or surgical patients to help identify psychosomatic complications or help predict response to illness or treatment; to help assess stress-related worker’s compenstation claims; to develop effective rehabilitation programs for claims related to physical injuries; and to evaluate and screen individuals in specialty clinics/programs (e.g., pain, stress, headache) with problems that may stem from a psychological disorder or unidentified stressor.</p></p>The BBHI 2 assessment is ideal for treatment monitoring and treatment outcomes measurement. This instrument offers healthcare professionals a quick and comprehensive picture of a patient’s situation.</p><p>Used in medical and counselling settings by psychologists and psychiatrists working with patients in hospitals, clinics, and private practices, MBHI is particularly useful to evaluate and screen physically ill, injured, or surgical patients to help identify psychosomatic complications or help predict response to illness or treatment; to help assess stress-related worker’s compenstation claims; to develop effective rehabilitation programs for claims related to physical injuries; and to evaluate and screen individuals in specialty clinics/programs (e.g., pain, stress, headache) with problems that may stem from a psychological disorder or unidentified stressor.</p><p>The self-report format enables clinicians to collect an individual’s perceptions about his/her use of alcohol and compare them with the interviewer’s perceptions and those of family members and other individuals.</p>
<p>The self-report format enables clinicians to collect an individual’s perceptions about his/her use of alcohol and compare them with the interviewer’s perceptions and those of family members and other individuals.</p>
<p>The MAPI Clinical Interpretive report provides a narrative interpretation of an adolescent’s personality and behavioural patterns and includes a profile of base rate scores for all MAPI scales.</p>
<h1>DSM-IV-TR™ Case Book</h1><p>Through clinical vignettes, this book facilitates the transition from the concepts and terminology of DSM-IV-TR™ to actual clinical situations. It has been updated to include information from DSM-IV-TR™.</p><p><b>2002, 624 pages</b></p>
CSP.gif
<p>This text is used as an introduction to corrections and justice work. With a focus on Community Corrections, iLOP.gif
WILLIAMS<p>This parent-completed screening and diagnostic instrument was developed on the basis that the total stress a pare
PEC.gif<p>Interpretive strategies for the MMPI-2 and MMPI-A assessments. Includes recent research on ethnic/cultural backg<p>This parent-completed screening and diagnostic instrument was developed on the basis that the total stress a pare
<p>Head-injury clients will appreciate these 6 pamphlets summarizing symptoms and interventions. The pamphlets suWVS.gif
CSC.gif
CCH.gifCCM.gifCPP.gifEEW.gifAFV.gifCIE.gif
<p>Read what lawyers, social workers, and psychologists say about the roles and limits of expert testimony inBCP.gifIIB.gifHOF.gifTRO.gifVCM.gifVAT.gifDAP.gif
<p>This book provides professionals with easy-to-follow advice and guidance on how to administer, score, and inteANG.gifRAS.gifASV.gifLBS.gifCRT.gifASS.gifAAP.gif
<p>Top writers and researchers in criminal psychopathology discuss threats, pursuit characteristics, psychiatric dAYO.gifCRV.gifFEJ.gifPRO.gifDDS.gifPAD.gifCBT.gif
<p>The MAPI Clinical Interpretive report provides a narrative interpretation of an adolescent’s personality and behavioural patterns and includes a profile of base rate scores for all MAPI scales.</p>
<p>The report options include the Summary of Responses report that paraphrases each question asked and gives the client’s responses and the Diagnostic report, an adaptation of SSPQ’s Concise and Long reports. This report lists diagnoses that are likely, unlikely, and contradictory. Results from the SSPQ-X software can be imported into DTREE: The DSM-IV™ Expert.</p><p>Users of this unlimited-use program can administer, score, and generate any of the available reports an unlimited number of times. However, if the program is installed on a network, the number of users of the program at one time is limited to the number of “installations” that have been purchased (call for multiple installations pricing). The preview version includes the Software Manual and allows you to assess and produce reports for three clients. Both the preview and full versions of the program run on PsychManager™ or PsychManager Lite™, which comes free with the SSPQ-X software.</p><p>The report options include the Summary of Responses report that paraphrases each question asked and gives the client’s responses and the Diagnostic report, an adaptation of SSPQ’s Concise and Long reports. This report lists diagnoses that are likely, unlikely, and contradictory. Results from the SSPQ-X software can be imported into DTREE: The DSM-IV™ Expert.</p><p>Users of this unlimited-use program can administer, score, and generate any of the available reports an unlimited number of times. However, if the program is installed on a network, the number of users of the program at one time is limited to the number of “installations” that have been purchased (call for multiple installations pricing). The preview version includes the Software Manual and allows you to assess and produce reports for three clients. Both the preview and full versions of the program run on PsychManager™ or PsychManager Lite™, which comes free with the SSPQ-X software.</p>
<p>The report options include the Summary of Responses report that paraphrases each question asked and gives the client’s responses and the Diagnostic report, an adaptation of SSPQ’s Concise and Long reports. This report lists diagnoses that are likely, unlikely, and contradictory. Results from the SSPQ-X software can be imported into DTREE: The DSM-IV™ Expert.</p><p>Users of this unlimited-use program can administer, score, and generate any of the available reports an unlimited number of times. However, if the program is installed on a network, the number of users of the program at one time is limited to the number of “installations” that have been purchased (call for multiple installations pricing). The preview version includes the Software Manual and allows you to assess and produce reports for three clients. Both the preview and full versions of the program run on PsychManager™ or PsychManager Lite™, which comes free with the SSPQ-X software.</p>
The Interpretive report is based on age-appropriate nonpatient norm groups. Adolescent norms are used for 13 to 17 year olds, and nonpatient adult norms are used for subjects over 17.</p><p>This report is a tailored forensic report designed to help you make the interpretive adjustments necessary in forensic applications of the test. These reports, authored by MMPI-2 expert Dr. James Butcher, have been normed on thousands of cases from various forensic settings. They provide interpretive guidance and support decisions in child custody, personal injury, pre-trial criminal, general corrections, and competency/commitment settings. </p>
ABC.gifAAD.gifADB.gifPCP.gifYLS.gif
<p>This videotape describes the roles of professional and child witnesses in sexual abuse cases. The manual provi<p>Learn how to gauge children’s ability to report events accurately, which questions to ask/avoid, how to use ana
NIM.gifCSQ.gifPDX.gifEQS.gifADH.gif
<p>In this audiotaped ADHD workshop, Dr. Conners (author of the Conners’ scales and clinician and researcher ALD.gifMAC.gifPMT.gifPSG.gifPTT.gifRMR.gifTDA.gifAMP.gifANX2.gif
<p>Drawing from clinical experience and extensive literature reviews, the authors discuss the impact of the devCLE.gifCAD.gifHEA.gifCMR.gif
WIS.gifCRS.gif
<p>The CRS–R software presents the CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, and CASS:S items on your coCTO.gif
<p>This book teaches parents how to work with a child’s talents and difficulties to help him/her interact more fullyDTL.gifAAS.gifDCR.gifLDC.gifOBM.gifSTM.gifTFB.gifUCB.gifEDE.gif
<p>All parents want their children to be confident, successful, and happy. Achieving these goals is based just as <p>A self-help program for managing anxiety, anger, and depression, this book is both entertaining and educational
EQY.gifFAC.gifGAR.gifGRT.gifICP.gifICP.gifIPS.gifLDD.gifMAS.gif
<h1>Conners' Adult ADHD History Form</h1><p>Send the Conners' Adult ADHD History Form to your clients prior to their first visit or have them complete it at their initial consultation. It covers historical information that is of clinical importance in assessing an adult for ADHD and lets you evaluate your client's handwritten responses to questions about current problems, employment, family, past school history, relevant medical information, medications, and other areas.</p>
PPT.gif<p>The IDEAS test is a short, self-scored interest inventory designed to be an introduction to career exploration
<p>With problem-focused chapters, literature reviews, and guidelines with case studies, this text helps professi<p>A systematic guide to assessment, treatment planning, and skill-based cognitive-behavioral intervention for t<p>The SPAI–C assessment is a 26-item empirically derived self-report inventory. The SPAI–C self-report helps clin
STC.gifTLD.gifTLP.gifTML.gifTVP.gifWRA.gifWRV.GIFCAA.gifCAI.gifSTA.gifSPA.gifTON.gif
BSI.gifSSP.gifEMA.gif
<p> This interpretive aid provides test score corrections based on age, gender, and education for 54 tests includTOL.gifNES.gifMMS.gifREH.gifLAM.gifRHC.gifIER.gifMTO.gif
<p>This textbook integreates structural, thematic, behavioral, and sequence analysis into systematic guidelines foTOM.gifCDS.gif
DTS.gifISS.gifSPS.gifPPS.gif
<p>This manual provides a step-by-step procedure, with case examples, for using the MMPI-2 assessment as a therap<h1>The Millon Clinical Inventories: Clinical and Personality Assessment</h1><p>This comprehensive text examines t
HPS.gifRIA.gifSCB.gifSIP.gif
<p>The MMPI-2 Hand-Scoring Kit (includes MMPI-2 Test Manual, MMPI-2 Test Booklets (1 Hardcover or 10 Softcover), 50 Hand-Scoring Answer Sheets, 50 Validity and Clinical Scales Profile Forms, 50 Content Scales Profile Forms, 50 Content Component Scales Profile Forms, 50 Supplementary Scales Profile Forms, Basic Scales Answer Keys, Content Scales Answer Keys, Content Component Scales Answer Keys, and Supplementary Scales Answer Keys)</p><p>Twenty-four scales are included in the MCMI-III™: 14 personality pattern scales that co-ordinate with DSM-IV™ Axis II disorders, and 10 clinical syndrome scales related to DSM-IV™ Axis I disorders. In addition, three modifying indices and a validity index detect careless, confused, or random responding.</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p>
<p>The Profile report presents raw scores and normalized T-scores for each of the nine symptom scales and three indices. For adults, T-scores are reported using nonpatient, outpatient, and inpatient norms. For adolescents, T-scores are reported using adolescent nonpatient norms. The Profile report is useful for mental health professionals who only require test scores for monitoring change.</p>
<p>The TDS software operates with the Clinical Report Writer (CRW) program, which comes free with your purchase of this and any other products in the CRW family. CRW generates reports that allow you to evaluate, document, and interpret a wide range of client problems. CRW runs on Windows® 3.11, Windows® 95, and Windows® 98. </p><p>The Session Summary software operates within the Clinical Report Writer (CRW) program, which comes free with your purchase of this and any other products in the CRW family. This handy program generates reports that allow you to evaluate, record, and interpret a wide range of client problems. CRW runs on Windows® 3.11, Windows® 95, and Windows® 98. </p><p>The MMPI-2 Hand-Scoring Kit (includes MMPI-2 Test Manual, MMPI-2 Test Booklets (1 Hardcover or 10 Softcover), 50 Hand-Scoring Answer Sheets, 50 Validity and Clinical Scales Profile Forms, 50 Content Scales Profile Forms, 50 Content Component Scales Profile Forms, 50 Supplementary Scales Profile Forms, Basic Scales Answer Keys, Content Scales Answer Keys, Content Component Scales Answer Keys, and Supplementary Scales Answer Keys)</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p>
<p>This newest edition focuses on the latest empirical research and discusses the multitude of studies that have
CAE.gifPSP.gifSCD.gif
<p>Familiarize yourself with the administration, scoring, and interpretation of SCID-D-Revised. Includes guidelineIBC.gifNEO.gifEIE.gifDTR.gifGAF.gifPSH.gifCIS.gif
SA4.gifSAS.gifSET.gif
CLO.gifSCV.gif
<p>This practical "how-to" manual describes how to adapt short-term cognitive therapy techniques to more effective
PSI.gifQLQ.gif
<p>This short-term training is suited for clients who suffer from psychological disorders with anxiety components.<p>With this realistic, guided imagery, relax your clients while teaching them how to relax. Includes five clinically
DAS.gifTDM.gif
<p>This pocket-sized reference conveniently summarizes the main diagnostic categories and scoring codes for theWHA.gifJIRHEL.gifFAM.gif
WIF.gifPAN.gif
<h1>Rorshach Psychodianostic Test Plates</h1><p>Printed and published in Switzerland, this is the complete set o<p>Designed to reveal an individual’s perception of interpersonal relationships, the Thematic Apperception Test (TAT
IMP.gifCNT.gifAGG.gifPGC.gif
<p>Quickly acquire the knowledge you need to administer, score, and interpret the neuropsychological tests that wil
<p>This book is ideally suited for the critical task of treatment planning. James Butcher, a recognized authori<p>This textbook integreates structural, thematic, behavioral, and sequence analysis into systematic guidelines fo
<p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p>
<p>The CDAP computer program operates within the Clinical Report Writer program, which comes free with your purchase of this and any other products in the CRW family. This handy program generates reports that allow you to evaluate, record, and interpret a wide range of client problems. CRW runs on Windows® 3.11, Windows® 95, and Windows® 98. </p>
<p>The MMPI-2 Hand-Scoring Kit (includes MMPI-2 Test Manual, MMPI-2 Test Booklets (1 Hardcover or 10 Softcover), 50 Hand-Scoring Answer Sheets, 50 Validity and Clinical Scales Profile Forms, 50 Content Scales Profile Forms, 50 Content Component Scales Profile Forms, 50 Supplementary Scales Profile Forms, Basic Scales Answer Keys, Content Scales Answer Keys, Content Component Scales Answer Keys, and Supplementary Scales Answer Keys)</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>SCL-90 Analogue™ is an observer rating scale that provides a brief, standardized method for collecting observer data on a patient’s psychological symptomatic distress in terms of the 9 primary symptom dimensions measured by the SCL-90-R and the BSI self-report. It is useful in the initial evaluation of patients or to measure patient progress during and after treatment, as well as for any application where SCL-90-R or BSI is used. Designed for health professionals without in-depth training or knowledge of psychopathology, SCL-90 Analogue is easy to score using a 100 mm ruler. SCL-90 Analogue takes 1–3 minutes to complete. </p>
<p>The <b>Interpretive Report</b> provides a detailed analysis of the patient’s potential strengths and weaknesses and an interpretation for each of the five Domains, plus Noteworthy Responses that alert the clinician to potential problem areas. The Management Guide serves as a summary, helping to identify problems that may call for psychological referral and/or medication. A one-page, tear-off Healthcare Provider Summary to help facilitate communication between the psychologist and medical staff is also included. The <b>Profile Report</b> provides a graphic representation of the prevalent scores for all the content scales, plus a rating for the likelihood of a problem with the Response Patterns and Negative Health Habits. </p>
<p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p>
TEB.gifCHP.gifDOP.gifEDM.gifCLT.gifPDR.gifMIH.gifEOB.gifCGI.gifCAM.gif
<p>Ensure that you receive third-party payment for services rendered! This book offers crucial information and aUPT.gifHAD.gifPER.gif
SASQ.gifSTO.gif
CBS.gifSNG.gifSST.gifTAB.gifEWA.gifPSB.gifSMT.gifAMN.gifCRI.gifESR.gifSHR.gif
<p>Copublished with the American Psychiatric Association. With the SCID II PQ for Windows®, clients can respond tPPO.gif
<p>This extensive ttext details the traslation and use of the MMPI-2 worldwide, including normative data and rePC2.gif
UNK.gifCMP.gif
<p>The CAARS V.5 for Windows™ software combines the reliability and validity of the CAARS paper-and-pencil forms w<p>The MICROTEST Q™ Assessment System Software will accurately and efficiently score, report, and store informa
SIT.gif<p>This video series, which is based on successful psychoeducational classes, has been designed as a first-stage i
RRA.gif<p>Valuable details on the MMPI-2 restandardization and its content and supplementary scales. It details interpr
<p>CISS® Individual Profile reports provide descriptions of each scale, presentation of scores both numerically and graphically, and narrative comments to facilitate self-interpretation. The Campbell Interest/Skill Pattern Worksheet is also available to help individuals focus on their parallel interest and skill scores and provides an aid for action planning.</p>
The Interpretive report is based on age-appropriate nonpatient norm groups. Adolescent norms are used for 13 to 17 year olds, and nonpatient adult norms are used for subjects over 17.</p>
<p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>The MACI items comprise 27 scales within three categories. It also contains modifying indices that help identify test-taking attitudes as well as confused or random responding.</p>
<li>Comprehensive Ability Battery 5: Organizing Ideas, Production of Ideas, Verbal Fluency, Originality, Tracking, Drawing</li></ul>
<p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>MMPI-A Hand-Scoring Kit (includes Test Manual, 10 Softcover or 1 Hardcover Booklet, Basic Scales Answer Keys, Harris-Lingoes Subscales Answer Keys, Content/ Supplementary Scales Answer Keys, 50 Hand-scoring Answer Sheets, 50 Basic Scales Profile Forms, 50 Harris-Lingoes Subscales Profile Forms, and 50 Content/Supplementary Scales Profile Forms).</p><p>The MAPI Clinical Interpretive report provides a narrative interpretation of an adolescent’s personality and behavioural patterns and includes a profile of base rate scores for all MAPI scales.</p>
<p>The QUICKVIEW Social History collects patient information in several key areas: demographics; marital history; developmental history; legal history; educational history; family of origin; occupational history/financial status; military history; and symptom screen (Physical and Psychological).</p><p>The SCBE scales measure a full range of behaviors and emotions, including anxiety and depression, and is reliable for outcome assessment in experimental intervention programs.</p>
<p>BHI 2 provides useful information for the assessment of and treatment planning for people with injuries and helps measure the impact of physical, environmental, and psychological factors on treatment and recovery. Results help evaluate a patient’s emotional readiness for surgery or for vocational training/job placement. BHI 2 results can support other assessments in cases involving workers compensation, automobile injuries, and long-term disability. They also serve as a means of monitoring treatment progress and outcomes.</p><p>The Profile report is designed to provide objective, easy-to-read documentation about the presence and severity of PTSD symptoms. The report also documents whether or not a person is experiencing any functional impairment as a result of their symptoms. All the information in the report can be easily built into a treatment plan and communicated as needed.</p><li>Provides a total score that correlates highly (.75) with a WAIS-R™ full scale IQ, plus four subscales</li>
<p>This restandardized and updated version of the highly popular and effective Conners' CPT 3.0 has been completelAPS.gif
<p>The 16PF® Fifth Edition adds a number of enhancements to this widely used personality scale. The language has
<p>The 16PF® Fifth Edition adds a number of enhancements to this widely used personality scale. The language has
<p>The 16PF® Fifth Edition adds a number of enhancements to this widely used personality scale. The language has
JAD.gif
JIR
<p>The revisions to the MMPI-2 assessment include a contemporary normative sample; an expanded validity indicators section in the validity and clinical scales profile; new PSY-5 supplementary scales profile; revised general supplementary scales profile; re-ordered scales; an updated manual for administration, scoring, and interpretation; and new Restructured Clinical Scales.</p><p>Twenty-four scales are included in the MCMI-III™: 14 personality pattern scales that co-ordinate with DSM-IV™ Axis II disorders, and 10 clinical syndrome scales related to DSM-IV™ Axis I disorders. In addition, three modifying indices and a validity index detect careless, confused, or random responding.</p><p>This report is an incisive assessment of inmate personalities that can lead to better, more cost-effective decision-making. Based on norms developed in correctional settings, the Corrections Report presents information to help psychologists and prison administrators make security, management, and treatment decisions faster and more accurately. Its most distinguishing feature is a one-page correctional summary. All clinical information in the complete report is summarized in a one-page overview of nine areas critical to corrections: Reaction to Authority, Potential for Violence, Escape Risk, Impulsivity Proneness, Sexual Predation/Victimization, Disposition to Malinger, Response to Crowding/Isolation, Suicidal Tendencies, and Amenability to Treatment/Rehabilitation.</p>
<p>This report is a tailored forensic report designed to help you make the interpretive adjustments necessary in forensic applications of the test. These reports, authored by MMPI-2 expert Dr. James Butcher, have been normed on thousands of cases from various forensic settings. They provide interpretive guidance and support decisions in child custody, personal injury, pre-trial criminal, general corrections, and competency/commitment settings. </p>
<h1>Personal Career Development Profile (PCDP)</h1><p>The PCDP report shows how respondents' personal strengths can lead to career success and provides respondents with insights into their personality as it relates to their career.</>p<p>This report provides rating scales on work-related dimensions including openness to evaluation, addiction potential, social facility, and stress tolerance.</p>
<p>This report provides rating scales on work-related dimensions including openness to evaluation, addiction potential, social facility, and stress tolerance.</p>
<h1>Human Resources Development Report (HRDR)</h1><p>The HRDR report assesses leadership, management, and occupational growth potential by analysing the personality dimensions associated with success in a broad range of managerial settings.</p><h1>Personal Career Development Profile (PCDP)</h1><p>The PCDP report shows how respondents' personal strengths can lead to career success and provides respondents with insights into their personality as it relates to their career.</>p
<h1>Human Resources Development Report (HRDR)</h1><p>The HRDR report assesses leadership, management, and occupational growth potential by analysing the personality dimensions associated with success in a broad range of managerial settings.</p>
ShortDesA comprehensive risk/needs assessment for offender treatment planning and placementA tool to assess psychopathy and manage risk for antisocial, criminal, and violent behaviorA concice approach to managing anger
An aid for organizing homework sessionsBrochures to educate parents on high-risk adolescent behaviorsA brief videotape on the DSM-IV™Assesses psychopathic (antisocial) personality disordersAn ability-based masure of emotional intelligenceReviews of competency measures, ethical issues, and case examplesClearly explains complex concepts for criminal justice and mental health communitiesA comprehensive look at understanding, assessing, and treating juvenile sexual abusersAn aid to criminal justice professionals for predicting the likelihood of domestic violenceA parent/teacher rating scale that detects antisocial processes in young populations.A rating scale to help assess for Asperger SyndromeA client-completed software program that allows you to use your desktop or notebook computer for nA measure of depressive symptoms in youthsAn indispensable reference for neuropsychologists
Assessment software to help identify attention problems and to measure treatment effectivenessConcise measure of personality for adolescentsScreening tool to help identify adolescents at risk for suicideDiscussion of various aspects of psychopathology
A measure of emotional intelligence
A parent and teacher rating scale designed to assess executive functioning in a youth’s home and sGroup sessions that teach male participants to monitor and understand their emotionsDescribes Emotional Intelligence and provides steps for the reader to follow to improve their EIA description of how the Emotional Intelligence of leaders influences othersAn exploration of Emotional Intelligence in the corporate worldA personality classification system for delinquent and conduct-disordered youths and adultsGudeline for prevention and treament of domestic violenceEssential resources for professionals interested in learning more about applications and research in eAnswers to many questions about psychopaths and psychopathologyA collection of research that examines 5 topics of psychopathyA test that assesses, monitors, and documents psychotherapy or psychiatric intervention progressA psychometrically sound coping measure used with a broad range of health problems and illnessesAn assessment of the impact of a patient’s illness from multiple perspectivesProvides interpretive guidelines for neuropsychological testsUseful in MMPI-2 interpretationGuide for new MMPI-2 usersA measurement of the impact of various injuries and traumaA 185-item questionnaire to measure the whole of human personalityA tool for clinicians who evaluate and treat criminal psychopathsInsight into issues associated with assessing troubled youthsA discussion of forensic mental health concerns with test yourself questionsSource book for the study and application of forensic psychologyAn examination of research findings in prediction and intervention in keeping with the psychiatric/clinA thorough, balanced summary of the research in and theory about the biological determinants of criAn Illustration of the principles of conducting forensic mental health assessmentsA tool for clinical neuropsychologists involved in forensic practiceAssessment of antisocial traits in youths
A personality assessment tool for childrenAudiocassette to accompany the MMPI-A, an empirically-based measure of adolescent psychopatholScreens for substance dependencyMail-in scoring for MMPI-A, an empirically-based measure of adolescent psychopathyMail-in scoring for MACI, a brief self-report personality inventory with a strong clinical focusMeasures visual-perceptual and visual-motor abilitiesA time- and cost-efficient screening tool to help identify the psychological factors that may be delayinGives research and case examples for using the Millon Inventories in forensic assessmentProvides a 360-degree perspective of an individual's EQAssesses people's aptitude for executive positionsMeasures visual-perceptual and visual-motor abilities185-item questionnaire designed to measure the whole of human personality
The Battery for Health Improvement (BHI™) helps identify psychological and psychosocial factors that The Battery for Health Improvement (BHI™) helps identify psychological and psychosocial factors that The Millon Behavioral Health Inventory (MBHI™) assesses psychological coping factors related to aduAn occupational interest inventory for both college-bound and noncollege bound individualsMicrotest Q™ assesment software
Audiotapes accompanying the Battery for Health Improvement (BHI™) to help identify psychological andMail-in scoring service for the Battery for Health Improvement (BHI™) helps identify psychological andThe Battery For Health Improvement (BHI™) Microtest Q™ software helps identify psychological and psyThe mail-in version of the Career Assessment Inventory™, an occupational interest inventory for bot
The Microtest Q™ version of the Career Assessment Inventory™ occupational interest inventory for A brief self-report personality inventory with a strong clinical focusThe Battery for Health Improvement (BHI™) helps identify psychological and psychosocial factors that A self-report that helps identifypatterns of behaviour, attitudes, and symptoms associated with alcohThe Health Status Questionnaire (HSQ™ 20) is an outcome measurement tool that yields a profile of scoThe Health Status Questionnaire (HSQ™ 20) is an outcome measurement tool that yields a profile of scoAudiotapes that accompany the Millon Behavioral Health Inventory (MBHI™) to assess psychological coAids in identifying children who have Asperger Disorder<p>The Health Status Questionnaire (HSQ 2.0) is an outcome measurement tool that yields a profile of The Millon Behavioral Health Inventory (MBHI™) assesses psychological coping factors related to aduHelps identify the psychological and psychosocial factors that may interfere with a patient’s normal coMail-in scoring service for Millon Behavioral Health Inventory (MBHI™) assessmentsMail-in Scoring for the Alcohol Use Inventory
The Microtest Q™ program of the Alcohol Use Inventory (AUI™) helps identify patterns of behaviour,Assessment soctware to help identify attention problems and measurement of treatment effectivenessHelps parents improve socialization of children with Asperger Syndrome
Search and sequencing tasks to evaluate central nervous system compromiseDesigned to assess personality characteristics of both typical and troubled teensasdfAssesses perseveration and abstract thinkingDSM-IV-TR and books for use with the guidelines
Mail-in scoring service for MAPI, an assessment designed to assess personality characteristics of botA 119-item relf-report DSM-IV Axis II questionnaire
The SSPQ assessment is a brief self-report vesion of the SCID for Axis I disorders; the SSPQ–X asseThe SSPQ assessment is a brief self-report vesion of the SCID for Axis I disorders; the SSPQ–X asseIntroductory text about corrections and justice in CanadaHelps change adults' and children's outlooks
The SSPQ assessment is a brief self-report vesion of the SCID for Axis I disorders; the SSPQ–X asseMeasures emotional intelligenceTeaches emotional management skillsFrench translations of Parenting Stress IndexDiscusses issues in evaluation for courtsExplores MMPI-2 and MMPI-A interpretive strategiesFrench translations of Parenting Stress IndexAudiocassette to accompany BSI, an assessment designed to reflect psychological symptom patterns oForensic interpertive report for MMPI-26 pamphlets summarizing symptoms and interventions.An easy-to-use and useful projection technique clinical tool.Describes the MMPI-2 Content Scales and their use
An Axis I interview driver for clinicians
Numourous tests and tools for eliciting reliable information from both children and parentsA significant contribution to the literature of law enforcement intelligenceAn explanation of the deficiencies of psychiatric and psychological evidenceTypical ploys used by attorneys to draw information in forensic court psychologyEmpirically driven approaches to the clinical evaluation of violenceAn Update for forensic professionals on how the law conceptualizes insanity and key issues surroundiA description of the roles and limits of expert testimony in child abuse casesA detailed overview of psychological knowledge and its forensic applicationsAn aid to improve practitioners’ interviewing skillsCurrent knowledge and best practice in the rehabilitation and treatment of offendersAddresses therapeutic work, incorporating biological and psychological perspectivesA review of the knowledge and best practice for mental health and corrections professionalsCase studies that provide idiographic portraits of violent offendersExpert guidance for using RET to help your clients overcome angerGuidance and information about using MMPI-2A review of many of the facts and theories of angerAn account of the inner workings of aggressive and psychopathic personalitiesA summary of articles for those who work with antisocial children and adolescentsA commentary on the social environment that leads boys astrayExplicit guidelines about the role and limits of expert testimonyA review of what has been learned about the revised MMPI-2An overview of the author’s Structural Summary approach to MMPI-A interpretation and literature revA description and discussion of numerous issues in criminal psychopathologyA discussion of the utility and limitations of psychological assessments in the juvenile justice systemA practical guide for mental health professionals interested in applying their training and knowledge tAn authoritative work on adolescent assessment for the courtsProtocols are delineated for common types of sexual perpetrators and victimsA 12-step concept that integrates substance use disorder and mental health treatmentsA DSM-IV™ audiotape seriesA program that motivates sexual offenders to take responsibility for their actions
A measure of functioning and behavior disorders in mentally handicapped and autistic individuals andA set of guidelines for assessing children and adolescents with ADHDAn essential resource for individuals interested in learning about the nature, diagnosis, assessment,Guide and preparation for providing court testimonyA guide for the assessment of rehabilitation needsVideotape that describes the roles of professional and child witnesses in sexual abuse casesVideo and manual that teach best interviewing practicesWorkbook for recording parent-child interactionsA method for documenting past sexual behaviors as a means to assess respondent’s risk to others andA measure of the tendency to give socially desirable responsesA quick measure of emotional intelligenceThis essential resource by the author of the CRS-R includes information on the assessment, researcAn audiotaped ADHD workshop conducted by Dr. Conners (author of the Conners’ scales and clinicianA comprehensive reference book detailing the causes, symptoms, and diagnosis of ADHDAn ADHD resource book featuring discussion of controversial treatments such as diets, dietary supA parent training audiotape series for professionals helping parents of ADHD childrenA collection of tips and strategies for improving attention, behavior, and performance in ADHD studenAn essential resource for teachers dealing with behavior disorders, sexual abuse, alcohol/drug abuseAn award-winning video to help parents with ADHD children.An essential resource to help parents of ADHD childrenA self-report inventory used to identify underachieving or unmotivated studentsA collection of theoretical perspectives on the diagnosis, etiology, and treatment of specific DSM-IVAn essential resource for professionals dealing with social phobiaA measure that determines the impact of life events and change in a young person’s personal develA coaching tool for adults to assist attention-deficit students in enhancing their organizational and studAn audiotape with practical suggestions for using Conners’ CPT and explaining the results clientsA parent-completed form designed to collect information about clients before an ADHD assessmentThe 1989 version of the Conners’ Rating Scales–Revised (CRS–R), which was restandardized in 199A computer program to assist in interpretation of the Wechsler Intelligence Scale for Children-IIIA comprehensive assessment of psychopathology and problem behavior and the standard in ADHD asA computerized version of the CRS-R, the standard in ADHD assessment for childrenA measure of nonverbal reasoning abilities
Stratgies to help parent's of children with asperger syndrome and high-level functioning autism to impA measure of language, attention, and motor abilitiesA collection of empirically supported approaches to dealing with alcohol and other drug problemsA computerized diagnostic interview based on the DSM-IV™An educator training tool that teaches strategies for improving academic outcomes and classroom An educator training tool that teaches strategies for neutralizing and redirecting even the worst classAn educator training tool that provides strategies on how to manage threats and other violent events An Emotional Education Curriculum for Children Grades 1-6 and 7-12A guide to evaluating and managing children with behavioral problems for educatorsAn essential resource for professionals encorporating emotional intelligence into their educational prA guide to teaching social and emotional skills.A self-help program for managing anxiety, anger, and depressionA self-report emotional intelligence test for children and adolescentsAn emotional and behavior assessment for childrenA tool to aid in identifying autismA tool for assessing children's and young adult's understanding of written languageA program to improve problem-solving skills for primary school-aged childrenA program to improve problem-solving skills for preschool-aged childrenA program to improve problem-solving skills for intermediate grade school-aged childrenA rating scale designed to identify intrinsic processing disorders in children and adolescentsA self-report questionnaire that assesses the major dimensions of anxiety in young persons
Rating scale to measure psychological processingAn introductory career exploration inventoryA tool to provide MMPI-A interpretive hypothesesA text to help professionals help parents understand and manage childhood problemsA guide to assessing and treating youths with obsessive-compulsive disorderAn inventory to detect and assess social anxiety and phobiaA self-report measure of two distinct anxiety concepts in childrenA test to detect strengths and deficiencies in basic spoken language abilityA test to detect and isolate children’s language disordersA comprehensive battery designed to measure general and specific memory functions in children andA test of visual-perceptual skills for children and young adultsTests to pinpoint learning disabilities in reading, spelling, and arithmetic and to measure developmeA composite assessment of Visual-Motor abilitiesA multidimensional adult ADHD assessment instrumentA two-part structured interview that aids in diagnosing ADHD adultsA measure of two distinct anxiety conceptsA self-report inventory to assess social anxiety and fearA language-free, motor-reduced measure of intelligenceIn-depth measure of adult psychopathologyDesigned to assess DSM-IV™-related personality disorders and clinical syndromesAn empirically based measure of adolescent psychopathologyDesigned to reflect psychological symptom patterns of psychiatric and medical patientsSCID questionnaires for DSM-IV™ Axis I and II disordersA measure of state anxiety, trait anxiety, and perception of situational threatA set of score corrections for popular testsAssesses executive planning and higher-order problem-solvingA pamphlet set to educate patients with neuropsychological difficultiesAssesses cognitive functioning in adultsHelps determine the needs of clients recovering from injuries and illnessAssesses both specificity and sensitivity to diverse memory problemsEducational leaflets for rehabilitation psychologyHelps evaluate presenting problems, physical presentation, mental status, and interpersonal relationsA measure of verbal and visuospatial learning and memory performance in older adultsMail-in scoring for BSI, an assessment designed to reflect psychological symptom patterns of psychiatDescribes Rorschach interpretationHelps distinguish between malingered and true memory impairmentsQuestionnaires that measure depressive symptom severitySummarizes client treatment courseHelps summarize client presentation and session eventsIn-depth measure of adult psychopathologyAn empirically based measure of adolescent psychopathologyAn empirically based measure of adolescent psychopathologyA quick, accurate measure of Posttraumatic Stress Disorder (PTSD) symptomsMeasures internalized shame and the negative response patterns that result from itAssesses an individual’s problem-solving style and ability to generate solutionsA computer administration of an initial psychological/psychiatric interviewDescribes use of the MMPI-2 assessmentBooks about the MCMI and other Millon Clinical InventoriesMeasures emotional intelligence
A brief self-report assessment of psychiatric symptomatology, social symptomatology, and depressioAssists the clinical psychologist in scoring and interpreting Rorschach resultsAn audiotape series to assist in detecting dissociative disordersIdentifies stressful areas in parent-adolescent interactions
An empirically based measure of adolescent psychopathologyResearch using the Millon Clinical Multiaxial InventoryProvides MMPI-2 configurable interpretationA comprehensive test of acute psychopathology in the elderlyA self-report instrument designed to illustrate personality stylesA diagnostic interview specific to the assessment of DSM-IV™ dissociative disordersAn audiotape to assist in the use of the SCID-D revisedA videotape series on the DSM-IV™ classification systemObtain a detailed assessment of normal personalitySuggestions for implementing EI into everyday lifeSoftware that assists in diagnosing DSM-IV™ Axis I disordersHelps to assess clients on the DSM-IV™ GAF ScaleA computerized psychological intake interviewUsed to effectively measure three types of coping stylesDocuments details about your client’s drug and alcohol useA brief assessment of symptomatology across nine psychiatric domainsAssesses individuals’ ability to adapt to and be satisfied with their social rolesProgram to decrease social phobia and improve interpersonal skillsIn-depth measure of adult psychopathologyAn empirically based measure of adolescent psychopathologyAn empirically based measure of adolescent psychopathologyAn empirically based measure of adolescent psychopathologyA brief self-report inventory designed to screen for a broad range of psychological problems and syHelps differentiate between normal elderly and those suffering from dementiaA face-to-face, paper-and-pencil diagnostic interview for major DSM-IV disorders
Helps adapt therapy techniques to help those with personality disordersOffers a contemporary view of the psychosocial assets and liabilities that may support or interfere witA brief inventory to help measure life satisfaction that can also be used to help measure outcomesIdentifies parent-child problem areasAssesses quality of life indicatorsAn audiotaped relaxation training programAn audiotape of relaxation techniquesA self-report measure of relationship adjustmentAssists in generating a diagnosis and classifying the course of the movement disorderA pocket-sized quick scoring guideSocial Skills Help for Adults with ADHD: A Reader-Friendly GuideA personality classification system for delinquent and conduct-disordered youths and adultsA series of computer-assisted therapy programs that can help clients improve their assertiveness, selfProvides a multilevel (within family) assessment of family functioningA vocational assessment that measures five career interestsDescribes EI concepts and researchA 30-symptom rating scale for assessing schizophreniaPsychodiagnostic test plates, recording blanks, and location chartsA widely used projective assessmentAn essential reference to impulsive conductA reference guide to neuropsychological assessmentsAn essential resource for neuropsychologistsAn overview of neuropsychological assessments and techniquesA guide to administering, scoring and interpreting neuropsychological assessmentsAn empirically based measure of adolescent psychopathology
Helps in planning MMPI-2 treatmentDescribes Rorschach interpretation
A comprehensive text on brain functioningA practical reference for cliniciansA reference guide to personality disordersA convienent tool for users of the DSM-IV™A Thesaurus for use by mental health practitionersA reference guide for mental health practitionersA handbook for motivational interviewing practitioners and traineesA guide to administering, scoring and interpreting behavioral assessmentsAn indispensable resource in today's managed care environmentA new edition of the award-winning orginalA guide to selecting appropriate outcome measures assessmentsAn indispensable resource on treatment planning and outcome assessmentsGuidelines for the assessment of dissociation and PTSDA reference guide to perfectionismA vocational survey that measures and cross-references self-reported interests and skillsA questionnaire that determines a person's attributional style.LCD digital stopwatch.Audiocassette to accompany BSI, an assessment designed to reflect psychological symptom patterns oAn authoritative text that addressses emerging concerns in crisis interventionA reference guide to shame and guiltA social skills teaching toolAn essential resource for practitioners using thematic apperception techniquesAn authoritative resource on the use of the WAIS-IIIA resource to help individuals understand their personalityA stress management training toolAn indispensable resource for clinical settings.A guide to use to the RorschachA concise reference for users of the RorschachPsychManager™ and PsychManager Lite™ organize your practice into files and folders, allowing you tA 119-item self-report DSM-IV™ Axis II questionnaireFor use by human resource professionals and consultants, PeoplePro consolidates information about An empirically based measure of adolescent psychopathologyAudiotape to accompany the MACI, a brief self-report personality inventory with a strong clinical focuDescribes international use of MMPI-2Assesses psychopathic (antisocial) personality disordersProvides a general assessment of responses and is designed to measure malingeringMeasures abilities relevant to job performanceMHS Professional Tool Suite with SmartLink offers instantaneous scoring and report generation, enhancedA valuable case management tool for corrections professionals, Correction Manager combines the featAn empirically based measure of adolescent psychopathologyAn empirically based measure of adolescent psychopathologyAudiocassette for use with MAPI, an assessment designed to assess personality characteristics of botSoftware to assess ADHD in adultsMicrotest Q™ software annual maintenance fees
An extensive psychological inventory that assists in standardizing the collection of client information A measure of social competence and behavior in preschool childrenA quick, reliable measure of intelligenceA program formulated to help individuals dealing with an eating disorderHelps predict violence risk among mentally disordered peopleUseful in MMPI-2 interpretationBattery For Health Improvement 2 (BHI 2)helps identify the psychological and psychosocial factors thaPosttraumatic Stress Diagnostic Scale (PDS™) assess the presence and symptom severity of posttrauA brief, nonverbal test that provides an estimate of an individual’s general intellectual ability
Assessment software that helps identify attention problems and measures treatment effectivenessA parent/teacher rating scale that detects antisocial processes in young populations.Uses 16PF® items to assess relationship issuesAudiocassette to accompany MMPI-2, an in-depth measure of adult psychopathologyAudiocassettes to accompany MCMI-III, an assessment designed to assess DSM-IV™-related personalMail-in scoring service for MCMI-III, an assessment designed to assess DSM-IV™-related personalityUses 16PF® items to assess relationship issues
Forensic interpertive report for MMPI-2Uses 16PF® items to assess relationship issuesUses 16PF® items to assess personal and career strengthsMail-in scoring service for MMPI-2, an in-depth measure of adult psychopathologyA journal publishing research about attention disorders
Mail-in scoring service for MMPI-2, an in-depth measure of adult psychopathologyFrench translation of 16PF, 5th Ed.French translation of 16PF, 5th Ed.
Uses 16PF® items to assess human resources development issuesUses 16PF® items to assess personal and career strengths
Assessment that measures affective mood state fluctuationUses 16PF® items to assess human resources development issuesA personality classification system for delinquent and conduct-disordered youths and adults
Ages16 and older13 and olderna
nanana18 years and older17 and oldernananana6–135–18Adult (15 and older); Intermediate (9–14)7–17na
6 and older11–22nana
16 and older
5–18Males 14 and oldernanana8 and oldernanananaParents of children aged 4–19; 14 and older18 and older18 and oldernanana18 and older16 and oldernananananananana12–18
7–1214–18Adult and adolescent versions14–1813–194–1017–76na16 and olderAdult4–1016 and older
18–6518–6518 and older15 and oldern/a
18–6518–6516–6515 and older
15 and older13–1918–6516 and older14 and older14 and older18 and older3–2214 and older18 and older18–6518 and older16 and older
16 and older4–5na
11 to 7413–19asdf6–89na
13–1918 and older
18 and older18 and oldernana
18 and older16 and oldernaParents of children aged 1 month to 12 yearsnanaParents of children aged 1 month to 12 years13 and older18 and olderna18 and olderna
18 and older
nananananananananananananananananananananananananananananana
3–18nanana12–17nananaMales 18 and older16 and older16 and oldernanananananananana14 and oldernana5 and under (CLES-P), 6–12 (CLES-C), and 13–19 (CLES-A)nana3–173–173–133–17 (Self-report for 12–17 year olds)3–17 (Self-report for 12–17 year olds)6–90
naPrimary: 3–9; Adult: 16–79na6–17nananananananana7–186–133–226–18kindergarten and primary gradespreschool agedintermediate elementary grades8–178–19
kindergarten to fifth gradesixth grade and older14–18nana8–146–148–124–85–194–13;12-185–753–1718 and older18 and older15 and older14 and older6–9018 and older18 and older14–1813 and older18 and olderadolescents, adults, and the elderlyn/aChildren, adolescents, and adultsn/a18 and over
20–80na17 and older55–84 years13 and olderna16–84
nana18 and older14–1814–1818 and older13 and older13 and oldernanana16 and older
14 and older5 to 70naParents of adolescents aged 11–19
14–18na18 and older55–9018 and oldernanana17 years and olderna18 and older18 and older17 and olderAdolescent (13–18) and Adult (18+)16 years of age and older13 and older17 and older18 and older18 and older14–1814–1814–1813 and older65 and older18 and older
na18 and older18 years and olderParents of children aged 1 month to 12 years18 and oldernanaAdultsnanana8 and olderAdults, 18 and older; adolescents, 13–1710 and older15 and olderna18 and oldernanananananana14–18
nana
nananananananananananananana15 and older14 and olderna13 and oldernanananananananananana18 and olderna14–1813–19na18 years and older18 to 69Adolescent and adultnana14–1814–1813–1918 and oldern/a
16 years and older2.5–64–65young adult to adultnana18–6517–6518 and older
6 and older6–1316 and older18 and older18 and older18 and older16 and older
18 and older16 and older16 and older18 and olderna
18 and older16 and older16 and older
16 and older16 and older
18 years and older16 and older8 and older
AdminTypeStructured interview; Expert Rating formAssessor-completedna
nananaStructured interview and Expert Rating FormClient-completednananaClinician-completedParent/Teacher RatingObserver ratingClient-completedSelf-report, Parent Rating, Teacher Ratingna
Self-completed performance measureSelf-ReportSelf-reportna
Self-report
Parent/Teacher RatingGroup sessionsnananaSelf-reportnanananaParent-report and Self-reportSelf-reportSelf-report, observer rating, professional ratingnananaSelf-reportSelf-reportnanananananananastructured interview and Expert Rating Form
IndividualSelf-ReportSelf-reportSelf-ReportSelf-reportIndividualSelf-reportnaSelf report (BarOn EQ-i®) and multirater-report (EQ-360™)Self-reportIndividualSelf-report
Self-ReportSelf-ReportSelf-reportSelf-reportn/a
Self-reportSelf-reportSelf-reportSelf-report
Self-reportSelf-reportSelf-ReportSelf-reportSelf-report, interviewSelf-report, interviewSelf-reportParent or professional completedSelf-report, Personal Interview, Telephone InterviewSelf-reportSelf-reportSelf-reportSelf-report
Self-reportSelf-completed performance measurena
IndividualSelf-reportasdfIndividualna
Self-reportClient-completed
Computerized self-reportComputerized self-reportnana
Computerized self-reportSelf-reportVideoParent-completednanaParent-completedSelf-reportSelf-reportnaClient completedna
Clinician-completed
nananananananananananananananananananananananananananananana
IndividualnananaSemi-structured interviewnanaCompleted by professionalSelf-reportSelf-reportSelf-reportnananananananananaSelf-reportnanaSelf-report (6–19), Assisted Self-report (5 and under)nanaParent-completedParent and Teacher Rating, and Adolescent Self-reportProfessionally completedParent and Teacher Rating, and Adolescent Self-reportParent and Teacher Rating, and Adolescent Self-reportProfessionally administered
naProfessionally administerednaParent Rating and Self-report for Children/AdolescentsnanananananananaSelf-reportSelf-reportRated by parent, teacher, or a professionalProfessionally completedProfessionally completedProfessionally completedProfessionally completedProfessionally completedSelf-report
Teacher ratingSelf-reportClinician completednanaSelf-reportSelf-reportProfessionally completedProfessionally completedProfessionally completedProfessionally completedProfessionally completedProfessionally completedSelf-report and/or observer ratingClinical interview; Self-reportSelf-reportSelf-reportIndividualSelf-reportSelf-reportSelf-reportSelf-reportSelf-report or interview driverSelf-reportnaIndividualnaIndividualIndividualIndividualnaclinician-completedIndividualSelf-reportnaIndividualSelf-reportclinician-completedclinician-completedSelf-reportSelf-reportSelf-reportSelf-reportSelf-reportSelf-reportClient-completednanaSelf-report
Self-reportClinician-completednaParent-completed
Self-reportnaClinician enters T-scoresIndividual or GroupSelf-reportInterviewnanaSelf-report or observernaInterviewClinician-completedClient-completedSelf-reportSelf-reportSelf-reportSelf-reportGroup and individual sessionsSelf-reportSelf-reportSelf-reportSelf-reportSelf-reportIndividualInterview
naSelf-reportSelf-reportParent-completedSelf-reportnanaIndividual or Coupleclinician-completednanaSelf-reportSelf-reportSelf-report; family ratingSelf-reportnaInterviewIndividualIndividual or group sessionsnananananaSelf-report
nana
nanananananananananananananaSelf-reportSelf-reportnaSelf-reportnananananananananananaClient-completednaSelf-reportSelf-reportnaStructured interview and Expert Rating FormSelf-reportSelf-reportnanaSelf-reportSelf-reportSelf-reportSelf-report and/or observer ratingsoftware
Clinician-completedTeacher ratingIndividualIndividualnanaSelf-reportSelf-reportTimed Self-Report
Self-completed performance measureParent/Teacher RatingSelf-reportSelf-reportSelf-reportSelf-reportSelf-report
Self-reportSelf-reportSelf-reportSelf-reportna
Self-reportSelf-reportSelf-report
Self-reportSelf-report
Self-reportSelf-reportSelf-report
AdminTime30–45 minutes10–15 minutesna
nananaInterview section, 1.5–2 hours; collateral review, 1 hour30–45 minutesnanananana10–15 minutes30–40 minutes; up to 95 minutes for impaired clients10–30 minutesna
14 minutes55 minutes10 minutes (30 items)na
30 minutes
10–15 minutes24, 2-hour sessions (CALM); 8, 1.5–2-hour sessions administered once or twice a week (CALMER)nanana20–30 minutesnananana10–15 minutes10–15 minutes10 minutes per formnanana10 minutes35–50 minutesnanananananananainterview section, 1.5–2 hours; collateral review, 1 hour
45 minutes45–60 minutes15 minutes45–60 minutes30 minutes (160 items)na12–15 minutesna30 minutes per questionnaire50–60 minutesna35 to 50 minutes
30–40 minutes30–40 minutes20 minutes (150 items)40 minutesn/a
25–40 minutes25–40 minutes25–40 minutes40 minutes
40 minutes30 minutes (160 items)30–40 minutes35–60 minutes (228 items)5–10 minutes5–10 minutes20 minutes (150 items)5–10 minutes5–10 minutes20 minutes (150 items)30–40 minutes20 minutes (150 items)35–60 minutes (228 items)
35–60 minutes (228 items)7.5 minutesna
5 to 12 minutes20–30 minutes (150 itemsasdfnana
20–30 minutes (150 items)30–45 minutes
Approximately 20 minutesApproximately 20 minutesnana
Approximately 20 minutes30 minutes75 minutes per tape20–30 minutesnana20–30 minutes8–10 minutes (53 items)60–90 minutesnanana
na
nananananananananananananananananananananananananananananana
15–30 minutesnanana30–40 minutesnanaVariesApproximately 60–90 minutes5–7 minutes10-15 minutesnanananananananana20–30 minutesnana10–15 minutesnana20Long versions, 15–20 minutes; Short versions, 5–10 minutes; Auxiliary scales, 5–10 minutesna5–20 minutesLong versions, 15–20 minutes; Short versions, 5–10 minutes; Auxiliary scales, 5–10 minutes1 hour
na15 minutes–2.5 hoursna5–20 minutes per categorynananananananana30 minutes (10 minutes for Short version)10 minutes5–10 minutes30 minutesnanana10–20 minutes15 minutes; MASC-10 5 minutes
30 minutesna45–60 minutesnana20–30 minutes20 minutes30–60 minutes1 hour45 minutes10–20 minutes15–40 minutes5–10 minutes per subtest10–15 minutes90 minutes each part10 minutes20–30 minutes5–20 minutes60–90 minutes25 minutes (175 items)45–60 minutes (478 items)BSI: 8–10 minutes (53 items); BSI 18: 4 minutes20–45 minutes25 minutesna10–15 minutesna5–10 minutes
60 minutes or lessnavaries30–45 minutesBSI 8–10 minutes; BSI 18 4 minutesna15–20 minutesCDS–R, 20 minutes; Brief CDS, 5 minutesnana60–90 minutes45–60 minutes (478 items)45–60 minutes (478 items)10 minutes15 minutes15–20 minutes (10 minutes for the Short version)nanana30 minutes
5–7 minutesnana20 minutes
45–60 minutes (478 items)na60–90 minutes20–40 minutes30 minutesnanana35 to 45 minutesnanaLess than 3 minutes30–45 minutes10 minutesabout 20 minutesvaries15–20 minutes28 sessions over a 4-month period60–90 minutes45–60 minutes (478 items)45–60 minutes (478 items)45–60 minutes (478 items)12–15 minutes (90 items)5–10 minutes for each component45–90 minutes
na20–25 minutes (235 items)Approximately 5 minutesFull length, 20 to 30 minutes; Short Form, 10 minutes30 minutesnana5–10 minutesnanana20-30 minutesApproximately 30–40 minutes per sessionAbout 20 minutes per form15–20 minutesna30–40 minutesnanananananana45–60 minutes (478 items)
nana
nananananananananananananana25 minutes5-10 minutesna8–10 minutes (53 items)nanananananananananana30–45 minutesna45–60 minutes (478 items)30 minutes (160 items)naInterview section, 1.5–2 hourse; collateral review, 1 hour30 minutes20–30 minutesnana45–60 minutes (478 items)45–60 minutes (478 items)20–30 minutes (150 items)15–15 minutesn/a
30–45 minutes (235 items)15 minutes10–20 minutesover several sessionsnana30–40 minutes10 to 15 minutes (49 items)30–40 minutes
14 minutesn/a35–50 minutes60–90 minutes25 minutes (175 items)25 minutes (175 items)35–50 minutes
60–90 minutes35–50 minutes35 to 60 minutes60–90 minutesna
60–90 minutes35–50 minutes35–50 minutes
35–50 minutes35 to 60 minutes
3 - 5 minutes35–50 minutes20-30 minutes
ScoringOptions Featuredpaper-and-pencil, software 0paper-and-pencil and web 0na 0
0na 0na 0na 0paper-and-pencil 0paper-and-pencil 0na 0na 0na 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil 0software 0paper-and-pencil 0na 0
0Computer 0Mail-In Scoring service and Onsite Computer Scoring 0Hand scoring 0na 0
0paper-and-pencil and software 1
0paper-and-pencil 0na 0na 0na 0na 0paper-and-pencil, software, and web 0na 0na 0na 0na 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil 0na 0na 0na 0paper-and-pencil 0paper-and-pencil 0na 0na 0na 0na 0na 0na 0na 0na 0
0
paper-and-pencil 0Handscore, Mail-in, Software 0Hand-scoring, computer scoring 0Handscore, Mail-in, Software 0Hand Scoring, Computer Scoring, Mail-In Scoring Service 0Paper-and-Pencil 0Hand-scoring, Mail-in scoring service 0na 0Hand-scoring and web 0Mail-in 0Paper-and-Pencil 0Hand-scoring, Mail-in scoring 0
0Hand Scoring, Mail-In Scoring, and Computer Scoring 0Hand Scoring, Mail-In Scoring, and Computer Scoring 0Computer Scoring and Mail-In Scoring Service 0Computer Scoring 0Software 0
0Hand Scoring, Mail-In Scoring and Computer Scoring 0Hand Scoring, Mail-In Scoring and Computer Scoring 0Hand Scoring, Mail-In Scoring and Computer Scoring 0Computer scoring, mail-in 0
0Computer Scoring 0Hand Scoring, Computer Scoring, Mail-In Scoring Service 0Hand Scoring, Mail-In Scoring, and Computer Scoring 0Handscoring and mail-in scoring service 0Handscoring, computer scoring 0Handscoring, computer scoring 0Computer Scoring, MTQ™, and Mail-In Scoring Service 0Hand scoring 0Computer scoring 0Computer Scoring, MTQ™, and Mail-In Scoring Service 0Hand Scoring, Mail-In Scoring and Computer Scoring 0Computer Scoring, MTQ™, and Mail-In Scoring Service 0Handscoring, computer scoring and mail-in scoring service 0
0Handscoring, computer scoring and mail-in scoring service 0Computerized Scoring 0na 0
0n/a 0Hand Scoring, Computer Scoring, Mail-In Scoring Service 0asdf 0Paper-and Pencil, Computer 0na 0
0000000
Hand Scoring, Computer Scoring, Mail-In Scoring Service 0Computer 0
0Computer 0Computer 0na 0na 0
0Computer 0Software 0na 0Hand scoring 0na 0na 0Hand scoring 0Hand scoring, mail-in scoring 0Mail-in scoring service 0na 0na 0na 0
00
software 00
na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0
paper-and-pencil 0na 0na 0na 0paper-and-pencil 0na 0na 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil and software 0paper-and-pencil 0na 0na 0na 0na 0na 0na 0na 0na 0na 0paper-and-pencil 0na 0na 0paper-and-pencil 0paper-and-pencil 0na 0paper-and-pencil 0paper-and-pencil 0software 0paper-and-pencil 1software 0paper-and-pencil and software 0
0na 0paper-and-pencil 0na 0software 0na 0na 0na 0na 0na 0na 0na 0na 0paper-and-pencil, software, web 0paper-and-pencil, web 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil 0
Paper-and Pencil 0Hand scoring 0computer 0na 0na 0paper-and-pencil 0paper-and-pencil and software 0paper-and-pencil and software 0paper-and-pencil and software 0paper-and-pencil 0paper-and-pencil 0paper-and-pencil and software 0paper-and-pencil 0paper and pencil, software 0paper and pencil 0paper and pencil, software 0paper and pencil 0paper and pencil 0Hand-scoring, Mail-in scoring 0Hand-scoring, mail-in scoring service 0Handscore, Mail-in, Software 0Hand Scoring, Mail-In Scoring and MTQ™ Computer Scoring 0Computer 0paper and pencil 0na 0paper-and-pencil 0na 0paper and pencil 0paper and pencil 0paper and pencil 0na 0paper-and-pencil, software 0paper and pencil 0Hand-scoring and mail-in scoring 0na 0paper and pencil 0paper and pencil 0software 0software 0Hand-scoring, Mail-in scoring 0Handscore, Mail-in, Software 0Handscore, Mail-in, Software 0paper and pencil 0paper and pencil 0paper and pencil 0software 0na 0na 0Software 0
0paper and pencil, software 0paper and pencil, software 0na 0paper-and-pencil 0
Handscore, Mail-in, Software 0na 0software 0paper-and-pencil 0paper-and-pencil, web 0paper-and-pencil 0na 0na 0
0na 0software 0software 0software 0paper-and-pencil 0paper-and-pencil, software 0paper-and-pencil, software 0paper-and-pencil 0na 0Hand-scoring, Mail-in scoring 0Handscore, Mail-in, Software 0Handscore, Mail-in, Software 0Handscore, Mail-in, Software 0Hand-scoring, mail-in scoring 0Hand Scoring 0Paper-and-pencil 0
0na 0Hand-scoring, computer scoring 0Hand-scoring 0paper-and-pencil, software 0paper-and-pencil, web 0na 0na 0paper-and-pencil, software 0paper-and-pencil 0na 0na 0
0software 0paper-and-pencil, software 0Paper-and-pencil 0na 0paper-and-pencil 0na 0na 0na 0na 0na 0na 0na 0Handscore, Mail-in, Software 0
0na 0na 0
na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0Mail-in scoring 0Online 0na 0Hand scoring, mail-in scoring 0na 0na 0na 0na 0na 0na 0na 0na 0na 0na 0software 0software 0software 0Handscore, Mail-in, Software 0Hand Scoring, Computer Scoring, Mail-In Scoring Service 0na 0paper-and-pencil 1Mail-in 0Hand-scoring 0software 0software 0Handscore, Mail-in, Software 0Handscore, Mail-in, Software 0Computer Scoring, Mail-In Scoring Service 0Computer 0n/a 0
0Computer scoring and mail-in scoring service 0Paper-and-pencil 0Paper-and-pencil 0na 0na 0na 0Hand Scoring, Mail-In Scoring and Computer Scoring 0Hand Scoring, Computer Scoring 0Hand Scoring and Computer Scoring 0
computer 0paper-and-pencil 0Hand-scoring, Mail-in scoring 0Hand-scoring, mail-in scoring service 0Hand-scoring, Mail-in scoring service 0Hand-scoring, Mail-in scoring service 0Hand-scoring, Mail-in scoring 0
0Mail-in scoring service 0Hand-scoring, Mail-in scoring 0Mail-in scoring 0Hand-scoring, Mail-in scoring service 0na 0
00
Hand-scoring, Mail-in scoring service 0Hand-scoring, Mail-in 0Hand-scoring, Mail-in 0
0Mail-in scoring 0Mail-in scoring 0
000
Paper-and-pencil, Online 0Mail-in scoring 0
00
AuthorDon Andrews, Ph.D. & James Bonta, Ph.D.Robert D. Hare, Ph.D. & Hugues F. Hervé, M.A.Bill Borcherdt, ACSW, BCD
Peg Dawson, Ed.D.William Benninger, Ph.D.Michael B. First, M.D.Robert D. Hare, Ph.D.John D. Mayer, Ph.D., Peter Salovey, Ph.D., & David R. Caruso, Ph.D.Thomas Grisso, Ph.D.J. Reid Meloy, Ph.D.Edited by Gail Ryan & Sandy LaneP. Randall Kropp, Ph.D., Stephen D. Hart, Ph.D., Christopher D. Webster, Ph.D., & Derek Eaves, M.BPaul J. Frick, Ph.D., & Robert D. Hare, Ph.D.Brenda Myles, Ph.D, Stacy Jones-Bock, Ph.D, & Richard Simpson, Ph.D.James Choca, Ph.D., Linda Laatsch, Ph.D., Dan Garside, & Carl ArnemannMaria Kovacs, Ph.D.Muriel Deutsch Lezak, Ph.D.
C. Keith Conners, Ph.D. and MHS StaffJ. M. Schuerger, Ph.D.Brian Kowalchuk, Ph.D., & John D. King, Ed.D.Edited by J. Reid Meloy, Ph.D.
Reuven Bar-On, Ph.D.
Gerard A. Gioia, Ph.D., Peter K. Isquith, Ph.D., Steven C. Guy, Ph.D., & Lauren Kenworthy, Ph.D.William Winogron, Ph.D., Marilyn Van Dieten, Ph.D., Laurence Gauzas, Ph.D., & Vicki Grisim, M.Ed.Steven J. Stein, Ph.D. & Howard E. Book, M.DDaniel Goleman Ph.D., Richard Boyatzis B. A., & Annie McKeeDaniel Goleman, Ph.D.Carl F. Jesness, Ph.D.Edited by Albert R. Roberts; Foreword by Judge Marjory D. FieldsVariousRobert D. Hare, Ph.D.Theodore Millon, Ph.D., Erik Simonsen, M.D., Morten Birket-Smith, M.D., & Roger D. Davis, Ph.D.Stephen Saunders, Ph.D. & James Wojcik, Ph.D.Norman S. Endler, Ph.D. & James D. A. Parker, Ph.D.Glen D. Greenberg, Ph.D. & Rolf A. Peterson, Ph.D.David T. Bradford, Ph.D.Roger L. Greene, Ph.D.James N. Butcher, Ph.DJ. Douglas Salmon, Jr., Ph.D. & Marek Celinski, Ph.D.Raymond B. Cattell, Ph.D., D.Sc., A. Karen Cattell, & Heather E. P. Cattell, Ph.D.J. Reid Meloy, Ph.D.Joseph T. McCann, Psy.D., J.D.Marc J. Ackerman, Ph.D.Irving B. Weiner, Ph.D.Don Andrews, Ph.D. & James Bonta, Ph.D.Adrian Raine, Ph.D.Kirk Heilbrun, Geoffrey R. Marczyk, & David DeMatteoEdited by Robert J. McCaffrey, Arthur D. Williams, Jerid M. Fisher, & Linda C. LaingAdelle Forth, Ph.D., David Kosson, Ph.D., & Robert D. Hare, Ph.D.
Carina Coulacoglou, Ph.D.Starke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuSASSI InstituteStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuTheodore Millon, Ph.D., with Carrie Millon, Ph.D., & Roger DavisDonald D. Hammill, Ed.D., Nils A. Peterson, Ph.D., & Judith K. Voress, Ph.D.C. David Tollison, Ph.D. & Jerry C. Langley, D.C.Joseph T. McCann, Psy.D., J.D. & Frank Dyer, Ph.D. Foreword by Theodore MillonReuven Bar-On, Ph.D. & Rich Handley, Ph.D.Virgil R. Long, Ph.D.Donald D. Hammill, Ed.D., Nils A. Peterson, Ph.D., & Judith K. Voress, Ph.D.Raymond B. Cattell, PhD., D.Sc., A. Karen Cattell, & Heather E. P. Cattell, Ph.D.
Daniel Bruns, Psy.D. & John Disorbio, Ed.D, with contributions by Julia Copeland Disorbio, P.T.Daniel Bruns, Psy.D. & John Disorbio, Ed.D, with contributions by Julia Copeland Disorbio, P.T.Theodore Millon, Ph.D., Catherine J. Green, Ph.D., & Robert B. Meagher, Jr., Ph.D.Charles B. Johansson, Ph.D.NCS
Daniel Bruns, Psy.D. & Mark Disorbio, Ed.D. with contributions by Julia Copeland Disorbio, P.T.Daniel Bruns, Psy.D. & Mark Disorbio, Ed.D. with contributions by Julia Copeland Disorbio, P.T.Daniel Bruns, Psy.D. & Mark Disorbio, Ed.D. with contributions by Julia Copeland Disorbio, P.T.Charles B. Johansson, Ph.D.
Charles B. Johansson, Ph.DTheodore Millon, Ph.D., with Carrie Millon, Ph.D.Daniel Bruns, Psy.D. & John Disorbio, Ed.D, with contributions by Julia Copeland Disorbio, P.T.J. L., Horn, Ph.D., K. W. Wanberg, Ph.D., & F. M. Foster, M.S.n/an/aTheodore Millon, Ph.D., Catherine J. Green, Ph.D., & Robert B. Meagher, Jr., Ph.D.James E. Gillam, Ph.D.
Theodore Millon, Ph.D., Catherine J. Green, Ph.D., & Robert B. Meagher, Jr., Ph.D.John Mark Disorbio, Ed.D, & Daniel Bruns, Psy.D.Theodore Millon, Ph.D., Catherine J. Green, Ph.D., & Robert B. Meagher, Jr., Ph.D.J. L., Horn, Ph.D., K. W. Wanberg, Ph.D., & F. M. Foster, M.S.
J. L., Horn, Ph.D., K. W. Wanberg, Ph.D., & F. M. Foster, M.S.C. Keith Conners, Ph.D. & MHS StaffSally Ozonoff, Ph.D., Geraldine Dawson, Ph.D., & James McPartland
Cecil R. Reynolds, Ph.D.Theodore Millon, Ph.D., Catherine J. Green, Ph.D., & Robert B. Meagher, Jr., Ph.D.asdfVariousVarious
Theodore Millon, Ph.D., Catherine J. Green, Ph.D., & Robert B. Meagher, Jr., Ph.D.Michael B. First, M.D., Miriam Gibbon, M.S.W., Janet B. W. Williams, D.S.W., Robert L. Spitzer, M.D
Michael B. First, Ph.D., Miriam Gibbon, M.S.W., Janet B. W. Williams, D.S.W., & Robert L. Spitzer, MMichael B. First, Ph.D., Miriam Gibbon, M.S.W., Janet B. W. Williams, D.S.W., & Robert L. Spitzer, MCTI Canadian Training InstituteMartin E. P. Seligman, Ph.D.
Michael B. First, Ph.D., Miriam Gibbon, M.S.W., Janet B. W. Williams, D.S.W., & Robert L. Spitzer, MReuven Bar-On, Ph.D. & MHS StaffVirginia P. Williams, Ph.D. & Redford W. Williams, M.D.Richard R. Abidn, Ed.D.Gary B. Melton, Ph.D., John Petrila, JD, LL.M, Norman G. Poythress, A.B., Ph.D., & Chrisotpher SlobJames N. Butcher, Ph.D. & Carolyn L. Williams, Ph.D.Richard R. Abidn, Ed.D.Leonard R. Derogatis, Ph.D.Starke R. Hathaway, Ph.D., & J. Charnley McKinley, M.D. Restandardisation Committee: James N. BTom Tombaugh, Ph.D.Joel Walker, M.D.James N. Butcher, Ph.D., Editor
Michael B. First, M.D., Robert L. Spitzer, M.D., Miriam Gibbon, M.S.W., Janet B. W. Williams, D.S.W.
Barry Bricklin, Ph.D.John E. Douglas, Ann W. Burgess, Allen G. Burgess, & Robert K. ResslerJay Ziskin, Ph.D., LL.B.Stanley L. Brodsky, Ph.D.Edited by Robert T. Ammerman, Ph.D. & Michel Hersen, Ph.D.Richard Rogers, Ph.D., A.B.P. P. & Daniel W. Shuman, J.D.Edited by Stephen J. Ceci, Ph.D., & Helene Hembrooke, Ph.D.Edited by James McGuire, Ph.D., Tom Mason, Ph.D., & Aisling O’Kane, M.Sc.Rebecca Milne, Ph.D., & Ray Bull, Ph.D.Edited by Clive R. HollinRobert M. Wettstein, M.D.Edited by Sheilaugh Hidgins, Ph.D., & Rüdiger Müller-IsbernerJ. Reid Meloy, Ph.D.Windy Dryden, Ph.D.Davis S. Nichols, Ph.D.Edited by Howard Kassinove, Ph.D.Carl B. Gacono, Ph.D. & J. Reid Meloy, Ph.D.Jalal Shamsie, M.B., FRCPC, Sorrel Nicholl, B.A., & Kirsten C. Madsen, Ph.D.James Garbarino, Ph.D.Kenneth S. Pope, Ph.D., James N. Butcher, Ph.D., & Joyce Seelen, B.A., J.D.John R. Graham, Ph.D.Robert P. Archer, Ph.D.Edited By J. Reid Meloy, Ph.D.Robert D. Hoge, Ph.D. & D. A. Andrews, Ph.D.David L. Shapiro, Ph.D.Thomas Grisso, Ph.D.Richard A. Gardner, M.D.Katie Evans, Ph.D. & J. Michael Sullivan, Ph.D.Michael B. First, M.D., Editor, DSM-IV™ Text and CriteriaWilliam L. Marshall, Ph.D., Dana Anderson, M.A., & Yolanda Fernandez, M.A.
Nadine Lambert, Ph.D., Kazuo Nihira, Ph.D., & Henry Leland, Ph.D.Arthur D. Anastopoulos, Ph.D. & Terri L. Shelton, Ph.D.Russell A. Barkley, Ph.D.James N. Butcher, Ph.D.R. D. Hoge, Ph.D. & D. A. Andrews, Ph.D.Kathleen Coulborn Faller, Ph.D., A.C.S.W.Kathleen Coulborn Faller, Ph.D., A.C.S.W.Jerry P. Nims, Ph.D., J.D.Ron Langevin, Ph.D. & Dan Paitich, Ph.D.Delroy L. Paulhus, Ph.D.Reuven Bar-On, Ph.D.C. Keith Conners, Ph.D. & Juliet L. Jett, Ph.D.C. Keith Conners, Ph.D.Barbara D. Ingersoll, Ph.D. & Sam Goldstein, Ph.D.Sam Goldstein Ph.D. & Michael Goldstein, M.D.Karen C. Wells, Ph.D.Harvey C. Parker, Ph.D.William Benninger, Ph.D.Rick D’Alli, M.D. with C. Keith Conners, Ph.D., & John S. March, M.D.Russell A. Barkley, Ph.D.Jotham Friedland, Ph.D., Harvey Mandel, Ph.D., & Sander Marcus, Ph.D.Edited by John S. March, M.D.Deborah C. Beidel, Ph.D. & Samuel M. Turner, Ph.D.R. Dean Coddington, M.D.Peg Dawson, Ed.D. & Richard Guare, Ph.D.David Schopick, M.D.C. Keith Conners, Ph.D. & John S. March, M.D.C. Keith Conners, Ph.D.L. Michael Honaker, Ph.D. & Thomas Harrell, Ph.D.C. Keith Conners, Ph.D.C. Keith Conners, Ph.D.Donald D. Hammill, Ed.D., Nils A. Pearson, Ph.D., & J. Lee Wiederholt, Ph.D.
Sally Ozonoff, Ph.D., Geraldine Dawson, Ph.D., & James McPartlandDonald D. Hammill, Ed.D. & Brian R. Bryant, Ph.D.Edited by Peter M. Monti, Ph.D. Suzanne M. Colby, Ph.D. & Tracy A. O’Leary, Ph.D.Wendy Reich, Ph.D., Zila Welner, M.D., Barbara Herjanic, M.D., & MHS StaffNancy Mather, Ph.D. & Sam Goldstein, Ph.D.Barry T. Christian, Ph.D.Kris Mohandie, Ph.D.Ann Vernon, Ph.D.Sam Goldstein, Ph.D.Peter Salovey, Ph.D. & David J. Sluyter, Ed.D.Lawrence E. Shapiro, Ph.D.Lynn Clark, Ph.D.Reuven Bar-On, Ph.D. & James D.A. Parker, Ph.D.Joseph H. Beitchman, M.D.James E. Gilliam, Ph.D.J. Lee Wiederholt, Ph.D. & Brian R. Bryant, Ph.D.Myrna B. Shure, Ph.D.Myrna B. Shure, Ph.D.Myrna B. Shure, Ph.D.Donald D. Hammill, Ed.D. & Brian R. Bryant, Ph.D.John S. March, M.D.
Mark E. Swerdlik, Ph.D., Peggy Swerdlik, M.S.Ed., Jeffery H. Kahn, Ph..D., & Tim Thomas, M.A.Charles B. Johansson, Ph.D.Robert P. Archer, Ph.D.Carolyn S. Schroeder, Ph.D. & Betty N. Gordon, Ph.D.John S. March, M.D. & Karen Mulle, B.S.N., M.T.S., M.S.W.Samuel M. Turner, Ph.D., Deborah C. Beidel, Ph.D., & Tracy L. Morris, Ph.D.Charles Spielberger, Ph.D.Donald Hammill, Ed.D. & Phyllis Newcomer, Ph.D.Phyllis Newcomer, Ph.D. & Donald Hammill, Ed.D.Cecil R. Reynolds, Ph.D. & Erin D. Bigler, Ph.D.Morrison F. Gardner, Ed.D.Gary Wilkinson, Ph.D. and Gary J. Robertson, Ph.D.Wayne Adams, Ph.D. & David Sheslow, Ph.D.C. Keith Conners, Ph.D., Drew Erhardt, Ph.D., & Elizabeth Sparrow, Ph.D.Jeff Epstein, Ph.D., Diane Johnson, Ph.D., & C. Keith Conners, Ph.D.Charles D. Spielberger, Ph.D.Samuel M. Turner, Ph.D., Deborah C. Beidel, Ph.D., & Constance V. Dancu, Ph.D.Linda Brown Ph.D., Rita J. Sherbenou Ph.D., & Susan K. Johnsen, Ph.D.Starke R. Hathaway, Ph.D., & J. Charnley McKinley, M.D. Restandardisation Committee: James N. BTheodore Millon, Ph.D., D.Sc. with Carrie Millon, Ph.D., & Roger DavisStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuLeonard R. Derogatis, Ph.D.Michael B. First, Ph.D., Miriam Gibbon, M.S.W., Janet B. Williams, D.S.W., & Robert L. Spitzer, M.D.Norman S. Endler, Ph.D., F.R.S.C., Jean M. Edwards, Ph.D., & Romeo Vitelli, Ph.D.Robert K. Heaton, Ph.D., Igor Grant, M.D., & Charles G. Matthews, Ph.D.William C. Culbertson, Ph.D. & Eric A. Zillmer, Psy.D.J. Douglas Salmon, Jr., Ph.D.Marshal F. Folstein, M.D., Susan E. Folstein, M.D., Paul R. McHugh, M.D., & Gary Fanjiang, M.D.J. Douglas Salmon Jr., Ph.D.James P. Schmidt, Ph.D. & Tom N. Tombaugh, Ph.D.J. Douglas Salmon Jr., Ph.D.Thomas Harrell, Ph.D. & L. Michael Honaker, Ph.D.Anita M. Hubley, Ph.D. & Tom N. Tombaugh, Ph.D.Leonard R. Derogatis, Ph.D.Irving B. Weiner, Ph.D.Tom N. Tombaugh, Ph.D.Bernard Carroll, M.B., Ph.D.L. Michael Honaker, Ph.D.L. Michael Honaker, Ph.D.Starke R. Hathaway, Ph.D., & J. Charnley McKinley, M.D. Restandardisation Committee: James N. BStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuJonathan Davidson, M.D.David R. Cook, Ed. D.Thomas J. D’Zurilla, Ph.D., Arthur M. Nezu, Ph.D., & Albert Maydeu-Olivares, Ph.D.L. Michael Honaker, Ph.D. & Thomas Harrell, Ph.D.Stephen E. Finn, Ph.D.Edited by Theodore Millon, Ph.D., D.Sc.Reuven Bar-On, Ph.D. & MHS Staff
Ronald R. Holden, Ph.D.John E. Exner, Jr., Ph.D., & Irving B. Weiner, Ph.D.Marlene Steinberg, M.D.Peter L. Sheras, Ph.D. & Richard R. Abidin, Ed.D.
Starke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuJames P. Choca, Ph.D. & Eric Van Denburg, Ph.D.Roger L. Greene, Ph.D., Robert C. Brown, Jr., Ph.D., & Rebecca E. KovanCecil R. Reynolds, Ph.D. & Erin D. Bigler, Ph.D.John M. Oldham, M.D. & Lois B. MorrisMarlene Steinberg, M.D.Marlene Steinberg, M.D.Michael B. First, M.D. Editor, DSM-IV™ Text and CriteriaPaul T. Costa, Jr., Ph.D., & Robert R. McCrae, Ph.D.Edited by Joseph Ciarrochi, Ph.D., Joseph P. Forgas, Ph.D., & John D. Mayer, Ph.D.Michael B. First, M.D., Janet B. W. Williams, D.S.W., Robert L. Spitzer, M.D., & MHS StaffMichael B. First, M.D. & MHS StaffGiles D. Rainwater, Ph.D., Debora Silver Coe, Psy.D., & MHS StaffNorman Endler, Ph.D. & James D. A. Parker, Ph.D.L. Michael Honaker, Ph.D., Thomas Harrell, Ph.D., & Anthony Ciminero, Ph.D.Strategic Advantages Inc. (paper-and pencil) and MHS Staff (software)Myrna Weissman, Ph.D.Samuel M. Turner, Ph.D., Deborah C. Beidel, Ph.D., & Michele R. Cooley-Quille, Ph.D.Starke R. Hathaway, Ph.D., & J. Charnley McKinley, M.D. Restandardisation Committee: James N. BStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuLeonard R. Derogatis, Ph.D.Holly Tukko, Ph.D., Thomas Hadjistavropoulos, Ph.D., Jo Ann Miller, Ph.D., Annette Horton, M.D., & Michael B. First, M.D., Robert L. Spitzer, M.D., Miriam Gibbon, M.S.W., & Janet B. W. Williams, D.S.
Jeffery E. Young, Ph.D.Theodore Millon, Ph.D. Michael Antoni, Ph.D., Carrie Millon, Ph.D., Sarah Meagher, M.S., & Seth GMichael B. Frisch, Ph.D.Richard R. Abidin, Ed.D.David Evans, Ph.D. & Wendy Cope, M.A.Thomas Budzynski, Ph.D.Haig J. Kojian, Ph.D.Graham Spanier, Ph.D.William M. Glazer, M.D.Rex Samuel, D.C.P., C. Psych.Michele Novotni, Ph.D.Carl F. Jesness, Ph.D.VariousHarvey A. Skinner, Ph.D., Paul D. Steinhauer, M.D., & Jack Santa-Barbara, Ph.D.Human Resources Development CanadaLisa Feldman Barrett, Ph.D., & Peter Salovey, Ph.D. Foreword by John D. Mayer, Ph.D.Stanley R. Kay, Ph.D., Lewis A. Opler, M.D., Ph.D., & Abraham Fiszbein, M.D.Hermann Rorschach, M.D.; John E. Exner, Jr., Ph.D.Henry A. Murray, Ph.D.Edited by Christopher D. Webster, Ph.D. & Margaret A. Jackson, Ph.D.Otfried Spreen, Ph.D. & Esther Strauss, Ph.D.Holly Tuokko, Ph.D. & Thomas Hadjistavropoulos, Ph.D.Robert M. Anderson, Jr., Ph.D.Nancy Hebben, Ph.D. & William Milberg, Ph.D.Starke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. Bu
James N. Butcher, Ph.D.Irving B. Weiner, Ph.D.
Elkhonon Goldberg, Ph.D.Kalyna Z. Bezchilbnyk-Butler, B.Sc., Phm., & Joel J. Jeffries, M.B.Theodore Millon, Ph.D.American Psychiatric AssociationEdward L. Zuckerman, Ph.D.Gerald P. Koocher, Ph.D., John C. Norcross, Ph.D., & Sam S. Hill III, Psy.D.William R. Miller, Ph.D. & Stephen Rollnick, Ph.D.Michael C. Ramsay, Ph.D., Cecil R. Reynolds, Ph.D., & R. W. Kamphaus, Ph.D.Myrna Weissman, Ph.D., John C. Markowitz, M.D., & Gerald Klerman, M.D.Edited by Richard Rogers, Ph.D., A.B.P.P.Benjamin M. Ogles, Ph.D. Michael J. Lambert Ph.D., & Scott A. Fields, M.A.Edited by Mark E. Maruish, Ph.D.Marlene Steinberg, M.D.Edited by Gordon L. Flett, Ph.D. & Paul L. Hewitt, Ph.D.David Campbell, Ph.D.Martin E.P. Seligman, Ph.D.naLeonard R. Derogatis, Ph.D.Edited by Frank M. Dattilio, Ph.D. & Arthur Freeman, Ed.D.June Price Tangney, Ph.D. & Ronda L. Dearing, Ph.D.Alan S. Bellack, Ph.D., Kim T. Mueser, Ph.D., Susan Gingerich, M.S.W., & Julie Agresta, M.S.S.Leopold Bellak, M.D. & David Abrams, Ph.D.Alan S. Kaufman, Ph.D. & Elizabeth O. Lichtenberger, Ph.D.John M. Oldham, M.D. & Lois B. MorrisNancy Norvell, Ph.D. & Dale Belles, Ph.D.Howard Kassinove, Ph.D., ABPP & Raymond Chip Tafrate, Ph.D.Charles A. Peterson, Ph.D.Tara Rose, Nancy Kaser-Boyd, Ph.D., & Michael P. Maloney, Ph.D.MHS StaffMichael B. First, M.D., Miriam Gibbon, M.S.W., Janet B. W. Williams, D.S.W., Robert L. Spitzer, M.DMHS StaffStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuTheodore Millon, Ph.D., with Carrie Millon, Ph.D., & Roger DavisJames N. Butcher, EditorRobert D. Hare, Ph.D.Richard I. Frederick, Ph.D.A. Ralph Hakstian, Ph.D. & Raymond B. Cattell, Ph.D., D.Sc.MHS StaffMHS StaffStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuStarke R. Hathaway, Ph.D. & J. Charnley McKinley, M.D. Restandardization Committee: James N. BuTheodore Millon, Ph.D., Catherine J. Green, Ph.D., & Robert B. Meagher, Jr., Ph.D.C. Keith Conners, Ph.D., Drew Erhardt, Ph.D., Elizabeth Sparrow, Ph.D., & MHS Staffn/a
Ronald A. Giannetti, Ph.D.Peter J. LaFreniere, Ph.D. & Jean E. Dumas, Ph.D.Richard L. Slosson, M.A.; revised by Charles L. Nicholson, Ph.D. & Terry L. Hibpshman, M.A.; SuppRon Davis, Ph.D. & William Phillips, B.Sc., B.A.A.John Monahan,Ph.D., Henry J. Steadman,Ph.D., Eric Silver,Ph.D., Paul S. Applebaum,M.D., Pamela Roger L. Greene, Ph.D.John Mark Disorbio, Ed.D, & Daniel Bruns, Psy.D.Edna B. Foa, Ph.D.Jack Naglieri, Ph.D. and Achilles N. Bardos, Ph.D.
C. Keith Conners, Ph.D. and MHS StaffPaul J. Frick, Ph.D. & Robert D. Hare, Ph.D.Raymond B. Cattell, Ph.D., D.Sc., A Karen Cattell, & Heather E. P. Cattell, Ph.D.Starke R. Hathaway, Ph.D., & J. Charnley McKinley, M.D. Restandardisation Committee: James N. BTheodore Millon, Ph.D., D.Sc. with Carrie Millon, Ph.D., & Roger DavisTheodore Millon, Ph.D., D.Sc. with Carrie Millon, Ph.D., & Roger DavisRaymond B. Cattell, Ph.D., D.Sc., A Karen Cattell, & Heather E. P. Cattell, Ph.D.
Starke R. Hathaway, Ph.D., & J. Charnley McKinley, M.D. Restandardisation Committee: James N. BRaymond B. Cattell, Ph.D., D.Sc., A Karen Cattell, & Heather E. P. Cattell, Ph.D.Raymond B. Cattell, Ph.D., D.Sc., A. Karen S. Cattell, & Heather E. P. Cattell, Ph.D.Starke R. Hathaway, Ph.D., & J. Charnley McKinley, M.D. Restandardisation Committee: James N. BEdited by C. Keith Conners, Ph.D., John S. March M.D., Allen Frances, M.D., Karen C. Wells, Ph.D.,
Starke R. Hathaway, Ph.D., & J. Charnley McKinley, M.D. Restandardisation Committee: James N. BRaymond B. Cattell, Ph.D., D.Sc., A. Karen S. Cattell, & Heather E. P. Cattell, Ph.DRaymond B. Cattell, Ph.D., D.Sc., A. Karen S. Cattell, & Heather E. P. Cattell, Ph.D
Raymond B. Cattell, Ph.D., D.Sc., A. Karen S. Cattell, & Heather E. P. Cattell, Ph.D.Raymond B. Cattell, Ph.D., D.Sc., A. Karen S. Cattell, & Heather E. P. Cattell, Ph.D.
Maurice Lorr, Ph.D., Douglas M. McNair, Ph.D., & JW P. Heuchert, Ph.D.Raymond B. Cattell, Ph.D., D.Sc., A. Karen S. Cattell, & Heather E. P. Cattell, Ph.D.Carl F. Jesness, Ph.D.
LanguagesEnglish, Spanish (U.S.)EnglishEnglish
EnglishEnglishEnglishMultiple translations availabletranslations availableEnglishEnglishEnglishEnglishEnglishEnglishEnglishMultiple translations availableEnglish
EnglishEnglishEnglishEnglish
translations available
EnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish and FrenchEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish
EnglishEnglishEnglishEnglishEnglish, SpanishEnglishEnglishEnglishEnglishEnglishEnglishEnglish
English, SpanishEnglish, SpanishEnglish, SpanishEnglish, French, Spanishn/a
English, French, SpanishEnglish, French, SpanishEnglish, French, SpanishEnglish, French, Spanish
English, French, SpanishEnglish, SpanishEnglish, SpanishEnglishEnglishEnglishEnglish, SpanishEnglishEnglishEnglish, SpanishEnglishEnglish, SpanishEnglish
EnglishEnglishEnglish
EnglishEnglish, SpanishasdfEnglishEnglish
English, SpanishEnglish
EnglishEnglishEnglish, FrenchEnglish
EnglishVariousEnglishFrenchEnglishEnglishFrenchEnglish, SpanishEnglishEnglishEnglishEnglish
English
EnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish
EnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish, French (Canadian)EnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishMultiple translations availableEnglishMultiple translations availableEnglishEnglish
EnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishMultiple Translations AvailableEnglishEnglishEnglishEnglishEnglishEnglishEnglishMutiple translations available
EnglishEnglish, SpanishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishTranslations availableEnglishEnglishTranslations availableEnglishEnglish, SpanishEnglish, Spanish, French (Canadian)EnglishEnglish, French (Canadian) and SpanishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish, French, and SpanishEnglishEnglishEnglishEnglishEnglishEnglish, SpanishEnglishEnglishtranslations availableEnglishEnglish and SpanishEnglishEnglishEnglishVarious
EnglishEnglishEnglishEnglish
EnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish and SpanishEnglishEnglishEnglishEnglishMultiple translations availableEnglishEnglishMultiple translations availableEnglishEnglish, SpanishEnglishEnglishEnglishEnglish, French, SpanishEnglishEnglish
EnglishEnglishEnglishEnglish and French (Canadian)EnglishEnglishEnglishEnglishEnglishEnglishEnglish
EnglishMultiple translations availableEnglish, FrenchEnglishMultiple translations availableEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish
EnglishEnglish
EnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish, SpanishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish and SpanishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglishEnglish, SpanishEnglishn/a
EnglishEnglishasdfEnglishEnglishEnglishEnglishEnglishEnglish, Spanish
EnglishEnglishEnglishEnglish, Spanish, FrenchEnglish, French (Canadian), SpanishEnglish, French (Canadian), SpanishEnglish
EnglishEnglishEnglishEnglish, French, SpanishEnglish
English, French, SpanishFrenchFrench
EnglishEnglish
EnglishEnglish
InvtID InvtdescrCAR13D CAARS-O:SV QuikScore FormsCPTW40 CPT II (unlimited use) Plus K-CPT PreviewCRS70J Spanish CASS:S Quikscore Forms (25/pkg)DTS3PB DTS Quikscore FormsEQYV50 BarOn EQ-i:YV Specimen SetHSG10A Homework Survival Guide: Parent HandoutLS8P0F LSI-R ColorPlot ProfilesOB1R0A Outrageous Behavior ModificationPSP2PD PSP Quikscore/Interpretation GuidesSO4R0A SOS! Help for EmotionsUMCC0A Understanding & Managing Child.Classroom BehaviorXPDSW0 PDS for Windows ReportPSP3PC PSP Item BookletsPSP4PD PSP QuikScore FormsPSP5PE PSP Specimen SetPSP6PD PSP Interpretation GuidesPTRT10 Perfectionism:Theory,Research,and TreatmentPTSK1 MHS Professional Tool Suite Kit (with documentation)QL1P0A QLQ Complete KitQL1S0B QLQ Specimen SetQL2P0D QLQ Quikscore FormsQL2PSD QLQ Quikscore Forms-SinglesQL3P0C QLQ ManualQL4P0D QLQ QuikScore FormsQL5P0E QLQ Question BookletsQL5PSE QLQ Question Booklets SinglesRA1R0A Rorschach Assessment of Aggressive & PsychopathicRCL1PC RCL KitRCL2PA RCL User's ManualRCL3PB RCL QuikScore FormsRE10PA Work-Related IssuesRE11PA Muscle Contraction HeadachesRE12PA Rehabillitation Preview PackageRE1P0A Anger ManagementRE2P0A Anxiety, Moodiness, Irritability, & SaddnessRE3P0A Communicating your Symptoms to OthersRE4P0A Dizziness Following an InjuryRE5P0A Coping with Pain and Neg.ThinkingRE6P0A Why Does Recovery Take So Long?RE7P0A Coping With Sleep DifficultiesRE8P0A Stress Personal ResourcesRE9P0A Concentration, Memory, & Thinking DifficultiesRI1W00 RIAP4 Plus for Windows (CD-ROM)RIAPS RIAP4 Plus:S (CD-ROM)RL1P0A Rorschach Location ChartsRMRKVA Restless Minds.Restless KidsRP1P0A Rorschach Psychodiagnostic Test PlatesRQ1P0A Rorschach QuikguideRR1P0A Rorschach Recording BlanksRRA1R0 Rethinking Risk AssessmentRSP01 R-SOPAC Complete KitRSP03 R-SOPAC Technical ManualRSP04 R-SOPAC QuikScore Forms
RSP05 R-SOPAC QuikScore FormsRT100A Relaxation Training ProgramRT1W0A The Rorschach Trainer (Windows) (DISCONT)RT200A Relaxation Training ProgramRTCW1R Raising a Thinking Child Workbook (S/C)SA1P0A SARA Complete KitSA1PSD SARA Specimen SetSA2P0B SARA ManualSA3P0C SARA Assessment FormsSA410A SA-45 KitSA420B SA-45 Technical ManualSA430C SA-45 QuikScore FormsSA44SH SA-45 Specimen SetSA4P0C SARA Assessment FormsSA5P00 SARA Checklist FormsSA6P00 SARA Checklist FormsSAGL10 Shame and GuiltSASKT0 SAS-SR Complete KitSASP10 SAS-SR User's ManualSASP40 SAS-SR QuikScore FormsSASP50 SAS-SR QuikScore FormsSASP60 SAS-SR Question BookletsSASPS0 SAS-SR Specimen SetSASS10 Spanish SAS-SR QuikScore Forms (25/pkg)SASS20 Spanish SAS-SR QuikScore Forms (100/pkg)SASS30 Spanish SAS-SR Question Booklets (10/pkg)SC2D0A SCID-D Interviewer's GuideSC3D0A SCID-D FormsSC4D0A SCID-D Starter KitSCBE10 SCBE Complete KitSCBE20 SCBE ManualSCBE30 SCBE AutoScore FormsSCID1A SCID-I:CV Starter KitSCID2A SCID-I:CV User's GuideSCID3A SCID-I:CV Administration BookletSCID4A SCID-I:CV ScoresheetsSCID5A SCID-II Starter KitSCID6A SCID-II User's GuideSCID7A SCID-II Questionnaire with InterviewSCP1RA Shy Children,Phobic Adults H/CSETMNC SET Therapist's GuideSETW1B SET WorkbooksSETW2B SET WorkbooksSIPA10 SIPA Introductory KitSIPA20 SIPA ManualSIPA30 SIPA Item BookletsSIPA40 SIPA Handscorable Answer Sheet/Profile FormsSIT10A SIT-R3 ManualSIT20A SIT-R3 Score SheetsSIT30A SIT-R3 Technical ManualSM1R0A Stress Management Training: Leader's GuideSP1P0A SPAI Complete KitSP2P0B SPAI ManualSP3P0C SPAI Quikscore Forms
SP3PSC SPAI Quikscore Forms (Singles)SP4P0C SPAI Quikscore FormsSP5P0D SPAI Specimen SetSPAN01 Complete DTS/SPAN KitSPAN02 SPAN Complete KitSPAN03 SPAN Forms (pad of 100 forms)SPC10A SPAI-C Complete KitSPC20B SPAI-C ManualSPC30C SPAI-C Quikscore forms (25/pkg)SPC40D SPAI-C Specimen SetSPC6SP Spanish SPAI-C QuikScore FormsSPS01 SPSI-R Complete KitSPS02 SPSI-R:L Long Version KitSPS03 SPSI-R:S Short Version KitSPS04 SPSI-R Specimen SetSPS05 SPSI-R Technical ManualSPS06 SPSI-R:L QuikScore FormsSPS07 SPSI-R:L QuikScore FormsSPS08 SPSI-R:S QuikScore FormsSPS09 SPSI-R:S QuikScore FormsSS2W3F Session Summary Kit for WindowsSSA010 What Does Everybody Else Know that I Don't?SSR1RA Social Skills Training for SchizophreniaST1P0E STAI KitST2P0C STAI QuestionnairesST4P0H STAI BibliographySTAID0 STAIC Preview VersionSTAIE0 STAIC Computer Data Entry SheetsSTAIW0 STAIC for Windows Profile ReportsSVTM1R School Violence Threat ManagementSW4S0A Digital StopwatchSW4STA Stepwatch: TimerTAT10A TAT KitTCA1RA Taking Charge of ADHDTCS1RA TAT CAT & SAT in Clinical UseTCSAVA Testifying About Child Sexual Abuse (Video)TD1P0C TD Monitor ManualTD2P0A TD Monitor Complete KitTD2W3F Termination/Discharge Summary Kit for WindowsTD3P0B TD Monitor Specimen SetTD5P0E TD Monitor Modified Webster QuikScore FormsTD5PSE TD Monitor Mod.Webster Q/S - SinglesTD6P0F TD Monitor History FormsTEB1R0 The Executive BrainTFB1R0 Thinking,Feeling,Behaving Grades 1-6TFB2R0 Thinking,Feeling,Behaving Grades 7-12TI1A0A Tropical Island Paradise Relaxation (Audiotape)TI1P0Q Conners' Teacher Info FormsTLI4PA TOLD-I:3 Complete KitTLI5PA TOLD-I:3 ManualTLI6PA TOLD-I:3 Profile/Examiner Record FormsTLI7PA TOLD-I:3 Picture BookTLIMAA TOLD-I:3 Pro-Score for MacintoshTLIW0A TOLD-I:3 Pro-Score for Windows
TLP1PA TOLD-P:3 Complete KitTLP2PA TOLD-P:3 Examiner's ManualTLP3PA TOLD-P:3 Profile/Examiner Record FormsTLPMAA TOLD-P:3 Pro-Score for MacintoshTLPW0A TOLD-P:3 Pro-Score for WindowsTLRP1 TOL-DX Complete KitTLRP2 TOL-DX ManualTLRP3 TOL-DX Child Recording FormsTLRP4 TOL-DX Adult Recording FormsTLRPA TOL-DX Complete Adult KitTLRPC TOL-DX Complete Child KitTN6P0A TONI-3 Complete KitTN8P0A TONI-3 Form A Answer/Record FormsTN9P0A TONI-3 Form B Answer/Record FormsTO1P0A TOMAL Complete KitTO4P0A TOMAL Record Forms & Administration BookletsTOM10A TOMM Complete KitTOM20B TOMM User's ManualTOM30C TOMM Stimulus BookletsTOM40D TOMM Recording FormsTR1R0A Rorschach: Vol.I Basic Foundations 3rd Ed.TR2R0A Rorschach: Vol. II Interpretation 2rd Ed.TR3R0A Rorschach: Vol. III Assessment 2nd Ed.TR4R0A Rorschach 3-Volume SetTT1A0A Tips&Techniques for SCID-DTT1AAB Tips and Techniques - Audiotape onlyTVP10A TVPS (n-m):R Complete KitTVP20A TVPS (n-m):R ManualTVP30A TVPS (n-m):R Test PlatesTVP40A TVPS (n-m):R Record FormsTVU10A TVPS (n-m):UL-R Complete KitTVU20A TVPS (n-m):UL-R ManualTVU30A TVPS (n-m):UL-R Test PlatesTVU40A TVPS (n-m):UL-R Record FormsTWMD20 Treat. of Offenders w/ Mental DisordersTWMDRA Treat. of Offenders w/ Mental DisordersUPTT0A The Use of Psych.Testing for Treatment PlanningVA2R0A Violent AttachmentsVCMDO Violence,Crime&Mentally Disordered OffendersVRTA1R Violence Risk and Threat AssessmentWC1P0A WCST KitWC2P0A WCST Record BookletsWC2R0A Without ConscienceWC2W00 WCST:CV3 Research Edition-CD-ROMWC3P0A WCST Card DeckWC3W00 WCST:CV3 Research Edition Intro Kit-CD-ROM)WC4P0A WCST ManualWC5BW0 WCST:CV3 Scoring Program Kit (CD-ROM)WC64RF WCST-64:CV Record FormsWC6BW0 WCST:CV3 Scoring Program (CD-ROM)WCS10A WCST-64 Introductory KitWCS20A WCST-64 ManualWCS30A WCST-64 Record BookletsWCS40A WCST-64 Record Booklets
WCS50A WCST-64 Card DeckWCS6W0 WCST-64:CV Research Edition-CD-ROMWCS7W0 WCST-64:CV Scoring Program-CD-ROMWI2W3F WISC-III Report Kit for WindowsWLS1V Williams Lifeskills Sys.for Managing Stress&AngerWR220A WRAT3 Soft Attache CaseWR910A WRAT3 Manual for Administration & ScoringWR92BA WRAT3 Blue Test FormsWR92TA WRAT3 Tan Test FormsWR930A WRAT3 Profile/Analysis FormWR950A WRAT3 Plastic Cards for Reading/SpellingWR9P0A WRAT3 Starter SetWR9W0A WRAT3 Scoring Program WindowsWRAV1A WRAVMA KitWRAV2A WRAVMA ManualWRAV3A WRAVMA Examiner Record FormsWRAV4A WRAVMA Drawing FormsWRAV5A WRAVMA Matching FormsWRE10A WRAT-Expanded Form G Comprehensive kitWRE20A WRAT-Expanded Level I (Grade 2) KitWRE30A WRAT-Expanded Level 2 (Grade 3-4) KitWRE40A WRAT-Expanded Level 3 (Grade 5-6) KitWRE50A WRAT-Expanded Level 4 (Grade 7-9) KitWRE60A WRAT-Expanded Level 5 (Grade 10-12) KitWRE70A WRAT-Expanded Form I Reading/Mathematics KitWT100B Workshop/Training - (Organizational)XCAS20 CAS II ES InstallationXCASIN CAS II SetXCATD0 CAS-CV PreviewXCRSDD CRS-R for Windows Preview VersionXCRSI0 CRS-R Psychmanager Interpretive ReportsXCRSP0 CRS-R PsychManager Profile ReportsXCVUS0 CAS-CV UsesXDADTE DAS for Windows Preview VersionXDAKTF DAS Preview KitXDAP00 DAS Profile ReportXDI6T0 DICA-IV PreviewXDIBUE DICA-IV Both VersionsXDICU0 DICA-IV Child/AdolescentXDIPU0 DICA-IV ParentXDTINS DTREE InstallationXEQCT EQ-i for Windows Development Report Preview PkgXEQDR0 EQ-i Development Report for WindowsXEQRR0 EQ-i Resource Report for WindowsXEQRT EQ-i for Windows Resource Report Preview PkgXEQSR0 EQ-i for Windows Individual Summary ReportXFAMT1 FAM-III Preview VersionXFAMW FAM-III for Windows Profile ReportXFBUSP Brief FAM for Windows Profile ReportsXGAFIN GAF Report for Windows InstallationXHA010 Help-Assert Preview VersionXHA030 Help-AssertXHEA10 SHRINK V.2.0 Upgrade (3.5XHEA20 SHRINK V.2.0 Upgrade (3.5
XHEUSR SHRINK V.2.0 Upgrade (3.5XHPDT0 HPSI for WIndows Preview VersionXHPSW0 HPSI for Windows ReportsXHST60 SHRINK V.2.0 Upgrade (3.5XHSUSR HELP-Stress Adult VersionXHTPRV HELP-Think Preview Adult VersionXHTUSR HELP-Think Adult VersionXHTY10 HELP-Think for Windows Preview Youth VersionXHTY20 HELP-Think Youth VersionXJBCI0 JBC Interpretive Report for WindowsXJBCMO JBC Interpretive Report (Mail-in/Fax-in)XJBDT0 JBC Computer Program for Windows Preview VersionXJI100 JI Interpretive Report for WindowsXJI1T0 JI for Windows Preview Version (CD-ROM)XJIP10 JI Profile Report for WindowsXLA1T0 LAMB Score for WindowsXLATD0 LAMB Score for Windows Preview VersionXLSITD LSI-R for Windows Preview VersionXLSIW0 LSI-R for Windows Profile ReportXPDDT0 PDS for Windows Preview VersionXPM1U0 PsychManagerXPM1UD Disc. PsychManager Full Installation XXXPMCD0 PsychManager LiteXPSINS PSH for WindowsXPSPRV PSH for Windows Preview VersionXSADT0 SA-45 for Windows Preview VersionXSAS0I SA-45 Data Entry SheetsXSAW01 SA-45 for Windows Profile ReportsXSIINS SCID II PQ InstallationXSS2T0 SSPQ for Windows Preview VersionXSS4T0 SSPQ-X Preview VersionXSSE1A SSPQ-X for WindowsXSSUNA SSPQ for WindowsXSTAP0 STAI for Windows Preview VersionXSTD10 STAI for Window Data Entry SheetsXTOMP0 TOMM for Windows Preview VersionXTOMT0 TOMM for Windows KitXTOMW0 TOMM for Windows ReportYCC1R0 You Can Control Your Anger!YLS01 YLS/CMI Complete KitYLS02 YLS/CMI Specimen SetYLS03 YLS/CMI User's ManualYLS04 YLS/CMI QuikScore FormsYLS05 YLS/CMI QuikScore FormsYLS06 YLS/CMI Case Management FormsYLS07 YLS/CMI Case Management FormsYLS08 YLS/CMI Interview GuidesYLS09 YLS/CMI Interview Guides00515K MMPI-2 Interperative Mail-In Preview Pkg00515K MMPI-2 Interperative Mail-In Preview Pkg00517K MMPI-2 P.S. Interperative Mail-In Preview PkgAAAT0T ADHD Assessment & Treatment for Children & Adoles. (audio)AADH10 Assessing Attention-Deficit/Hyperactivity DisorderAASA10 Adolescents, Alcohol, and Substance Abuse
AAVY1R Antisocial and Violent YouthAB13PA ABS-S 2nd Edition Complete KitAB14PA ABS-S 2nd Edition Examiner's ManualAB15PA ABS-S 2nd Edition Examination BookletsAB16PA ABS-S 2nd Edition Profile & Scoring FormsAB18PA ABS-RC 2nd Edition Complete KitAB20PA ABS-RC 2nd Edition Examination BookletsAB22PA ABS-RC 2nd Edition Profile & Scoring FormsAD1R0A Anxiety Disorders in Children and AdolescentsAD2R0A Anger Disorders: Definition, Diagnosis, and TreatmentAD500A DTLA-A Examiner Record BookletsAD600A DTLA-A Profile/Summary FormsAD700A DTLA-A Response FormsADDLDB Attention Deficit Disorder & Learning DisabilitiesADHAC0 ADHD in Adults & ChildrenADHD0A ADHD: A Handbook for Diagnosis & Treatment 2nd EditionAFV1R0 Assessment of Family Violence 2nd EditionAGG1R0 Assessment Guide to Geriatric NeuropsychologyAMP1RA AMP Complete KitAMP2R0 AMP ManualAMP3R0 AMP AutoScore FormsANGM10 Anger ManagementAPS01 APSD Complete KitAPS02 APSD Specimen SetAPS03 APSD Technical ManualAPS04 APSD-P QuikScore FormsAPS05 APSD-P QuikScore FormsAPS06 APSD-T QuikScore FormsAPS07 APSD-T QuikScore FormsAPS08 APSD-C QuikScore FormsAPS09 APSD-C QuikScore FormsAS10PP ASQ-P FormsAS11PP ASQ-T FormsAS7P0P ASQ Progress ChartsAS9P0P ASQ Parent Instruction SheetsASDS10 ASDS Complete KitASDS20 ASDS ManualASDS30 ASDS Summary/Response FormsATCP10 Assessment & Treatment of Childhood Problems 2nd EditionAY2R0A Assessing the Youthful OffenderBC1P0B Busy Clinician's Guide to DSM-IV Video HandbookBC1V0A Busy Clinician's Guide to DSM-IV VideoBC2P0B Busy Clinician's Guide to DSM-IV Video HandbookBCLP1R Behaviour, Crime and Legal ProcessesBRI10A BRIEF Introductory KitBRI20A BRIEF Professional ManualBRI30A BRIEF Parent Form Questionnaries (25/pkg)BRI40A BRIEF Teacher Form Questionnaires (25/pkg)BRI50A BRIEF Parent Form Scoring Summary/Profile FormsBRI60A BRIEF Teacher Form Scoring Summary/Profile FormsCA1R0A Clinical Assessment of Malingering and DeceptionCA3R0A DSM-IV-TR Case BookCAAD1 CAADID Technical ManualCAAD2 CAADID Part I: Patient History Forms
CAAD3 CAADID Part II: Diagnostic Criteria Interview FormsCAAD4 CAADID Complete KitCAAD5 CAADID Specimen SetCAAQ0A Conners' Adult ADHD History FormsCAAQ2A Conners' Adult ADHD History FormsCAD01 CADS-P:V.5 Data Entry SheetsCAD02 CADS-T:V.5 Data Entry SheetsCAD03 CADS-A:V.5 Data Entry SheetsCAD04 CADS-P:V.5 Spanish Data Entry SheetsCAD05 CADS-T:V.5 Spanish Data Entry SheetsCAD06 CADS-A:V.5 Spanish Data Entry SheetsCALM1A CALM KitCALM2B CALM Group Leader's GuidesCALM3C CALM Group Member's WorkbookCAR10B CAARS Complete KitCAR10D CAARS-O:L QuikScore FormsCAR11D CAARS-O:S QuikScore FormsCAR12D CAARS-O:S QuikScore FormsCAR14D CAARS-O:SV QuikScore FormsCAR20A CAARS Technical ManualCAR30D CAARS-S:L QuikScore FormsCAR40D CAARS-S:L QuikScore FormsCAR50D CAARS-S:S QuikScore FormsCAR510 CAARS V.5 Profile ReportsCAR520 CAARS V.5 Interpretive ReportsCAR540 CAARS V.5 Preview VersionCAR550 CAARS-S:L Data Entry SheetsCAR560 CAARS-S:S Data Entry SheetsCAR570 CAARS-S:SV Data Entry SheetsCAR580 CAARS-O:L Data Entry SheetsCAR590 CAARS-O:S Data Entry SheetsCAR60D CAARS-S:S QuikScore FormsCAR610 CAARS-O:SV Data Entry SheetsCAR70D CAARS-S:SV QuikScore FormsCAR80D CAARS-S:SV QuikScore FormsCAR90D CAARS-O:L QuikScore FormsCARS0C CAARS Specimen SetCASEK CASE Introductory KitCASEM CASE ManualCASEP CASE Profile FormsCASERB CASE Form R Reusable Item BookletsCASERS CASE Form R Hand-Scorable Answer SheetsCASESB CASE Form S Reusable Item BookletsCASESS CASE Form S Hand-Scorable Answer SheetsCBS1R0 Cognitive-Behavioral Strategies in Crisis InterventionCBT1R0 Cognitive Behavioural Treatment of Sexual OffendersCCM1R0 Crime Classification ManualCD1P0A Chemical Dependency Assessment Paper VersionCD2W3F Chemical Dependency Kit for WindowsCDS20B CDS-R ManualCDS30C CDS-R QuikScore FormsCDS40C CDS-R QuikScore FormsCDS60C Brief CDS QuikScoresCDS70C Brief CDS QuikScores
CDS8SD CDS-R Specimen SetCDSK1A CDS Complete KitCDSK2A Brief CDS Complete KitCE2R0A The Custody Evaluation HandbookCG1A0A Clinician's Guide to Dissoc. Symptoms AudioCG2A0B Tips and Techniques for Using SCID-D (audio)CGIPR0 Comprehensive Guide to Interpersonal PsychotherapyCH1R0A Clinical Handbook of Psychotropic Drugs 12th EditionCHIP30 CHIP Complete KitCHIP40 CHIP Technical ManualCHIP50 CHIP Specimen SetCHIP60 CHIP QuikScore FormsCHIP70 CHIP QuikScore FormsCI0P10 CISS Adult Version Complete Kit PlusCI1OPI CISS Disk Only Preview - DOSCI20P0 CISS:SSC QuikScore FormsCI2P0E CISS Adult Quikscore FormsCI2PSE CISS Adult Quikscore Forms SinglesCI2S0C CISS Specimen SetCI3P0D CISS ManualCI4P0B CISS Adolescent Version Complete KitCI5P0F CISS Adolescent Quikscore FormsCI5PSF CISS Adolescent Quikscore Forms SinglesCIE1R0 Conducting Insanity EvaluationsCLES10 CLES ManualCLES20 CLES-P QuikScore FormsCLES30 CLES-C QuikScore FormsCLES40 CLES-A QuikScore FormsCLES60 CLES Specimen SetCLMR10 CALMER KitCLMR20 CALMER Group Leader's Guides (5/pkg)CLMR30 CALMER Group Member's Wkbks (10/pkg)CLMR40 CALMER Master PackageCLMR50 CALMER Certificates of Accomplishment (10/pkg)CMCD10 Corrections Manager CD-ROMCMDQ0A CMDQ FormsCMDQ2A CMDQ FormsCNTR0A Compendium of Neuropsychological Tests 2nd EditionCP11PK CPRS-93 Feedback FormsCP1R0A Coping with Psychiatric & Psychological TestimonyCP5P0H CPRS-48 QuikScore FormsCP7P0HCP9P0K CPRS-48 Feedback FormsCPS10H Spanish CPRS-48 Quikscore FormsCPS30G Spanish CPRS-93 Quikscore FormsCPTW20 CPT II/K-CPT Preview VersionCPTW30 CPT IICPTW50 CPT II plus K-CPTCPTW60 K-CPT (unlimited use) Plus CPT II Preview (3 uses)CRE1R0 Criminal Responsibility EvaluationsCRI1PB Contemporary Rorschach Intepretation H/CCRP01K Spanish CPRS-R:L Feedback FormsCRP02K Spanish CPRS-R:L Feedback FormsCRP03K Spanish CPRS-R:S Feedback Forms
CRP04K Spanish CPRS-R:S Feedback FormsCRP05I Spanish CTRS-R:L Feedback FormsCRP06I Spanish CTRS-R:L Feedback FormsCRP07I Spanish CTRS-R:S Feedback FormsCRP08I Spanish CTRS-R:S Feedback FormsCRP091 Spanish CASS:L Feedback Forms (25/pkg)CRP101 Spanish CASS:L Feedback Forms (100/pkg)CRP112 Spanish CASS:S Feedback Forms (25/pkg)CRP122 Spanish CASS:S Feedback Forms (100/pkg)CRS01A Complete CRS-R Parent & Teacher Rating Scales User's PackageCRS02J Complete CRS-R Parent & Teacher Rating Scales/Feedback KitCRS03C CRS-R Long Version KitCRS05B CRS-R Short Version KitCRS08D CRS-R Specimen SetCRS09M CRS-R Technical ManualCRS10M CRS-R User's ManualCRS11G CPRS-R:L QuikScore™ FormsCRS12G CPRS-R:L Quikscore™ FormsCRS13H CPRS-R:S QuikScore™ FormsCRS14H CPRS-R:S QuikScore™ FormsCRS15E CTRS-R:L QuikScore™ FormsCRS16E CTRS-R:L Quikscore™ FormsCRS17F CTRS-R:S QuikScore™ FormsCRS18F CTRS-R:S Quikscore™ FormsCRS19Y CASS:L QuikScore Forms (25/pkg)CRS20Y CASS:L QuikScore Forms (100/pkg)CRS21Z CASS:S QuikScore Forms (25/pkg)CRS22Z CASS:S QuikScore Forms (100/pkg)CRS23K CPRS-R:L Feedback FormsCRS24K CPRS-R:L Feedback FormsCRS25K CPRS-R:S Feedback FormsCRS26K CPRS-R:S Feedback FormsCRS27I CTRS-R:L Feedback FormsCRS28I CTRS-R:L Feedback FormsCRS29I CTRS-R:S Feedback FormsCP8P0G CPRS-93 QuikScore FormsCRS30I CTRS-R:S Feedback FormsCRS311 CASS:L Feedback Forms (25/pkg)CRS321 CASS:L Feedback Forms (100/pkg)CRS332 CASS:S Feedback Forms (25/pkg)CRS342 CASS:S Feedback Forms (100/pkg)CRS354 CADS Parent QuikScore FormsCRS364 CADS Parent QuikScore FormsCRS374 CADS Teacher QuikScore FormsCRS384 CADS Teacher QuikScore FormsCRS394 CADS Adolescent QuikScore FormsCRS404 CADS Adolescent QuikScore FormsCRS414 CADS-P Feedback FormsCRS424 CADS-P Feedback FormsCRS434 CADS-T Feedback FormsCRS444 CADS-T Feedback FormsCRS454 CADS-At Feedback FormsCRS464 CADS-A Feedback FormsCRS473 CGI-T QuikScore
CRS483 CGI-P QuikScoreCRS493 CRS-R Treatment Progress ColorPlot™ FormsCRS503 Conners' Global Index KitCRS52A Complete CRS-R Parent, Teacher & Adolescent User's PackageCRS533 CGI Reorder KitCRS54 CRS-R V.5 Profile ReportCRS55 CRS-R:V.5 Interpretative ReportCRS57 CRS-R V.5 Preview VersionCRS60G Spanish CPRS-R:L Quikscore FormsCRS61G Spanish CPRS-R:L Quikscore FormsCRS62H Spanish CPRS-R:S Quikscore FormsCRS63H Spanish CPRS-R:S Quikscore FormsCRS64E Spanish CTRS-R:L Quikscore FormsCRS65E Spanish CTRS-R:L Quikscore FormsCRS66F Spanish CTRS-R:S Quikscore FormsCRS67F Spanish CTRS-R:S Quikscore FormsCRS68I Spanish CASS:L Quikscore Forms (25/pkg)CRS69I Spanish CASS:L Quikscore Forms (100/pkg)CRS71J Spanish CASS:S Quikscore Forms (100/pkg)CRS72A Spanish CRS-R Parent, Teacher & Adolescent User's PackageCRS73D Spanish CRS-R Specimen SetCRS74 Spanish CGI-T V.5 Data Entry SheetsCRS75 Spanish CGI-P V.5 Data Entry SheetsCRS804 Spanish CADS-P Quikscore FormsCRS814 Spanish CADS-P Quikscore FormsCRS824 Spanish CADS-T Quikscore FormsCRS834 Spanish CADS-T QuikScore FormsCRS844 Spanish CADS-A QuikScore FormsCRS854 Spanish CADS-A Quikscore FormsCRS863 Spanish CGI-T QuikScore FormsCRS873 Spanish CGI-P QuikScore FormsCRS907 CPRS-R:L Data Entry SheetsCRS917 CPRS-R:S Data Entry SheetsCRS927 CTRS-R:L Data Entry SheetsCRS937 CTRS-R:S Data Entry SheetsCRS947 CASS:L Data Entry Sheets (50/pkg)CRS957 CASS:S Data Entry Sheets (50/pkg)CRS967 CGI-P Data Entry FormsCRS977 CGI-T Data Entry FormsCRSK1 CADS Complete KitCRSS17 Spanish CPRS-R:L Data Entry SheetsCRSS27 Spanish CPRS-R:S Data Entry SheetsCRSS37 Spanish CTRS-R:L Data Entry SheetsCRSS47 Spanish CTRS-R:S Data Entry SheetsCRSS57 Spanish CASS:L Data Entry SheetsCRSS67 Spanish CASS:S Data Entry SheetsCS1P0E STAIC KitCS2P0C STAIC QuestionnairesCS2R0A Competency to Stand Trial EvaluationsCSQ10A SHQ-R Item BookletsCSQ20A SHQ-R Item BookletsCSQ30A SHQ-R Technical ManualCSQ40A SHQ-R Comprehensive Report (Mail/Fax In)CSQ60A SHQ-R Comprehensive Report Preview Package (Mail-In/Fax In)
CT11PI CTRS-39 Feedback FormsCT1MAA Clinician's Electronic ThesaurusCT1R0A Clinician's Thesaurus 5th EditionCT1W3A Clinician's Electronic Thesaurus V5CT2D3B Category Test Computer Program Preview MS DOSCT2F3A Category Test Computer Program MS DOSCT4P0F CTRS-28 QuikScore FormsCT6P0E CTRS-39 QuikScore FormsCT9P0I CTRS-28 Feedback FormsCTN1FA CTONI-CA Windows (25 uses)CTO1PA CTONI Complete KitCTO2PA CTONI Examiner's ManualCTO6PA CTONI Profile/Examiner Record FormsCTS10F Spanish CTRS-28 Quikscore FormsCTS30E Spanish CTRS-39 Quikscore FormsCTT2PB Clock Test ManualCTT3PE Clock Test Stimulus Cards TentCTT4PC Clock Test Quikscore FormsCTT5PC Clock Test Quikscore FormsCTT6PD Clock Test Profile SheetsCTT7PD Clock Test Profile SheetsCTT8PA Clock Test KitDA1P0A DAS Complete KitDA1S0G DAS Specimen SetDA2P0B DAS Quikscore FormsDA2PSB DAS Quikscore Forms (Singles)DA3P0C DAS ManualDC4R0A DSM-IV-TR Case BookDH1R0A DSM-IV-TR Handbook of Differential DiagnosisDP2R0A Disorders of Personality: DSM-IV & Beyond 2nd EditionDS5R0A DSM-IV-TR ManualDS6R0A DSM-IV-TR ManualDS7R0A DSM-IV-TR Desk ReferenceDS8R0A DSM-IV-TR Quick ReferenceDS9RCD Electronic DSM-IV-TR Plus (CD-ROM)DT10PA DTLA-P:2 Profile/Examiner Record FormsDT7P0A DTLA-P:2 Complete KitDT9P0A DTLA-P:2 Response FormsDTL1PA DTLA-4 Complete KitDTL2PA DTLA-4 Profile/Summary FormsDTL3PA DTLA-4 Examiner Record BookDTL4PA DTLA-4 Response FormsDTL5PA DTLA-4 Examiner's ManualDTL6WA DTLA-4 Scoring & Report System for WindowsDTS1PC DTS KitDTS2PA DTS ManualDTS4PB DTS QuikScoresDTS5PB DTS Specimen SetDTSP10 Spanish DTS QuikScore FormsDTSP20 Spanish DTS QuikScore FormsDTSP30 Spanish DTS Complete KitDTSP40 Spanish DTS Specimen SetDTVP10 DTVP-2 Complete KitDUAD10 Dual Diagnosis 2nd Edition
DW1R0A Dealing With Anger ProblemsEDEIR0 Emotional Development & Emotional IntelligenceEEW1R0 Expert Expert WitnessEFPA10 Essentials of Forensic Psychological AssessmentEIED10 Emotional Intelligence in Everyday LifeEIED20 Emotional Intelligence in Everyday LifeEIV010 Emotional Intelligence: A New Vision for Educators (Video)EMA1P0 EMAS Complete KitEMA2P0 EMAS ManualEMA3P0 EMAS-S FormsEMA4P0 EMAS-Trait/EMAS-Perception FormsEOAS10 Essentials of Outcome AssessmentEOBA10 Essentials of Behavioral AssessmentEONA10 Essentials of Neuropsychological AssessmentEQ1R0A Emotional IntelligenceEQ2P0B EQ-i User's ManualEQ2R0A Emotional IntelligenceEQ3P0C EQ-i Administrator's GuideEQ3R00 Working with Emotional IntelligenceEQ4P0D EQ-i Facilitator's GuideEQ5P0E EQ-i Technical ManualEQ6P0F EQ-i Item BookletsEQ7P0F EQ-i Item BookletsEQ8P0F EQ-i Item BookletsEQ9P0L EQ-i Data Entry SheetsEQDR0G EQ-i Development ReportEQDT EQ-i Development Report Mail-In Preview PackageEQED20 The EQ EdgeEQGRPG EQ-i Group ReportEQI39 EQ-i V.5 Group ReportEQI51 EQ-i V.5 Individual Summary ReportEQI52 EQ-i V.5 Development ReportEQI53 EQ-i V.5 Resource ReportEQI54 EQ-i V.5 Development Report Preview VersionEQI55 EQ-I V.5 Resource Report Preview VersionEQI57 EQ-i V.5 Individual Across Administrations ReportEQI58 EQ-i V.5 Individual to Group ReportEQI59 EQ-i V.5 Group to Group ReportJIR017 JI-R Interpretive Report Kit - Web00748A ISO-30 Handscoring Introductory KitCD1S0D CDI Specimen SetQLQW02 QLQ Report Kit- Web00651A BSI Nonpatient Adolescent Starter Kit25018L MMPI-A Audiocassette45109L Spanish MAPI Audiocassette45110L MAPI AudiocassetteSETKTA SET Kit00742G Quickview Mail-In Preview PackagePPC003 PPC QuikScore FormsIR1R0A Interpretive Reasoning & the Halstead-Reitan TestsBMM1R0 Beginner's Guide to the MMPI-2CTP1RA Cognitive Therapy for Personality DisordersTP1V3B Turning Points Patient WorkbookTP1VVA Turning Points Complete Video Kit
05616C BSI ManualTN7P0A TONI-3 ManualEQF2P French EQ-i Resource Report (black & white)EQI201 EQ-Interview Semi-structured FormsFA1GPH FAM-III Progress Colour Plot Profiles00972N BSI 18 Community Norms Starter Kit00973N BSI 18 Oncology Norms Starter Kit05627B BSI English Answer SheetsFA1R0A Forensic Assessment with Millon Inventories35020B IDEAS English Test Booklets08700B CAB Manual with NormsDTS6FB French DTS QuikScore Forms702000 APQ ManualFTT001 FTT Complete Kit45221J MACI Mail-in Profile Report45223J Spanish MACI Mail-in Interpretive Report45224J Spanish MACI Mail-in Profile ReportXDT1WA DTREE: DSM-IV Expert for WindowsSAS100 SASSI-3 ManualSIT50A SIT-R3 Complete KitSIT60A SIT-R3 Supplementary Manual for Visually ImpairedXSSEXP SSPQ for Windows33006B MCMI-III Handscoring Reorder Kit33011F MCMI-III Test Booklets24013E MMPI-2 Content Scale Answer Keys24015E MMPI-2 Supplementary Scales Answer Keys24016E MMPI-2 Clinical Subscales Answer Keys24019E MMPI-2 Validity & Clinical Scales Answer Keys24020E MMPI-2 Content Scale Answer Keys24022E MMPI-2 Supplementary Scales Answer Keys24023E MMPI-2 Clinical Subscales Answer Keys24024F MMPI-2 Softcover Hispanic Test Booklets24027C MMPI-2 Manual24031C MMPI-2 Alcohol & Drug Treatment User's Guide24032C MMPI-2 Adult Clinical System Revised User's Guide24041C MMPI-2 Personnel Selection System User's Guide24042F French MMPI-2 Test Booklet24082B MMPI-2 Basic Hand-Scoring Materials Package24083B MMPI-2 Basic Hand-Scoring Materials Package24084E MMPI-2 Content Component Scales Answer Keys24085E MMPI-2 Content Component Scales Answer Keys24086D MMPI-2 Content Component Profiles24104N MMPI-2 Additional Validty Scales Int. Answer Keys24105N MMPI-2 Additional Validty Scales Int. Answer Keys24107N MMPI-2 Additional Suppl. Scales Int. Answer Keys24108N MMPI-2 Additional Clinical Subsc. Int. Answer Keys24109N MMPI-2 Additional Clinical Subsc. Int. Answer Keys31000N MMPI-2 RC Scales Profile Forms31001N MMPI-2 RC Scales Answer Keys31002N MMPI-2 RC Scales Answer Keys51950N MMPI-2 Criminal Justice User's Guide24025L English MMPI-2 AudiocassetteGADS20 GADS Examiner's ManualGADS30 GADS Summary/Response Booklets
AD100A DTL-A Complete KitPPC002 PPC Technical ManualPPC004 PPC QuikScore FormsNEO010 NEO PI-R Comprehensive KitWIF10A The Wisdom In Feeling33016C MCMI-III Manual33017C MCMI-III Corrections Report User's Guide33020N MCMI-III French Test Booklets24026L Spanish MMPI-2 Audiocassette24034J MMPI-2 Adult Clinical System Revised Mail-In24035J MMPI-2 Alcohol & Drug Interpretive Report Mail-In24036J MMPI-2 Adult Clinical Interpretive Report Mail-In24050J MMPI-2 Basic Service Profile Report Mail-In24053J MMPI-2 Basic Service Profile Report Mail-In24060J MMPI-2 Personnel Selection Interpretive Mail-In51952N MMPI-2 Criminal Justice & Corrections Report51953N MMPI-2 Criminal Justice & Corrections Report24066N MMPI-2 Personnel Selection Syst Adjustment Rating24069N MMPI-2 Personnel Selection Syst Adjustment Rating24101C MMPI-2 Forensic Report User's Guide24102J MMPI-2 Forensic Interpretive Mail-In Report24103J MMPI-2 Forensic Interpretive Mail-In Report00676A SCL-90-R Nonpatient Adult Starter Kit00692A SCL-90-R Nonpatient Adolescent Starter Kit00694A SCL-90-R Inpatient Psychiatric Starter Kit05610C SCL-90-R Manual05612L Spanish SCL-90-R Audiocassette05614L English SCL-90-R Audiocassette05619D SCL-90-R Nonpatient Adult Reorder Kit05620D SCL-90-R Nonpatient Adolescent Reorder KitTD4P0D TD Monitor Modified AIMS QuikScore FormsJAD1RA Journal of Attention DisordersJAD2RB Journal of Attention Disorders449M0B Karson Clinical Report (KCR) Mail-In510M0B Basic Interpretive Report (BIR) Mail-in511M0D Basic Score Report (BSR) Mail-in51200A 16PF 5th Ed. Handscoring Starter Kit51300B 16PF 5th Ed. Administrator's ManualBGMC Beginners' Guide to the MCMI-IIIEMIAR Essentials of Million Inventories Assessment55400I 16PF5 : Overcoming Obstacles In InterpretationCDS001 CDS V.5 Getting Started GuideEQI60 EQ-i V.5 Group Across Administrations ReportEQI61 EQ-i Individual Across Administrations Report (Mail/Fax-In)EQI62 EQ-i Individual to Group Report (Mail-In/Fax-In)EQI63 EQ-i Group to Group Report (Mail-In/Fax-In)EQI64 EQ-i Group Across Administrations Report (Mail-In/Fax-In)EQI70 EQ-i:S Complete KitEQI71 EQ-i:S Specimen SetEQI72 EQ-i:S Technical ManualEQI73 EQ-i:S Complete Assessment SetEQIRRG EQ-i Resource ReportEQISRG EQ-i Individual Summary ReportEQOD EQ-i Development Report- Web
EQOGA EQ-i Group Across Administraions Report- WebEQOGR EQ-i Group Report- WebEQOI EQ-i Individual Summary Report- WebEQOIA EQ-i Individual Across Administrations Report- WebEQOIG EQ-i Individual to Group Report- WebEQORB EQ-i Resource Report- WebEQOTG EQ-i Group to Group Report- WebEQPRR EQ-i Resource ReportEQRT EQ-i Resource Report Mail-In Preview PackageEQS10F Spanish EQ-i Item BookletsEQS20G Spanish EQ-i Individual Summary ReportEQS2DG Spanish EQ-i Development ReportEQS2P Spanish EQ-i Resource ReportEQS2RG Spanish EQ-i Resource ReportEQTP EQ-i User's SetEQYS1 Spanish EQ-i:YV QuikScore FormsEQYS2 Spanish EQ-i:YV QuikScore FormsEQYS3 Spanish EQ-i:YV(S) QuikScore FormsEQYS4 Spanish EQ-i:YV(S) QuikScore FormsEQYV10 BarOn EQ-i:YV KitEQYV21 EQ-i:YV ManualEQYV30 EQ-i:YV QuikScore FormsEQYV40 EQ-i:YV QuikScore FormsEQYV60 BarOn EQ-i:YV/BarOn EQ-i:YV(S) KitEQYV70 BarOn EQ-i:YV(S) QuikScore FormsEQYV80 BarOn EQ-i:YV(S) QuikScore FormsERA1R0 Essentials of Rorshach Assessment S/CEW1R00 Expert Witnesses in Child Abuse Cases H/CEW2R00 Expert Witnesses in Child Abuse Cases S/CEWA1R0 Essentials of WAIS-III AssessmentFA12PB FAM-III General Scale QuikScore FormsFA13PC FAM-III Dyadic Relationship Quikscore FormsFA14PD FAM-III Self-Rating Scale QuikScore FormsFA15PF FAM-III ColorPlot Profile of Family PerceptionsFA16PM FAM-III ManualFA1P0A FAM-III Starter KitFA2P0G FAM-III Specimen SetFA3P0O FAM-III General Scale Data Entry SheetsFA4P0O FAM-III Dyadic Relationship Scale Data Entry SheetsFA5P0O FAM-III Self-Rating Data Entry SheetsFAB1PA FAB-C KitFAB1SD FAB-C Specimen SetFAB2PB FAB-C ManualFAB3PC FAB-C QuikScore FormsFAM1PH Brief FAM Starter KitFAM2PI Brief FAM General Scale QuikScore FormsFAM3PJ Brief FAM Dyadic Relationship QuikScore FormsFAM4PK Brief FAM Self-Rating Scale QuikScore FormsFAM5PH Brief FAM Specimen SetFAM6PO Brief FAM General Scale Data Entry SheetsFAM7PO Brief FAM Dyadic Relationship Data Entry SheetsFAM8PO Brief FAM Self-Rating Scale Data Entry SheetsFAS01B Spanish FAM-III General Scale QuikScore FormsFAS02C Spanish FAM-III Dyadic Relationship QuikScore Forms
FAS03D Spanish FAM-III Self-Rating Scale QuikScore FormsFAS04I Spanish Brief FAM General Scale QuikScore FormsFAS05J Spanish Brief FAM Dyadic Relionship QuikScore FormsFAS06K Spanish Brief FAM Self-Rating Scale QuikScore FomsFEJR0A Forensic Evaluation of JuvenilesFMHA10 Forensic Mental Health AssessmentGARS10 GARS Complete KitGARS20 GARS ManualGARS30 GARS Summary/Response BookletsGO1R0A GORT-4 Complete KitGO2R0A GORT-4 Examiner's ManualGO3R0A GORT-4 Student BookGO4R0A GORT-4 Form A Record FormsGO5R0A GORT-4 Form B Record FormsHA1R0A Handbook for the Assessment of DissociationHAR2PA Comprehensive NormsHAR4PA Record Forms for Comprehensive NormsHAR7PA Comprehensive Norms KitHDI01 HDI Complete KitHDI01A HDI Research Version Manual (set of 2)HDI02 HDI-P Item BookletsHDI02B HDI Research Version Forms (4 of each)HDI03 HDI-S Item BookletsHDI04 HDI-P Background Information QuestionnairesHDI05 HDI-S Background Information QuestionnairesHDI06 HDI-P Response FormsHDI07 HDI-P Response FormsHDI09 HDI-S Response FormsHDI10 HDI Specimen SetHDI11 HDI Technical ManualHDI12 HDI-P KitHDI13 HDI-S KitHDVI10 Handbook of Domestic Violence Intervention StrategiesHEAA0A Highly Effective Approaches to Making CPT WorkHEI1R0 The Handbook of Emotional IntelligenceHFP1R0 The Handbook of Forensic Psychology 2nd EditionHOAT1R Handbook of Offender Assessment & TreatmentHPS10A HPSI Complete KitHPS20B HPSI ManualHPS30C HPSI Quikscore FormsHPS3FF French HPSI QuikScore Forms (25/pkg)HPS3SC HPSI Quikscore Forms (Singles)HPS40D HPSI Quikscore FormsHPS5SD HPSI Specimen SetHPS61 HPSI V.5 ReportsHPS62 HPSI V.5 Preview VersionHPS63 HPSI Data Entry SheetsHRC2R0 How to Raise a Child with a High EQHSC1R0 Homework Success for Children with ADHD S/CIC1P0B Insider's Complete Guide to DSM-IV HandbookIC1V0A Insider's Complete Guide to DSM-IV VideoIC2P0B Insider's Complete Guide to DSM-IV HandbookICPR0A 16PF Interpretive Guide to the 5th Ed.ICPSE0 ICPS Intermediate Elementary Grades Manual
ICPSK0 ICPS Kindergarten & Primary Grades ManualICPSP0 ICPS Preschool ManualICSAVA Interviewing for Child Sex Abuse (Video)IE1P0A Intake Evaluation Repor Paper Version (20/pkg)IE2W3F Intake Evaluation Report Kit for WindowsIEQ03 IEQ-MP Complete KitIEQ04 IEQ-MP Specimen SetIEQ05 IEQ-MP Technical ManualIEQ06 IEQ-S FormsIEQ07 IEQ-S FormsIEQ08 IEQ-Pro FormsIEQ09 IEQ-Pro FormsIEQ10 IEQ-O FormsIEQ11 IEQ-O FormsIEQ12 IEQ-Tx FormsIEQ13 IEQ-Tx FormsIEQ14 IEQ-CIP FormsIEQ15 IEQ-CIP FormsII2R10 Investigative InterviewingII3R10 Investigative InterviewingINVCO1 Invisible ClockIPD1R0 Interpreting Projective Drawings H/CISS010 ISS Technical ManualISS020 ISS QuikScore FormsISS030 ISS Brochure Patient HandoutsISS040 ISS Complete KitISS050 ISS Specimen SetITA1RA Impulsivity: Theory, Assessment, and TreatmentJADBSU JAD Supplement (Vol. 4, Supplement 1, 2001)JB3P0B JBC Specimen SetJB8P0M JBC Observer Data Entry SheetsJBC1PA JBC Complete KitJBC2PR JBC Observer Item BookletJBC3PS JBC Observer Quikscore FormsJBC4PD JBC Technical ManualJBC5PF JBC Self-Appraisal Item BookletsJBC6PU JBC Self-Appraisal Quikscore FormsJBC7PU JBC Self-Appraisal Quikscore FormsJBC9PS JBC Observer Quikscore FormsJI12PH JI/JBC Complete SetJI12SE Spanish JI Test BookletsJI13PG JI ManualJI14PD JI QuikScore FormsJI15PA JI Complete KitJI16PD JI QuikScore FormsJI17PM JI Data Entry SheetsJI1MNG JI Software Manual-DOSJI2P0B JI Specimen SetJI4SCR JI Scoring TemplatesJIPM00 JI Profile Report (Mail-In/Fax-In)JSO1R0 Juvenile Sexual OffendingKCPT10 K-CPT for Windows (Unlimited Use)LA1P0A LAMB Complete KitLA2P0B LAMB Manual
LA4P0C LAMB Recording FormsLA5P0D LAMB Profile/Summary SheetsLA6P0E LAMB Standard Score Conversion BookletLA7P0F LAMB Simple & Complex Figure Drawing Forms PadLA8P0J LAMB Stimulus Cards TentsLB1R0A Lost BoysLDCB1R Learning Disabilities & Challenging BehaviorsLDDI1A LDDI Complete KitLDDI2B LDDI Examiner's ManualLDDI3C LDDI Rating Summary BookletsLS10PI LSI-R Interview Guide/QuikScore/ColorPlot ProfileLS11PI LSI-R Interview Guide/QuikScore/ColorPlot ProfileLS1P0A LSI-R Complete KitLS2P0C LSI-R ManualLS2PFC French LSI-R ManualLS3P0D LSI-R Interview GuidesLS3PSD LSI-R Interview Guide (Single)LS3SPD Spanish LSI-R Interview GuidesLS4P0D LSI-R Interview GuidesLS4SPD Spanish LSI-R Interview GuidesLS5P0E LSI-R Quikscore FormsLS5PSE LSI-R QuikScore Forms (Single)LS5SPE Spanish LSI-R QuikScore FormsLS6P0E LSI-R QuikScore FormsLS6PFE French LSI-R Quikscore FormsLS6SPE Spanish LSI-R QuikScore FormsLS7P0F LSI-R ColorPlot ProfilesLS7PF0 French LSI-R ColorPlot ProfilesLS7PSF LSI-R ColorPlot Profiles (Single)LS7SPF Spanish LSI-R ColorPlot ProfilesLS8PF0 French LSI-R ColorPlot ProfilesLS8SPF Spanish LSI-R ColorPlot ProfilesLS9P0B LSI-R Specimen SetLSI2PQ LSI-R V.5 Data Entry Sheets (50/pkg)LSI2VH LSI-R Training Video Series-Volume IILSI4VH LSI-R Training Video SeriesLSI51 LSI-R V.5 Profile ReportsLSI52 LSI-R V.5 Preview VersionLSIS2B LSI-R:SV ManualLSIS3C LSI-R:SV Interview Guides/QuikScore FormsLSIS4C LSI-R:SV Interview Guides/QuikScore FormsLSIS5E LSI-R:SV Interview GuidesLSIS6E LSI-R:SV Interview GuidesLSIS7D LSI-R:SV QuikScore FormsLSIS8D LSI-R:SV QuikScore FormsLSISSF LSI-R:SV Specimen SetLSIT1K LSI-R Training the Trainer WorkbookLSS510 LSI-R:SV V.5 Profile ReportsLSS520 LSI-R:SV: V.5 Preview VersionLSS54 LSI-R:SV V.5 Data Entry SheetsM22R0A MMPI-2 Assessing Personality 3rd EditionM24R0A MMPI-2: An Interpretive Manual 2nd EditionMA1W3A MMPI-A Interpretive System for WindowsMAAA0A MMPI-A: Assessing Adolescent Psychopathology
MADC20 Managing ADHD in Children 2nd EditionMASC1A MASC Complete KitMASC2B MASC Specimen SetMASC3C MASC ManualMASC4D MASC Quikscore FormsMASC5D MASC Quikscore FormsMASC6A MASC/MASC-10 Complete KitMASC7D MASC-10 Quikscore formsMASC8D MASC-10 Quikscore formsMDIARA Malingering and Deception in AdolescentsMI3W3A MMPI-2 Adult Interpretive System for Windows V.2MM2BR0 Essentials of MMPI-2 & MMPI-A Interpretation 2nd EditionMM2R0A MMPI, MMPI-2, MMPI-A in Court 2nd EditionMM2WB0 Essentials of MMPI-2 & MMPI-A Interpretation 2nd Ed WorkbookMMSE100 MMSE Complete KitMMSE50 MMSE KitMN1R00 Motivational Interviewing 2nd EditionMSC02 MSCEIT User's KitMSC03 MSCEIT User's ManualMSC04 MSCEIT Personal Summary Reports- WebMSC05 MSCEIT Item BookletsMSC06 MSCEIT Personal Summary ReportsMT2P0A Parent's GuideMTG1PA Teacher's GuideMTOA10 MTOA KitMTOA20 MTOA Technical ManualMTOA30 MTOA : L Recording FormsMTOA40 MTOA : L Recording FormsMTOA50 MTOA : S Recording FormsMTOA60 MTOA : S Recording FormsMTOA70 MTOA Long Kit (DISCONTINUED)MTOA80 MTOA Short Kit (DISCONTINUED)MTOA90 MTOA Specimen SetNA1R0A Neuropsychological AssessmentNES010 Neuropsychological Summary: IntroNES020 Thinking Difficulties w/o Signs of Brain ImpairmenNES100 Understanding Attention, Concentration & MemNES200 Problem Immediate & Long Term Verbal MemoryNES300 Problem Immediate & Long Term Visual MemoryNES400 Decision, Planning & Organizational SkillsNES500 Trouble Initiating Activities & O to DirectionsNES600 Dificulties w/Social Perception & JudgementNES700 Reading, Writing & Arithmetic ProblemsNES800 Problems w/Balance & Hand CoordinationNES900 Anxiety, Moodiness, Irritability & DepressionNESPV0 Preview PackageNIMS50 NOC Complete KitNIMS60 NOC Overall Summary FormsNIMS70 NOC BookletsNIMS80 NOC Specimen SetOA1R0A Coaching the ADHD Student Complete KitOA2R0B Coaching the ADHD Student GuidebookOA3R0C Long Term Goals Planning SheetOA4R0D Coach Monitoring Sheet
OA5R0E Weekly Progress ReportOA6R0F Goals for KidsOCD1RA OCD in Children & AdolescentsOIN1V0 Optimizing Intelligences VideoPA10PA PANSS KitPA1P0A PANSS Complete KitPA2P0C PANSS Technical ManualPA3P0D PANSS Quikscore FormsPA3PSF PANSS Quikscore Forms SinglesPA4P0D PANSS Quikscore FormsPA5P0E SCI-PANSS FormsPA5PSF SCI-PANSS Forms (Singles)PA6P0E SCI-PANSS FormsPACVRA Psychopathy:Antisocial,Criminal & Violent BehaviorPAD1AA Volume I: Managed CarePAD2AB Volume II: Differential DiagnosisPAD3AC Vol.III: Multiaxial AssessmentPAD4AD Practical Appl.of DSM-IV Audio Complete SetPAIQ10 IQ-PANSS FormsPAIQ20 IQ-PANSS FormsPCC1RA The Psychology of Criminal Conduct 3nd Ed.PCCBR0 The Psychopathology of CrimePCL1AN Psychopathy and the Hare PCL-R (Audio Set)PCL1HN Hare PCL-R Audiotape HandbooksPCL1PA Hare PCL-R Hardcover KitPCL2HN Hare PCL-R Audiotape HandbooksPCL2PD Hare PCL-R ManualPCL3PF Hare PCL-R Hardcover Rating BookletPCL4PE Hare PCL-R QuikScore FormsPCL5PG Hare PCL-R Interview GuidesPCL6PE Hare PCL-R QuikScore FormsPCL7PG Hare PCL-R Interview GuidesPCL7SS Hare PCL-R Specimen SetPCL8PB Hare PCL-R Softcover KitPCLS1H Hare PCL:SV KitPCLS2J Hare PCL:SV ManualPCLS3L Hare PCL:SV Interview Guides/QuikScore FormsPCLS4L Hare PCL:SV Interview Guides/QuikScore FormsPCLS6T Hare PCL:SV Interview Guides (25/pkg)PCLS7I Hare PCL:SV Specimen SetPCLS8J Swedish Hare PCL:SV Manual SupplementPCLS9S PCL:SV QuikScore FormsPCLSQS PCL:SV QuikScore FormsPCT1PA Preparing For Court Testimony KitPCT2PB Prep. for Court Testimony Interpretation GuidePCT3PC Preparation for Court Testimony Preparation FormsPCT4PC Preparation for Court Testimony Preparation FormsPDRFRA Psychologists' Desk ReferencePDS1PC PDS Complete KitPDS2PA PDS User's ManualPDS3PB PDS QuikScore FormsPDS4PB PDS QuikScore FormsPDSF10 French PDS QuikScore FormsPE1R0A Psychological Evaluation for the Courts
PFN1RA The Practice of Forensic NeuropsychologyPG1R0A Practitioner's Guide to Clinical NeuropsychologyPGAS10 A Parent's Guide to Asperger Syndrome& HF AutismPM1R0A The Psychopathic MindPMTAAT Parent Management Training for ADHDPOSR20 The Psychology of StalkingPP2W3F PPSI Kit for WindowsPRCD10 PeoplePro (CD-ROM)PRI1R0 Principles of Rorschach InterpretationPRIL10 Primal LeadershipPS10PA PSI Short Form Questionnaire/Profile sheetsPS11PA PSI3 Plus SW Test Booklets-Long (25/pkg)PS12PA PSI3 Plus SW Test Booklets-Short(25/pkg)PS2P0A PSI Introductory KitPS3P0A PSI ManualPS3R0A Protocols for the Sex-Abuse EvaluationPS4P0A PSI Hand Scorable Answer Sheets/Profile FormsPS6F3A PSI3 Plus SW Sys.Abbreviated Kit MS DOS(3.5"disks)PS7F3A PSI3 Plus SW Sys.MS DOS(3.5"disks)PS8F3A PSI Software 3.5" diskPS8P0A PSI Item BookletsPS9F3A PSI Software 3.5" diskPS9P0A PSI Short Form KitPSCKB0 Hare P-Scan RV Complete KitPSCKK0 Hare P-Scan RV KitPSCN10 Hare P-Scan RV ManualPSCN20 Hare P-Scan RV QuikScore FormsPSCN30 Hare P-Scan RV QuikScore FormsPSCNS0 Hare P-Scan RV Specimen SetPSGS1R Problem Solver Guide for Students with ADHD S/CPSP1PA PSP Complete KitPSP1RB New Personality Self-Portrait RevisedPSP25D PSP Quikscore/Interpretation Guides (5/pkg)00696A MMPI-2 Hand-Scoring Kit00720A MMPI-A Softcover Kit25003C MMPI-A Manual45204B MACI Hand-Scoring Reorder Kit45205A MACI Hand-Scoring Starter Kit45209C MACI User's Guide45210C MACI Manual45213E MACI Answer Keys45217F MACI Hand-Scoring Test Booklets51428I Spanish MACI MICROTEST Q Answer Sheets (25/pkg)51429I English MACI MICROTEST Q Answer Sheets (25/pkg)Z51428 MACI MTQ A/S HISPANIC - SINGLEZ51429 MACI MTQ A/S - SINGLE00721A MMPI-A Hardcover Kit51528I Spanish BHI MTQ Answer Sheets (25/pkg)51529I English BHI MTQ Answer Sheets (25/pkg)51600B BHI Hand-Scoring Reorder Kit51601A BHI Hand-Scoring Starter Kit45106C MBHI Manual50406I MBHI Microtest A/S Hisp.(25/pkg)51409I Spanish MBHI MICROTEST Q Answer Sheets (25/pkg)
51411I English MBHI MICROTEST Q Answer Sheets (25/pkg)Z51409 MBHI MTQ A/S HISPANIC - SINGLEZ51411 MBHI MTQ A/S ENGLISH - SINGLE00756C AUI Handscoring Starter Kit48009A AUI User's Guide26304B CAI-Vocational Interp. A/S Singles26310G CAI Voc.Coloured Printout Paper(500) (DISCONT)26355A CAI Vocational Manual00284N MTQ Kit with USB Report Counter51400N MTQ USB Report Counter51454D MICROTEST Q Version 3.2 User Guide (DISCONT)MTQ503 MTQ Version 5.031 Base Pkg (CD-ROM)MTQ504 MTQ Version 5.04 Base Pkg (CD-ROM) (DISCONT)MTQ505 MTQ Version 5.05 Base Pkg (CD-ROM)MTQ506 MTQ Version 5.06 Base PackageMTQ50D MTQ Version 5.02 UpdateMTQ54P MTQ Version 5.04 Update (DISCONT)MTQ55P MTQ Version 5.05 UpdateMTQ56P MTQ Version 5.06 Update25001E MMPI-A Basic Scales Answer Keys (50/pkg)MTQ5PD MTQ Version 5.05 Patch DisketteMTQ5UP MTQ Version 5.031 Update25004C MMPI-A Interpretive Report User's GuideMTQCD3 MTQ Version 5.02 Base Pkg (CD-ROM)25005D MMPI-A Profile Forms Content/Supplementary ScalesMTQD0G MTQ Dongle OnlyZ25015 MMPI-A S/C Test Booklet - Single25013B MMPI-A Answer/Profile Sheets (50/pkg)25008M MMPI-A Vrin-Trin Pad25009D MMPI-A Profile Forms Harris-Lingoes Subscales25011E MMPI-A Harris-Lingoes Subscales Answer Keys51420I MMPI-A MICROTEST Q Answer Sheets (25/pkg): H/CZ51419 MMPI-A S/C MTQ A/S - SINGLEZ51420 MMPI-A H/C MTQ A/S - SINGLE48010B AUI Test Booklets48011A AUI Manual48013E AUI Answer Keys51605F Spanish BHI Hand-Scoring Test Booklets51606F English BHI Hand-Scoring Test Booklets51613C BHI Manual51614A BHI Answer KeysZ51529 BHI MTQ A/S - SINGLE26382B French CAI Vocational Answer Sheets26408G CAI Enh. Coloured Printout Paper(500) (DISCONT)26410A CAI Enhanced Manual50205G CAI-Voc. Understanding… (Profile) (25/pk)50207G CAI-Voc. Understanding… (Interp) (25/pk) (DISCONT)50209G CAI-Enh. Understanding… (25/pk)50213B CAI-Enh. MTA Hisp. A/S (25/pkg) (DISCONT)51462B CAI Vocational MTQ Answer Sheets (25/pkg)51465B English CAI Enhanced MTQ Career Assessmt Answ Sht (25/pkg)51466B Spanish CAI Enhanced MTQ Career Assessmt Answ Sht (25/pkg)Z26328 CAI Voc. Hispanic Prof - SingleZ26382 CAI Voc. French Answer Sheets (Singles)
Z51462 CAI MTQ VOC AN/SHT SINGLEZ51465 CAI ENH Q AN/SHT SINGLE25002E MMPI-A Basic Scales Answer Keys (50/pkg)25006E MMPI-A Content/Supplementary Scales Answer KeysZ48010 AUI Test Booklet - Single51492A SF-36 Health Survey Manual & Interpretive Guide51493A HSQ 2.0 User's Guide514950 HSQ 2.0 MICROTEST Q Single Administration Report514970 HSQ 2.0 MICROTEST Q Progress ReportZ51491 HSQ 2.0 MTQ Ans/Sht - Single45155L English MBHI Audiocassette45156L Spanish MBHI Audiocassette45099J Spanish MBHI Interpretive Report (Mail-In)45105J English MBHI Interpretive Report (Mail-In)46120A BHI 2 Manual46124 BHI 2 Mail-in Profile Report46128A BHI 2 Microtest Q™ Answer Sheets (25/pkg)00626J AUI Interpretive Mail-In Preview Pkg48015I AUI Interpretive Report Mail-In48018I AUI Profile Report Mail-In00754J AUI Interp. MTQ Preview Package514250 AUI Interpretive Report for MICROTEST Q514260 AUI Profile Report (MTQ)26305E English CAI Vocational Interpretive Report (Mail-in)26306E French CAI Vocational Interpretive Report (Mail-in)26308E English CAI Vocational Profile Report (Mail-in)26328E CAI-Voc. Hispanic Profile Report Mail-In26381E French CAI Vocational Profile Report (Mail-in)26400E English CAI Enhanced Profile Report (Mail-in)26402E Spanish CAI Enhanced Profile Report26405E CAI Enhanced Interpretive Report (Mail-in)51624 BHI 2 Microtest Q™ Progress ReportEMA1R0 Essentials of MMPI-2 AssessmentMCI1RA Interpretive Guide to the MCMI, 2nd Ed.EMS100 EMAS-SAS Complete KitPS11FA PSI French Reusable Maternal Test BookletsXSIIB0 SCID II PQ InstallationEQORK0 EQ-i Resource Report Kit-Web02401F Quickview Mail-In Answer Sheets02404F Quickview Mail-In Answer SheetsFAF01B French Canadian FAM-III General Scale QuikScoresFAF02C French Canadian FAM-III Dyadic Relation.QuikScoresFAF03D French Canadian FAM-III Self-Rating QuikScoresFAF04I French Canadian Brief FAM General Scale QuikScoresFAF05J French Canadian Brief FAM Dyadic Relp QuikScoresFAF06K French Canadian Brief FAM Self-Rating QuikScores25007E MMPI-A Content/Supplementary Scales Answer Keys51419I MMPI-A MICROTEST Q Answer Sheets (25/pkg): S/C00761F CAI-Vocational MTQ Preview Package51607J BHI Mail-in Spanish Profile Report51608J BHI Mail-in Profile Report51609H BHI Spanish Mail-in Interpretive ReportMTQMFE MTQ Annual Maintenance Fee00683K MBHI Interpretive MTQ Preview Package
514441 MBHI MTQ Interpretive Reports46125 BHI 2 Mail-In Interpretive Report46126 BHI 2 Mail-In Enhanced Interpretive Report51625A BHI 2 Microtest Q™ Profile Report51626A BHI 2 Microtest Q™ Basic Interpretive Report51627A BHI 2 Microtest Q™ Enhanced Interpretive ReportZ46128 BHI 2 Microtest Q™ Answer Sheets (singles)POCR00 Primer on Community Corrections (English)CW10PE CWPI Feedback FormsSASQ10 SASQ Online Report05658M BSI Profile Report Mail-In05647L English BSI Audiocassette05648L Spanish BSI Audiocassette33002L English MCM-II Audiocassette33003L Spanish MCM-II Audiocassette33012J English MCMI-III Interpretive Report Mail-In33013J English MCMI-III Profile Report Mail-In24010F MMPI-2 Hardcover Test Booklet24012E MMPI-2 Validity & Clinical Scales Answer Keys24106N MMPI-2 Additional Suppl. Scales Int. Answer Keys24037J MMPI-2 Alcohol & Drug Interpretive Report Mail-In24040J MMPI-2 Extended Score Report Mail-In24043J MMPI-2 Extended Score Report Mail-InPA7P0B PANSS Specimen SetPA9P0E French SCI PANSS FormsPAFR10 French PANSS QuikScore FormsPAFR20 French PANSS QuikScore FormsPAFR30 French PANSS KitCDS003 Brief CDS V.5 Profile ReportCDS004 CDS V.5 Preview VersionCDS005 CDS-R V.5 Computer Data Entry SheetsCDS006 Brief CDS V.5 Computer Data Entry SheetsCDSK30 CDS-R Complete KitNEO020 NEO PI-R Professional ManualNEO030 NEO PI-R Reusable Form S Item BookletsNEO040 NEO PI-R Reusable Form R Item BookletsNEO050 NEO PI-R Answer SheetsNEO060 NEO PI-R Answer SheetsNEO080 NEO PI-R Form S Adult Profile FormsNEO090 NEO PI-R Form R Adult Profile FormsNEO100 NEO PI-R Form R Adult Profile Forms48020D AUI Answer Sheets/Profile Forms51427H AUI MICROTEST Q Answer Sheets (25/pkg)Z51427 AUI MTQ A/S - SINGLE51491A HSQ 2.0 MTQ Answer Sheets (25/pkg)46101 BBHI2 Audiocassette (max -1)00817K BHI Microtest Q™ Preview Package515300 BHI Microtest Q™ Profile Report515310 BHI Microtest Q™ Interpretive Report46102 BBHI 2 Mail in Report46105A BBHI 2 MTQ Answer Sheets (25/pkg)46123 BHI2 Audiocassette51616A BBHI 2 Standard/Extended Report (MTQ)BBHIN BBHI - 2 Information
INBBHI BBHI 2 Sample ReportZ46105 BBHI 2 MTQ Answer Sheets - Singles51735G PDS Handscoring Starter Kit51736D PDS MTQ Preview Package51737B PDS MICROTEST Q Answer Sheets (25/pkg)51738A PDS Manual517390 PDS MICROTEST Q Profile Report51740F PDS Reorder KitZ51737 PDS MTQ Ans/Sht - SingleXSTPRO STAI for Windows Profile ReportMUM1RA Manual for Using the MMPI-2MC1R0L Millon Inventories: Clinical & Pers. Assessment5145EJ BSI Interpretive Report Mail-In5145HJ Spanish BSI Interpretive Report Mail-InCRF21I French Canadian CTRS-R:S Feedback FormsEQF10F French EQ-i Item BookletsEQF200 French EQ-i Individual Summary ReportEQF2D0 French EQ-i Development ReportEQF2R0 French EQ-i Resource ReportEQODK0 EQ-i Development Report Kit-Web51470A Quickview User's Guide51473B Quickview Hardcover Test Booklet51474B Quickview Softcover Test Booklet05631B BSI Nonpatient Adult Reorder Kit05638B BSI Nonpatient Adolescent Reorder Kit05640B BSI Inpatient Psychiatric Reorder Kit51904N BSI 18 Community Norms Profile FormNEO110 NEO PI-R College Profile FormsNEO120 NEO PI-R Summary Feedback SheetsNEO130 NEO PI-R Manual and SupplementNEO140 Spanish NEO PI-R Reusable Form S Item BookletsNEO150 Spanish NEO PI-R Feedback Sheets02202B P-3 Hand-Scoring Answer Sheets02200E P-3 Mail-In Interpretive ReportCW1P0A CWPI Complete KitCW1PFA CWPI French KitCW2P0B CWPI Technical ManualCW3P0B CWPI Counsellor's ManualCW4P0B CWPI Job DictionaryCW5P0C CWPI QuikScore FormsCW7P0D CWPI Work SheetsCW9P0E CWPI Feedback Forms088A0A CAB Battery 1 Preview PackageEQ3601 EQ-360 Multirater Feedback Report Mail/Fax KitZCRS9S CRS-R Site Co-ordinators Kit00502E CAI-Voc Interp. Mail-In Preview Pkg00650F CAI-Enh. Interp. Mail-In Preview Pkg51611L Spanish BHI Audio Cassette51610J BHI Mail-in Interpretive ReportMSC010 MSCEIT Item Booklet (1) (R&D use)26461D CISS Profile Report Mail-In27400B EPS Preview Package24001D MMPI-2 Validity & Clinical Scales Profile Forms24002D MMPI-2 Content Profile Forms
24004D MMPI-2 Supplementary Profile Forms24005D MMPI-2 Clinical Subscale Profile Forms24006D MMPI-2 Non-K Corrected Valid. & Clin.Profile Forms24063J MMPI-2 Personnel Selection Interpretive Mail-In05618B SCL-90-R English Answer Sheets05621D SCL-90-R Outpatient Psychiatric Reorder Kit05622D SCL-90-R Inpatient Psychiatric Reorder Kit05630L SCL-90 Analogue Forms05650E SCL-90-R Answer Keys05651B French SCL-90-R Hand-Score Answer Sheets50058M SCL-90-R Profile Report Mail-In5143EJ SCL-90-R Interpretive Report Mail-In5143FJ French SCL-90-R Interpretive Report Mail-In5143HJ Spanish SCL-90-R Interpretive Report Mail-In51400D 16PF 5th Ed. Question Booklets51500E 16PF 5th Ed. Answer Sheets51600F 16PF 5th Ed. Individual Record Forms51700G 16PF 5th Ed. Scoring Keys & Norm Tables51900C 16PF 5th Ed. Technical Manual5190NS 16PF 5th Ed. Norm Supplement, 2002520A0F Couples Counselling Report (CCR) Mail-in52900C Karson Clinical Report (KCR) 5th Ed. Manual580M0D Teamwork Development Report (TDR) Mail-in58200B Teamwork Development Report (TDR) ManualPFEC1B 16PF English/Canadian Version KitPFEC2C 16PF English/Cdn Supplemental ManualEQ3603 EQ-360 Technical ManualEQ3605 EQ-360 Item BookletsEQ3606 EQ-360 Additional Rater Response Sheets26469A CISS Softcover Manual088B0A CAB Battery 2 Preview Package088C0A CAB Battery 3/4 Preview Package088D0A CAB Battery 5 Preview Package08900D CAB Profile Sheets090A0E CAB 1 Scoring Keys & Instructions090B0E CAB 2 Scoring Keys & Instructions090C0E CAB 3 Scoring Keys & Instructions09900C CAB 3/4 Test Booklets51751B GAMA Manual51752D GAMA English Test Booklet51753C GAMA Handscoring Answer Sheets51754D Spanish GAMA Test BookletPSCW01 P-SCAN RV2 Profile Reports - WebNEO200 NEO-FFI Introductory Kit562MN0 16PF 5th Ed. CCPI Manual560MI0 CCPI Mail-In Report52200C Couples Counselling Report (CCR) User's Guide432M0D PCDP Plus Report Mail-In43500E 16PF 5th Ed. PCDP Manual454M0B PCDP Report Mail-InPFFR10 16PF 5th Ed. French Kit514F0A French 16PF 5th Ed. Test Booklets27500C EPS Perspectives on Executive PersonalityCSQ020 SHQ-R V.5 Comprehensive Reports
00760F CAI-Enhanced Interp. MTQ Preview Package514600 CAI Vocational MICROTEST Q Interpretive Report514610 CAI Vocational Microtest Q™ Profile Report514630 CAI Enhanced MICROTEST Q Interpretive Report514640 CAI Enhanced MICROTEST Q Profile Report51612L BHI English Audiocassette00818K BHI Mail-In Preview Package515320 BHI Microtest Q™ Progress Report46100A BBHI 2 ManualIAM20A International Adaptations of the MMPI-2SP8FR0 French (Canadian) SPAI QuikScore FormsEMS200 EMAS-SAS Answer SheetsEMS300 EMAS-SAS Profile FormsEMS400 EMAS-SAS Scoring TemplateEMS500 EMAS-SAS Manual Extension51907N BSI 18 Answer Sheets00652A BSI Outpatient Psychiatric Starter Kit00653A BSI Inpatient Psychiatric Starter Kit00677A BSI Nonpatient Adult Starter KitPCLR01 PCL-R : 2nd Ed. Complete Kit51767A VIP ManualPS2F0A PSI French (Canadian) KitPS3F0A PSI French ManualSA4502 SA-45 V.5 Profile ReportsSA4503 SA-45 V.5 Preview Version27700D EPS Test Booklets278M0B EPS Report Mail-In27900E EPS Answer SheetsCRF310 French Canadian CPRS-R:S Data Entry SheetsCRF300 French Canadian CTRS-R:L Data Entry SheetsCRF290 French Canadian CPRS-R:L Data Entry SheetsCRF280 French Canadian CPRS-R:L Data Entry SheetsCRF22I French Canadian CTRS-R:S Feedback FormsCRF20I French Canadian CTRS-R:L Feedback FormsCRF19I French Canadian CTRS-R:L Feedback FormsCRF18K French Canadian CPRS-R:S Feedback FormsCRF17K French Canadian CPRS-R:S Feedback FormsCRF16K French Canadian CPRS-R:L Feedback FormsCRF15K French Canadian CPRS-R:L Feedback FormsEQYV52 EQ-i :YV V.5 Profile ReportsEQYV53 EQ-i :YV V.5 Preview Version24017F English MMPI-2 Softcover Test Booklets00697A MMPI-2 Hand-Scoring Kit25015F MMPI-A Softcover Test Booklets25016F MMPI-A Hardcover Test Booklets46145 Single test bookletCD3P0B CDI ManualCD4P0A CDI Complete KitCD5P0C CDI-Short QuikScore FormsCD6P0A CDI/CDI-S Complete KitCD7P0A CDI-S Complete KitCD8P0C CDI QuikScore FormsCD9P0C CDI-Short QuikScore FormsCDIF10 French Canadian CDI QuikScore Forms (25/pkg)
CDIF20 French Canadian CDI QuikScore Forms (100/pkg)CDIF30 French Canadian CDI-Short QuikScore Forms (25/pkg)CDIF40 French Canadian CDI-Short QuikScore Forms (100/pkgCDIS2J Spanish CDI QuikScore Forms (100/pkg)CDIS30 Spanish CDI-Short QuikScores (25/pkg)CDIS40 Spanish CDI-Short QuikScores (100/pkg)CH1ROAMA3UPAKCPT20 CPT II/K-CPT Preview Version700000 APQ Guidance Report45103C MAPI ManualCDS10C Spanish CDI Quikscore Forms (25/pkg)CDIP0L CDI Data Entry SheetsCDIS0L CDI-Short Data Entry SheetsXCDIOO CDI PsychManager ReportsGADS10 GADS Complete KitINSET0 SET Product InformationEQIW02 BarOn EQ-i:YV Profile Reports Kit WebPPC001 PPC Complete KitEQYS6 Spanish BarOn EQ-i:YV/EQ-i:YV(S) KitEQYV54 EQ-i :YV V.5 Data Entry SheetsEQYV55 EQ-i :YV(S) V.5 Data Entry Sheets33005A MCMI-III Handscoring Starter KitCLES50 CLES Complete KitCTMO0A CTMT Record BookletsXDI1PH DICA-IV ParentXDI2CH DICA-IV Child/Adolescent25021J MMPI-A Basic Service Profile Report Mail-In25022J MMPI-A Basic Service Profile Report Mail-In25023J MMPI-A Extended Score Report Mail-In45211L MACI English Audiocassette45212L MACI Spanish Audiocassette45220J MACI Mail-in Interpretive Report45102J MAPI Clinical Interpretive Report45108J Spanish MAPI Clinical Interpretive Report02303B ISO-30 Hand-Scoring Reorder Kit02302D ISO-30 ManualCTMO2A CTMT Examiner's Manual25010E MMPI-A Harris-Lingoes Subscales Answer KeysXCDID0 CDI Computer Preview for WindowsCDI11 CDI Parent QuickscoreCDI20 CDI Teacher QuickScoreCD2P0C CDI QuikScore FormsXCACD0 CAS-CV Preview Version (diskette)TP1V1C Turning Points Patient VideoHDI08 HDI-S Response FormsCDI10 CDI Parent QuickscoreCDI21 CDI Teacher QuickScore703000 APQ Test Booklets704000 APQ Answer Sheets708000 APQ Psychological ReportEQIW01 BarOn EQ-i:YV Profile Reports WebEQYS5 Spanish BarOn EQ-i:YV KitHSG00A Homework Survival Guide
00350O SCL-90-R: Personality Disorders ResearchFABW01 FAB-C Profile Reports - WebFABW02 FAB-C Profile Report Kit - Web25012B MMPI-A Answer/Profile Sheets (50/pkg)25024J MMPI-A Extended Score Report Mail-In25025J MMPI-A Interpretive Report Mail-In25026J MMPI-A Interpretive Report Mail-InCTMO1A CTMT Complete KitXSIIDO SCID II PQ Disks onlyIEQ01A IEQ Research Version ManualFTT002 FTT Technical ManualFTT003 FTT Picture CardsFTT004 FTT Interview GuidesM21R0A MMPI-2 In Psychological TreatmentPS12FA PSI French Reusable Paternal Test Booklets515270 P-3 Interpretive Report (MTQ)02100C Quality of Life Inventory ManualPSC01 Hare P-Scan RV2 : V.5 Profile Report Uses - NYPPSPW01 PSP Reports-Web05639B BSI Outpatient Psychiatric Reorder Kit05649E BSI Answer Keys05653B French BSI Hand-Scoring Answer Sheets05656I Spanish BSI Answer Sheets51905N BSI 18 Oncology Norms Profile Forms51906N BSI 18 Manual00300D 16PF Form A Test Booklets 4th Ed.(25/pkg)LO1P0A Learned Optimism51750E GAMA Microtest Q Answer Sheets00910A GAMA Hand-Scoring Starter Kit51925N MBMD Profile Report Mail-InCI1P0A CISS Adult Complete KitDTS7FB French DTS QuikScore FormsDTS8FC French DTS Complete KitDTS9FB French DTS Specimen Set33014J Spanish MCMI-III Interpretive Report Mail-In33015J Spanish MCMI-III Profile Report Mail-In33018J English MCMI-III Corrections Interpretive Mail-InCP2D3B CPT Preview Version (3 uses) - DOS00693A SCL-90-R Outpatient Psychiatric Starter KitPFEC3D 16PF English/Canadian Scoring TemplatePFEC4E 16PF English/Cdn QuikScore FormssPFEC5E 16PF English/Cdn QuikScore FormsEQ3602 EQ-360 Multirater Feedback Report Reorder KitEQ3604 EQ-360 Item BookletsEQ3607 EQ-360 Additional Rater Response SheetsEQ3610 EQ-360 Multirater Feedback Report- Web KitEQ3611 EQ-360 Multirater Feedback Reports - WebCDS002 CDS-R V.5 Profile ReportRSP02 R-SOPAC Specimen Set51768B VIP Test Booklet51772C VIP Interpretive Report Mail-In52300D CCR Test Booklets52400E CCR Answer SheetsCRF410 French Canadian CADS-A QuikScore Forms
CRF400 French Canadian CADS-A QuikScore FormsCRF390 French Canadian CADS-T QuikScore FormsCRF380 French Canadian CADS-T QuikScore FormsCRF370 French Canadian CADS-P QuikScore FormsCRF360 French Canadian CADS-P QuikScore FormsCRF350 French Canadian CGI-P QuikScore FormsCRF340 French Canadian CGI-T QuikScore FormsCRF330 French Canadian CASS:S Data Entry SheetsCRF320 French Canadian CASS:L Data Entry SheetsCRF13A Complete French CRS-R Parent, Teacher, &AdolescentCRF08F French Canadian CTRS-R:S QuikScore FormsCRF07F French Canadian CTRS-R:S QuikScore FormsCRF06E French Canadian CTRS-R:L QuikScore FormsCRF05E French Canadian CTRS-R:L QuikScore FormsCRF04H French Canadian CPRS-R:S QuikScore FormsCRF03H French Canadian CPRS-R:S QuikScore FormsNEO070 NEO PI-R Form S Adult Profile FormsEQ4R00 Working with Emotional IntelligenceLSIS1A LSI-R:Screening Version Complete KitSASF10 French SAS QuikScore FormsSASF20 French SAS Item BookletsSASF30 French SAS-SR QuikScore FormsSAS200 SASSI-3 User's GuideSAS300 SASSI-3 Connecting Clinician & Client VideoSAS400 SASSI-3 Questionnaire/ProfilesSAS410 SASSI-3 Handscoring KitSAS500 SASSI-3 Questionnaire/ProfilesSAS600 SASSI-3 SoftwareSAS700 SASSI-3 SoftwareSAS800 SASSI-3 SoftwareSAS900 SASSI-3 Scoring KeySASA10 SASSI-A2 ManualSASA20 SASSI-A2 User's GuideSASA3 SASSI-A2 Scoring KeySASA40 SASSI-A2 Handscoring KitSASA50 SASSI-A2 Questionnaire/ProfilesSASA60 SASSI-A2 Questionnaire/ProfilesSASA70 SASSI-A2 SoftwareSASA80 SASSI-A2 SoftwareSASA90 SASSI-A2 Software090D0E CAB 4 Scoring Keys & Instructions09100E CAB 5 Scoring Keys & Instructions09200F CAB 1& 2 Answer Sheets09400F CAB 3 & 4 Answer Sheets09500F CAB Audio Cassette Tape09700C CAB 1 Test Booklets09800C CAB 2 Test Booklets10000C CAB 5 Test BookletsPCLS8T PCL:SV Interview GuidesNEO220 NEO-FFI Form S BookletsNEO230 NEO-FFI Form S BookletsNEO300 NEO PDR Introductory KitNEO310 NEO PDR Software User's ManualNEO320 NEO PDR 3.5" Key Diskette
NEO340 NEO PDR Pocket Folders475M0B HRDR Mail-in Report47700C 16PF 5th Ed. HDRD ManualCRF14D French Canadian CRS-R Specimen SetCRF02G French Canadian CPRS-R:L QuikScore FormsCRF01G French Canadian CPRS-R:L QuikScore FormsCRS59A Iowa Conners' Teacher Rating FormsJIR001 JI-R Complete KitJIR007 JI-R Specimen SetJIR002 JI-R Technical ManualJIR003 JI-R Item BookletsJIR004 JI-R Response FormsJIR005 JI-R Response FormsJIR006 JI-R Scoring TemplatesJIR010 JI-R Profile Report (Mail-in/Fax-in)JIR011 JI-R Interpretive Report (Mail-in/Fax-in)JIR015 JI-R Profile Report Kit - WebJIR016 JI-R Profile Report - Web00995N MBMD Reorder Kit00996N MBMD Hand-Scoring Starter Kit51927N MBMD Interpretive Report Mail-In51931N MBMD Test Booklets51938N MBMD Audiocassette51940N MBMD Manual51968N MBMD Large Print Answer Sheets02201A P-3 Inventory Manual02108A Quality of Life Inventory Starter Kit02109B Quality of Life Inventory Reorder Kit26471F CISS Pattern Worksheets26479F CISS Report Cover Sheets26486A CISS Hardcover Manual51811F CISS Career Planner35021A IDEAS Manual35022B Spanish IDEAS Test BookletsCRS1RW Conners' Rating Scales (Annotated Bibloiography)JIR018 JI-R Interpretive Report - WebCHI10A Preview VersionJIR022 JI-R V.5 Preview VersionCHI40A Consussion and FatigueJIR023 JI-R V.5 Computer Data Entry SheetsJIR024 JI-R V.5 Interpretive ReportsCHI60A Concussion and AngerCHI70A Concussion, Personality Change, and the FamilyPS4F0A PSI French Answer Sheets/Profile FormsWV100A Walker Visuals KitWV100J Walker Color Cards (set of 4)WV200A Walker Visuals ManualWV300A Walker Visuals QuikScores: Image 1WV400A Walker Visuals QuikScores: Image 2WV500A Walker Visuals QuikScores: Image 3WV600A Walker Visuals QuikScores: Image 4WV700A Walker Visuals QuikScores SetWV900I Walker Visuals Self-Assessment FormsJB9P0M JBC Self Data Entry Sheets
JI5P0C JI Test BookletsJIIM00 JI Interpretive Report (Mail-in/Fax-in)PCLR02 PCL-R: 2nd Ed. Technical ManualPCLR03 PCL-R: 2nd Ed. Rating BookletPCLR04 PCL-R: 2nd Ed. QuikScore FormsPCLR05 PCL-R: 2nd Ed. QuikScore FormsPCLR06 PCL-R : 2nd Ed. Interview GuidesPCLR07 PCL-R: 2nd Ed. Interview GuidesPCLR08 PCL-R: 2nd Ed. Specimen SetCSQ030 SHQ-R V.5 Preview VersionPDSF20 French PDS QuikScore FormsXSSEIN SSPQ-X for WindowsCAD07 French (Canadian) CADS-P:V.5 Data Entry SheetsCAD08 French (Canadian) CADS-T:V.5 Data Entry SheetsCAD09 French (Canadian) CADS-A:V.5 Data Entry SheetsCRS76 French (Canadian) CGI-T:V.5 Data Entry SheetsCRS77 French (Canadian) CGI-P:V.5 Data Entry SheetsCMDQ3 French Canadian CMDQ FormsCMDQ4 French Canadian CMDQ FormsCHI20A IntroductionJIR021 JI-R V.5 Profile ReportCHI30A Concussion and MemoryCHI50A Concussion and AttentionDA1R0A Development & Use of MMPI-2 Content ScalesLS4FP0 French LSI-R Interview GuidesWLS2V0 Williams Lifeskill Video SetPOM04LS12P LSI-R ColorPlot Profile Forms- U.S. NormsLS13P LSI-R ColorPlot Profile Forms- U.S. NormsLS14P LSI-R U.S. Norms SupplementSAT1RPOFR00 Primer on Community Corrections (French)QLQW01 QLQ Reports - WebSASQ20 SASQ Preview UsePCL1FQ French (Canadian) PCL-R Complete KitPCL7FQ French (Canadian) PCL-R Specimen SetPCL4FQ French (Canadian) PCL-R QuikScore FormsPCL5FQ French (Canadian) PCL-R Interview GuidesMSC07 MSCEIT Personal Summary Report Kit- WebPOM23 POMS BiPolar QuickScorePDSF30 French PDS Complete KitLS3FP0 French LSI-R Interview GuidsLS5PFE French LSI-R QuikscoresWLS3V0 Williams Lifeskills Corporate Library SetPCYV01POM22 POMS BiPolar QuickScoreSASQ1O SASQ Online ReportPOM03
Additional(25/pkg)(3 uses)
(25/pkg)BarOn EQ-i:YV Manual and 3 EQ-i:YV and 3 EQ-i:YV(S) QuikScore Forms(100/pkg)(100/pkg)
(20/pkg)
minimum purchase of 50(5/pkg; reusable)(20/pkg)1 Item Booklet and 5 QuikScore Forms/Interpretation Guides(20/pkg)
QLQ Manual, 10 Question Booklets, and 25 QuikScore FormsQLQ Manual, 1 Question Booklet, and 3 QuikScore Forms(25/pkg)
(100/pkg)(10/pkg)
RCL Manual and 25 QuikScore Forms
(25/pkg)(20/pkg)(20/pkg)1 of each leaflet(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)unlimited use
(Video, 32 min.)
(100/pkg)
R-SOPAC Technical Manual and 25 QuikScore Forms
(25/pkg)
(100/pkg)3 cassettes and 8-page guide, male narrator
3 cassettes and 8-page guide, female narrator
SARA Manual, 25 Checklist Forms, and 25 Assessment FormsSARA Manual, 3 Checklist Forms, and 3 Assessment Forms
(25/pkg)SA-45 Technical Manual and 25 QuikScore Forms
(25/pkg)SA-45 Technical Manual and 3 QuikScore Forms(100/pkg)(25/pkg)(100/pkg)
SAS-SR User's Manual, 10 Question Booklets, and 25 QuikScore Forms
(25/pkg)(100/pkg)(10/pkg)SAS-SR User's Manual, 3 Question Booklets, and 3 QuikScore Forms
(155 pages, 1994)(5/pkg)Interviewer's Guide with 5 SCID-D formsManual and 25 Autoscore Forms
(25/pkg)User's Guide, 1 Administration Booklet, and 5 Scoresheets(160 pages)(96 pages)(5/pkg)SCID-II User's Guide and 5 SCID-II Questionnaires
(5/pkg)
(5/pkg)(10/pkg)Manual, 25 Reusable Item Booklets, and 25 Handscorable Answer Sheets/Profile Forms
(25/pkg; reusable)(25/pkg)with test items(50/pkg)with Calibrated Norm Tables
SPAI Manual and 25 QuikScore forms
(25/pkg)
(100/pkg)SPAI Manual and 3 QuikScore forms
SPAI-C Manual and 25 QuikScore Forms
(25/pkg)SPSI-R Technical Manual, and 25 SPSI-R:L and 25 SPSI-R:S QuikScore FormsSPSI-R Technical Manual and 25 SPSI-R:L QuikScore FormsSPSI-R Technical Manual and 25 SPSI-R:S QuikScore FormsSPSI-R Technical Manual, 3 SPSI-R:L, and 3 SPSI-R:S QuikScore Forms
(25/pkg)(100/pkg)(25/pkg)(100/pkg)Session Summary disk, CRW disk, and CRW Software Manual
Manual with Scoring Key and 25 Questionnaires(25/pkg)
Software Manual and 3 uses(50/pkg)minimum purchase of 50 uses
Manual and set of 31 Picture Cards
TD Monitor Manual, 25 modified AIMS QuikScore Forms, 25 Modified Webster QuikScore Forms, and 25 TD Monitor History FormsTDS disk, CRW disk, and CRW Software ManualTD Monitor Manual, 1 modified AIMS QuikScore Form, 1 Modified Webster QuikScore Form, and 1 TD Monitor History Form(25/pkg)
(25/pkg)
(100/pkg)Manual, Picture Book, and 25 Profile/Examiner Forms
(25/pkg)
3.5" disks3.5" disks
Manual, Picture Book, and 25 Profile/Examiner Record Forms
(25/Pk)3.5" disks3.5" disksTOL-DX Manual, 2 Peg Boards with Beads, 25 Child and 25 Adult Recording Forms
(25/pkg)(25/pkg)TOL-DX Manual, 2 Peg Boards with Beads, 25 Adult Recording FormsTOL-DX Manual, 2 Peg Boards with Beads, 25 Child Recording FormsManual, Picture Book, 50 Form A and 50 Form B Answer Booklet and Record Forms(50/pkg)(50/pkg)Examiner's Manual, Picture Book, 25 Record Forms and Administration Booklets, 25 Supplementary Analysis Forms, Facial Memory Picture Book, 15 Facial Memory Chips. Visual Selective Reminding Test Board, and a set of Delayed Recall Cue Cards(25/pkg)User's Manual, 1 Set of Stimulus Booklets, and 25 Recording Forms
(set of 3)(25/pkg)(hardcover, 1993, 672 pages)(hardcover, 1991, 672 pages)(hardcover, 1995, 430 pages)
(1 Audiotape and Handbook)
Manual, Test Plates, and 25 Record Forms
(set of 144)(25/pkg)Manual, Test Plates, and 25 Record Forms
(25/pkg)SoftcoverHardcover
WCST Manual, 2 Decks of Cards, and 25 Record Booklets(25/pkg)
unlimited-use Software, Online Manual, 1 set of Keytops, and 25 WCST Computer Version Record Forms(Set of 2)unlimited-use Software, Online Manual, 1 set of Keytops, 25 WCST Computer Version Record Forms, and the Revised and Expanded WCST Professional Manual(1993, 230 pages)WCST:CV3 Scoring Program CD-ROM, WCST Manual, 2 Decks of Cards, and 50 Record Booklets(25/pkg)CD-ROM, online Manual, and 25 WCST:CV3 Record FormsWCST-64 Manual, 50 Record Booklets, and 1 WCST Card Deck
(25/pkg)(50/pkg)
onscreen Software Manual, 3.5" disk, and WCST-64:CV Record FormsWISC-III disk, CRW disk, and CRW software manual
(25/pkg)(25/pkg)(25/pkg)2/setManual, 25 Blue Test Forms, 25 Tan Test Forms, 25 Profile/Analysis Forms, Plastic Cards for Reading/Spelling, and Soft Attache Case3.5" disksManual, 25 Drawing Forms, 25 Examiner Forms (Visual-Motor), 25 Matching Forms (Visual-Spatial), Pegboards and Pegs (Fine-Motor), and a WRAVMA Soft Attache Case
(25/pkg)(25/pkg)(25/pkg)Levels 1, 2, 3, 4, & 5 Administration Manuals, Technical Manual, and 10 Booklets and 10 Forms for Levels 1, 2, 3, 4, & 5Level 1 Manual, Technical Manual, 25 Level 1 Booklets, and 25 Level 1 Scoring FormsLevel 2 Manual, Technical Manual, 25 Level 2 Booklets, and 25 Level 2 Scoring FormsLevel 3 Manual, Technical Manual, 25 Level 3 Booklets, and 25 Level 3 Scoring FormsLevel 4 Manual, Technical Manual, 25 Level 4 Booklets, and 25 Level 4 Scoring FormsLevel 5 Manual, Technical Manual, 25 Level 5 Booklets, and 25 Level 5 Scoring FormsReading/Math Manual, Flipbook, and 25 Response Forms
(Unlimited use)1 SCID II PQ Installation and 1 CAS II ES InstallationCAS-CV Software Manual and 3 uses3 Interpretive Report uses and the CRS-R Software Manualminimum purchase of 25 usesminimum purchase of 50 usesminmum purchase of 25DAS Software Manual and 3 UsesDAS User's Manual, DAS Software Manual, and 6 usesminmum purchase of 50 uses3 Child/Adolescent uses, 3 Parent uses, and Software Manualunlimited use
BarOn EQ-i Technical Manual, Software Manual, and 3 Development Report scorings
BarOn EQ-i Technical Manual, Software Manual, and 3 Resource Report scorings
3 FAM-III Profile Report uses and a Software Manual
unlimited use3 program launches and a Software Manual(6 user)
Software Manual and 3 usesminimum purchase of 50
3 program launches and a Software Manual
minimum purchase of 25 usesminimum purchase of 25 usesSoftware Manual and 3 Interpretive Report Scoringsminimum purchase of 25 usesSoftware Manual and 3 Interpretive Reportsminimum purchase of 50 uses(unlimited use)(Software Manual and 3 uses)Software Manual and 3 uses
Software Manual and 3 Uses
(3 uses)Software Manual and 3 uses(50/pkg)minimum purchase of 25 reports(Unlimited use)(3 uses)(3 uses)
STAI Software Manual and 3 Profile uses(50/pkg)Software Manual and 3 usesTOMM User's Manual, Software Manual, and 3 uses
YLS/CMI User's Manual, 25 Interview Guides, 25 QuikScore Forms, and 25 Case-Management FormsYLS/CMI User's Manual, 3 Interview Guides, 3 QuikScore Forms, and 3 Case-Management Forms
(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)
Examiner's Manual, 25 Examination Booklets, and 25 Profile and Scoring Forms
(25/pkg)(25/pkg)Examiner's Manual, 25 Examination Booklets, and 25 Profile and Scoring Forms(25/pkg)(25/pkg)
(25/pkg)(25/pkg)(25/pkg)
Manual and 25 AutoScore Forms
(25/pk)
APSD Technical Manual and 25 APSD-T, 25 APSD-T, and 25 APSD-C QuikScore FormsAPSD Technical Manual and 3 APSD-T, 3 APSD-T, and 3 APSD-C QuikScore Forms
(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(25/pkg)(25/pkg)(25/pkg)ASDS Manual and 50 Summary/Response Forms
(50/pkg)
(10/pkg)(130 min.) and handbook(30/pkg)
BRIEF Manual, 25 Parent Form Questionnaires, 25 Teacher Form Questionnaires, 50 Parent Form Scoring/Summary Profile Forms, and 50 Teacher Form Scoring/Summary Profile Forms
(50/pkg)(50/pkg)
softcover
(10/pkg)
(10/pkg)CAADID Technical Manual, 10 Patient History Forms, and 10 Diagnostic Criteria Interview FormsCAADID Technical Manual, 1 Patient History Form, and 1 Diagnostic Criteria Interview Forms(25/pkg)(100/pk)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)1 set of 6 Group Leader's Guides, 10 Group Member's Workbooks, 1 Master Package, and 1 Audiotape(set of 6)(10/pkg)CAARS Technical Manual and 25 QuikScore Forms for each of the CAARS-S:L, CAARS-S:S, CAARS-S:SV, CAARS-O:L, CAARS-O:S, and CAARS-O:SV(100/pkg)(25/pkg)(100/pkg)(100/pkg)
(25/pkg)(100/pkg)(25/pkg)minimum purchase of 50 reportsminimum purchase of 25 reports3 Interpretive Report uses and the CAARS V.5 Getting Started Guide(50/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(100/pkg)(50/pkg)(25/pkg)(100/pkg)(25/pkg)CAARS Technical Manual and 1 QuikScore Form for each of the CAARS-S:L, CAARS-S:S, CAARS-S:SV, CAARS-O:L, CAARS-O:S, and CAARS-O:SVCASE Manual, 25 CASE Form S and 25 CASE Form R Item Booklets, 25 CASE Form S and 25 CASE Form R Handscorable Answer Sheets, and 50 CASE Profile Forms
(pad of 50)(25/pkg)(25/pkg)(25/pkg)(25/pkg)
(16 pages; 20/pkg; software required)Chemical Dependency disk, CRW disk, and CRW Software Manual
(25/pkg)(100/pkg)(25/pkg)(100/pkg)
CDS Technical Manual, 3 CDS-R, and 3 Brief CDS QuikScore FormsCDS Technical Manual, 25 CDS-R, and 25 Brief CDS QuikScore FormsCDS Technical Manual and 25 Brief CDS QuikScore Forms
CHIP Technical Manual and 25 QuikScore Forms
CHIP Technical Manual and 3 QuikScore Forms(25/pk)(100/pkg)CISS Manual, 25 Adult QuikScore Forms, and 25 SSC QuikScore Forms
(25/pkg)(25/pkg)
CISS Manual and 3 each of Adult, Adolescent, and SSC QuikScore Forms
CISS Manual and 25 Adolescent QuikScore Forms(25/pkg)
(25/pkg)(25/pkg)(25/pkg)CLES Technical Manual and 3 QuikScore Forms for each of the CLES-P, CLES-C, and CLES-A
(25/pkg)(100/pkg)
(25/pkg)
(25/pkg)
(25/pkg)(25/pkg)(25/pkg)(CPT II Software Manual and K-CPT Software Manual, 3 CPT-II uses, and 3 K-CPT uses)
(25/pkg)(100/pkg)(25/pkg)
(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)
(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, and CTRS-R:S)(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, and CTRS-R:S)(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:L, CTRS:L, and CASS:L)(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:S, CTRS-R:S, and CASS:S)(CRS-R Technical Manual and 1 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CADS-P, CADS-T, CADS-A, CGI-T, CGI-P, 1 CRS-R Treatment Progress Colorplot™ Form, 1 Feedback Handout, and 1 CTIF)(1997, 209 pages)(1997, 79 pages)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)
(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(100/pkg)
(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(50/pkg)
(50/pkg)(15/pkg)CRS-R Technical Manual, 25 CGI-T and CGI-T QuikScore Forms, and 15 CRS-R Treatment Progress ColorPlot Forms(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L and CASS:S)50 CGI-T QuikScore Forms, 50 CGI-P QuikScore Forms, and 15 CRS-R Treatment Progress ColorPlot Formsminimum purchase of 50 usesminimum purchase of 25 uses3 Interpretive Report Uses and the CRS-R Software Manual(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)
CRS-R Technical Manual (English) and 25 QuikScore forms for each of Spanish CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, and CASS:SCRS-R Technical Manual (English) and 1 QuikScore forms for each of Spanish CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CADS-P, CADS-T, CADS-A, CGI-T, CGI-P, 1 CRS-R Treatment Progress Colorplot form (English), 1 Feedback Hangdout, and 1 CTIF(50/pkg)(50/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)
(50/pkg)(50/pkg)CRS-R Technical Manual, 25 QuikScore Forms, and 25 Feedback Handouts for each of CADS-P, CADS-T, and CADS-A(50/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)STAIC Manual with Scoring Key and 25 STAIC Questionnaires(25/pkg)
(3/pkg, reusable)(10/pkg, reusable)
SHQ-R Technical Manual, 1 Item Booklet, and 1 Comprehensive Report
(25/pkg)(CD-Rom for Macintosh)
(CD-ROM for Windows)(3.5" disks; 3 uses)(3.5" disks)(25/pkg)(25/pkg)(25/pkg)3.5" disksExaminer's Manual, Analogies Book, Categories Picture Book, Sequences Picture Book, and 25 Profile/Examiner Record Forms
(25/pkg)(25/pkg)(25/pkg)
(25/pkg)(100/pkg)(25/pkg)(100/pkg)Clock Test Manual, Stimulus Cards Tent, 25 QuikScore Forms, and 25 Profile SheetsDAS Manual and 20 QuikScore FormsDAS Manual and 6 QuikScore Forms(20 Forms–10 Couples/pkg)
hardcoversoftcover
hardcover, 943 pagessoftcover, 943 pagesspiralbound, 370 pagessoftcover, 370 pages
(25/pkg)Examiner's Manual, 25 Response Forms, 25 Profile/Examiner Record Forms, and a Picture Book(25/pkg)Examiner's Manual; Picture Book 1 for Design Sequences, Design Reproduction, and Symbolic Relations; Picture Book 2 for Story Sequences and Story Construction; 25 Profile/Summary Forms; 25 Examiner Record Booklets; 25 Response Forms; Story Sequence Chips; Design Sequence Cubes(25/pkg)(25/pkg)(25/pkg)
(3.5" disks)DTS Maunaul and 25 QuikScore Forms
(100/pkg)DTS Manual and 3 QuikScore Forms(25/pkg)(100/pkg)DTS Manual (English) and 25 Spanish QuikScore FormsDTS Manual (English) and 3 Spanish QuikScore FormsExaminer's Manual, Picture Book, 25 Profile/Examiner Record Forms, and 25 Response Booklets
Softcover, 2001, 230 pagesHardcover, 2001, 230 pages
Manual, 25 EMAS-S, and 25 EMAS-T/EMAS-P Forms
(25/pkg)(25/pkg)
Hardcover, 1995, 352 pages
Softcover, 1995, 352 pages
Hardcover(with Slide Masters)
(3/pkg)(10/pkg)(50/pkg)(25/pkg, requires BarOn Eq-i® Item Booklets)(Mail-In/Fax-In)EQ-i Technical Manual, 1 Item Booklet, and 1 Development Report Response Sheet
(Mail-In/Fax-In)
Technical Manual, Getting Started Guide, 3 Development Report uses, and softwareTechnical Manual, Getting Started Guide, 3 Resource Report uses, and software
JI-R Technical Manual and 2 Interpretive Reportsincludes ISO-30 manual and 10 carbonless English Answer SheetsCDI Manual, 3 CDI and 3 CDI-S QuikScore FormsQLQ Manual and 1 QLQ Report- Webincludes BSI Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and BSI Bibliographyoptional, can be used instead of Softcover Test BookletoptionaloptionalSET Therapist's Guide and 5 Workbooks
(25/pkg)
(5/pkg)includes 7 Patient Videotapes, 1 Practitioner's Supplementary Video, 5 Patient Workbooks, and 1 Practitioner's Guide
Mail-in/Fax-in(10/pkg)(15/pkg)
(50/pkg)
(50/pkg; self-contained booklet includes instructions for self-scoring)
(25/pkg)
FTT Technical Manual, Picture Cards, and 25 Interview Guides
Manual, Technical Manual/Norm Tables, Supplementary Manual, and 50 Score Sheets
includes 50 Answer Sheets, 50 Worksheets, and 50 Profile Forms(10/pkg)HardcoverHardcoverHardcoverSoftcoverSoftcoverSoftcoverSoftcover(10/pkg)
(10/pkg)Hardcover; includes 50 Answer Sheets, 50 Validity and Clinical Scale and Profile Forms and 50 new RC Scales Profile FormsSoftcover; includes 50 Answer Sheets, 50 Validity and Clinical Scale and Profile Forms and 50 new RC Scales Profile FormsHardcoverSoftcover(50/pkg)HardcoverSoftcoverHardcoverSoftcoverHardcover(50/pkg)SoftcoverHardcover
optional, can be used instead of softcover test booklet
(25/pkg)
Examiner's Manual; Picture Book for Design Sequences, Quantitative Relations, Design Reporduction, Symbiotic Relations; Picture Book for Story Sequences, Form Assembly; 25 Examiner Record Booklets, 25 Profile/Summary Forms; 25 Response Forms and Story Sequence Chips, Design Sequence Cubes, and Form Assembly Pieces
(100/pkg)NEO PI-R Manual, 10 NEO PI-R Reusable Form S Item Booklets, 10 NEO PI-R Form R Item Booklets (5 men and 5 women each), 25 NEO PI-R Handscorable Answer Sheets, 25 each of NEO PI-R Form S (self-report) and Form R (observer) Adult Profile Forms, and 25 NEO Feedback Sheets
(10/pkg)optional, can be used instead of softcover test bookletSoftcoverSoftcoverHardcoverSoftcoverHardcoverSoftcoverHardcoverSoftcoverSoftcoverHardcover
SoftcoverHardcoverincludes Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and SCL-90-R Bibliographyincludes Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and SCL-90-R Bibliographyincludes Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and SCL-90-R Bibliography
optionaloptionalincludes 50 Profile Forms and 2 Worksheetsincludes 50 Profile Forms and 2 Worksheets(25/pkg)Individual Subscription (4 issues)Institutional Subscription (4 issues)
includes Administrator's Manual, 10 Question Booklets, 25 Answer Sheets, 25 Individual Record Forms, and Scoring Keys
Hardcover, 1999, 149 pages
Technical Manual and 10 Complete Assessment SetsTechnical Manual and 1 Complete Assessment Set
(10/pkg)(Color Paper; Mail-In/Fax-In)(Mail-In/Fax-In)
black and white paper
(black & white; Mail-In/Fax-In)1 Technical Manual, 1 Item Booklet, and 1 Resource Report Response Sheet(10/pkg)(Mail-In/Fax-In)(Mail-In/Fax-In)(black & white; Mail-In/Fax-In)(Color Paper; Mail-In/Fax-In)Technical Manual, User's Manual, Administrator's Guide, and Facilitator's Guide(25/pkg)(100/pkg)(25/pkg)(100/pkg)BarOn EQ-i:YV Manual and 25 EQ-i:YV QuikScore Forms
(25/pkg)(100/pkg)BarOn EQ-i:YV Manual, and 25 EQ-i and 25 EQ-i(S) QuikScore Forms(25/pkg)(100/pkg)
(25/pkg)(25/pkg)(25/pkg)(15/pkg)
FAM-III Manual, 25 General Scale, 25 Dyadic Relationship Scale and 15 Self-Rating QuikScore Forms, and 5 FAM-III ColorPlot Profiles of Family PerceptionsFAM-III Manual, 5 General Scale, 10 Dyadic Relationship Scale and 5 Self-Rating QuikScore Forms, 1 FAM-III ColorPlot Profiles of Family Perceptions, and 1 Progress ColorPlot(50/pkg)(50/pkg)(50/pkg)FAB-C Manual and 25 QuikScore FormsFAB-C Manual and 3 QuikScore Forms
(25/pkg)FAM-III Manual, 25 Brief FAM General Scale, 25 Brief FAM Dyadic Relationship, and 25 Self-Rating QuikScore Forms, and 15 FAM Progress ColorPlots(25/pkg)(25/pkg)(25/pkg)FAM-III Manual, 5 Brief FAM General Scale, 10 Brief FAM Dyadic Relationship, and 5 Self-Rating QuikScore Forms, and 1 FAM Progress ColorPlots(50/pkg)(50/pkg)(50/pkg)(25/pkg)(25/pkg)
(25/pkg)(25/pkg)(25/pkg)(25/pkg)
Manual and 25 Summary/Response Booklets
(25/pkg)Manual, Student Book, and 25 Form A and Form B Profile/Examiner Record Forms
(25/pkg)(25/pkg)
Softcover, 344 pages(50/pkg)Book and 50 Record FormsHDI Technical Manual, 10 HDI-P and HDI-S Item Booklets, 25 HDI-P and HDI-S Background Information Questionnaires, and 25 HDI-P and HDI-S Response Forms
(10/pkg; reusable)
(10/pkg; reusable)(25/pkg)(25/pkg)(25/pkg)(100/pkg)(100/pkg)HDI Technical Manual, 1 HDI-P and HDI-S Item Booklet, 3 HDI-P and HDI-S Background Information Questionnaires, and 3 HDI-P and HDI-S Response Forms
HDI Technical Manual, 10 HDI-P Item Booklets, 25 HDI-P Background Information Questionnaires, and 25 HDI-P Response FormsHDI Technical Manual, 10 HDI-S Item Booklets, 25 HDI-S Background Information Questionnaires, and 25 HDI-S Response Forms
(Audiotape & Notebook)Hardcover, 2000, 496 pages
HPSI Manual and 25 QuikScore Forms
(25/pkg)
(100/pkg)HPSI Manual and 3 QuikScore Formsminimum purchase of 50 reports3 uses and HPSI Getting Started Guide(50/pkg)
(10/pkg)(4.5 hrs) with handbook(30/pkg)Hardcover, 2002, 221 pagesSoftcover, 2001, 421 pages
softcover, 1992, 439 pagesSoftcover, 2000, 323 pages
for use with IER softwareIER disk, CRW disk, and CRW Software ManualIEQ-MP Technical Manual; 25 forms each of IEQ-S, IEQ-PRO, IEQ-O, and IEQ-TX; 25 IEQ-CIP FormsIEQ-MP Technical Manual; 3 forms each of IEQ-S, IEQ-PRO, IEQ-O, and IEQ-TX; 3 IEQ-CIP Forms
(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)SoftcoverHardcover
(25/pkg)"Understanding and Dealing with Shame" (25/pkg)ISS Technical Manual, 25 QuikScore Forms, and 25 Brochure HandoutsISS Technical Manual, 3 QuikScore Forms, and 3 Brochure Handouts
(Expert Consensus GuideLine Series, Treatment of ADHD)JBC Manual, 1 Observer and 1 Self-Appraisal Item Booklet, 1 Observer and 1 Self-Appraisal QuikScore Form(50/pkg)JBC Manual, 10 Observer and 10 Self-Appraisal Item Booklet, 25 Observer and 25 Self-Appraisal QuikScore Form(10/pkg)(25/pkg)
(10/pkg)(25/pkg)(100/pkg)(100/pkg)JBC and JI Complete Kit, which includes JI Manual, 10 Item Booklets, and 25 QuikScore Forms(10/pkg)
(25/pkg)JI Manual, 10 Item Booklets, and 25 QuikScore Forms(100/pkg)(50/pkg)
JI Manual, 1 Item Booklet, and 3 QuikScore Forms
minimum purchase of 50 uses
LAMB Manual, Stimulus Cards Tent, 25 Recording Dorms, 25 Profile/Summary Sheets, LAMB Standard Score Conversion Booklet, and 100 Simple and Complex Figure Drawing Forms
(25/pkg)(25/pkg)
(100/pad)(set of 2)
Examiner's Manual and 50 Rating Summary Booklets
(50/pkg)(25/pkg)(100/pkg)LSI-R Manual, 25 Interview Guides, 25 QuikScore Forms, and 25 ColorPlot Profiles
(25/pkg)
(25/pkg)(100/pkg)(100/pkg)(25/pkg)
(25/pkg)(100/pkg)(100/pkg)(100/pkg)(25/pkg)(25/pkg)
(25/pkg)(100/pkg)(100/pkg)LSI-R Manual, 3 Interview Guides, 3 QuikScore Forms, and 3 ColorPlot Profiles
(3 videos & set of handbooks)
3 uses and LSI-R V.5 Getting Started Guide
(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)LSI-R:SV Manual, 3 Interview Guides, and 3 QuikScore Forms
3 Profile Reports and LSI-R:SV Getting Started Guide(50/pkg)
MASC Manual and 25 MASC QuikScore FormsMASC Manual and 3 QuikScore Forms for boththe MASC and MASC-10
(25/pkg)(100/pkg)MASC Manual and 3 QuikScore Forms for both the MASC and MASC-10(25/pkg)(100/pkg)
Hardcover, 2000, 392 pages
Softcover, 2002, 64 pages2 MMSE User's Guides and 100 MMSE Test FormsMMSE User's Guide and 50 MMSE Test Forms
MSCEIT User's Manual, 1 Item Booklet, 1 Response Sheet, and 1 Mail-in/Fax-in Personal Summary Report
(3/pkg)(Mail-In/Fax-In)(20/pkg)(20/pkg)MTOA Technical Manual, 1 MTOA:L and 1 MTOA:S Geometric Card, 25 MTOA:L Record Forms, and 25 MTOA:S Record Forms
(25/pkg)(100/pkg)(25/pkg)(100/pkg)
MTOA Technical Manual, 1 MTOA:L and 1 MTOA:S Geometric Card, 3 MTOA:L Record Forms, and 3 MTOA:S Record Forms
(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)(20/pkg)1 of each pamphlet25 NOC Booklets and 25 NOC Overall Summary Forms(25/pad)(25/pkg)3 NOC Booklets and 3 NOC Overall Summary FormsGuidebook and 1 pad of 50 sheets for each of the Long Term Goals Planning Sheet, Weekly Progress Report, and Goals for Kids, and 1 pad of 100 Coach Monitoring Sheets(30 pages)(5 pads/50 sheets each)(5 pads/100 sheets each)
(5 pads/50 sheets each)(5 pads/50 sheets each)
PANSS Technical Manual, 25 PANSS QuikScore Forms, and 25 SCI-PANSS FormsPANSS Technical Manual, 25 PANSS QuikScore Forms, 25 SCI-PANSS Forms, and 25 IQ-PANSS Forms
(25/pkg)
(100/pkg)(25/pkg)
(100/Pkg)
Audiotape and Handbook2 Audiotapes and HandbookAudiotape and Handbook
(25/pkg)(100/pkg)
3 cassettes (270 minutes) and Handbook(25/pkg)Manual, 1 Rating Booklet, 25 QuikScore Forms, and 25 Interview Guides(50/pkg)
(reusable)(25/pkg)(25/pkg)(100/pkg)(100/pkg)
Manual, 1 Rating Booklet, 25 QuikScore Forms, and 25 Interview GuidesHare PCL:SV Manual, 25 Interview Guides, and 25 QuikScore Forms
(25/pkg)(100/pkg)
Hare PCL:SV Manual, 3 Interview Guides, and 3 QuikScore Forms
(25/pkg)(100/pkg)Interpretation Guide and 25 Preparation Forma
(25/pkg)(100/pkg)
PDS Manual and 25 QuikScore Forms
(25/pkg)(100/pkg)(25/pkg)
3 Audiotapes and HandbookSoftcoverPPSI disk, CRW disk, and CRW Software Manual
(25/pkg)
Manual, 10 Reusable Item Booklets, 25 Hand-Scorable Answer Sheet/Profile Forms
(25/pkg)
25 administrations only(10/pkg)50 administrations onlyincludes Manual and 25 Questionnaire/Profile SheetsHare P-SCAN RV Manual, 25 QuikScore Forms, and Without Conscience (book by Dr. Hare)Hare P-SCAN RV Manual and 25 QuikScore Forms
(100/pkg)(25/pkg)Hare P-SCAN RV Manual and 3 QuikScore Forms
the New Personality Self-Portrait book, 5 PSP reusable Item Booklets, and 20 PSP QuikScore Forms/Interpretation Guides
Softcover
includes 50 Answer Sheets, 50 Worksheets, and 50 Profile Sheetsincludes MACI Manual, Hand-Scoring User's Guide, 10 Test Booklets, 50 Answer Sheets, 50 Worksheets, 50 Profile Sheets, and Answer Keys
(10/pkg)
includes 50 Answer Sheets, 50 Worksheets, and 50 Profile Formsincludes MHI Manual, 10 English Test Booklets, 50 Answer Sheets, 50 Worksheets, and 50 Profile Forms
For use with Softcover Test Booklets
50/pkg
For Use with Hardcover Test Booklets
50/pkgFor use with Hardcover Test Booklets5weptuiw[9ap5trp]q93-r
(10/pkg)
(10/pkg)(10/pkg)
(25/pkg)
For use with Hardcover Test BookletsFor use with Softcover Test Booklets
Manual Extension, Scoring Template, 25 Answer Sheets, and 25 Profile Forms(10/pkg)unlimited useEQ-i Technical Manual and 1 Black & White Resource Reportfor use with hardcover test bookletsfor use with softcover test booklets(25/pkg)(25/pkg)(25/pkg)(25/pkg)(25/pkg)(25/pkg)For use with Hardcover Test Bookletssoftcover Microtest Q
(100/pkg)
(optional)(optional)(optional)(optional)
(1 lapbook/pkg)HardcoverSoftcoverHardcoverHardcoverSoftcoverPANSS Technical Manual, 3 PANSS QuikScore Forms, and 3 SCI-PANSS Forms(25/pkg)(25/pkg)(100/pkg)includes PANSS Technical Manual (English), 25 PANSS QuikScore Forms, and 25 SCI-PANSS Formsminimum purchase of 50 usesCDS Getting Started Guide, 3 CDS uses, and 3 Brief CDS uses(50/pkg)(50/pkg)CDS Technical Manual and 25 CDS-R QuikScore Forms
(10/pkg)(10/pkg; 5 each of men and women)(25/pkg)(100/pkg)(100/pkg)(25/pkg)(100/pkg)(50/pkg)
includes PDS manual, 10 Answer Sheets, 10 Scoring Worksheets, and 1 Scoring Sheet
includes 50 Answer Sheets, 50 Scoring Worksheets, and 1 Scoring Sheet
minimum purchase of 50 uses
(25/pkg)(10/pkg)Mail-In/Fax-InMail-In/Fax-InMail-In/Fax-InEQ-i Technical Manual and 1 Development Report
(10/pkg)(10/pkg)includes 50 Profile Forms and 2 Worksheetsincludes 50 Profile Forms and 2 Worksheetsincludes 50 Profile Forms and 2 Worksheets(50/pkg)(25/pkg)(25/pkg)for the Spanish Edition(10/pkg; also includes the Manual Supplement for the Spanish Edition)(25/pkg)(50/pkg)
includes Technical Manual, User's Manual, Job Dictionary, 25 CWPI QuikScore Forms, 25 Worksheets, and 25 Client/Student Feedback Formsincludes Technical Manual, User's Manual, Job Dictionary, 25 French CWPI QuikScore Forms, 25 Worksheets, and 25 Client/Student Feedback Forms
(50/pkg)(50/pkg)(50/pkg)includes 1 Test Booklet, 1 Answer Sheet, 1 Profile, and Scoring KeysFor 3 to 10 raters; includes EQ-360 Technical Manual. 10 EQ-360 Item Booklets, 10 EQ-360 Rater Response Sheets, 1 EQ-i Item Booklet, 1 EQ-i Response Sheet, and 1 EQ-i Multirater Feedback Report
(50/pkg)(50/pkg)
(50/pkg)(50/pkg)(50/pkg)Hardcover(50/pkg)includes 50 Profile Forms and 2 Worksheetsincludes 50 Profile Forms and 2 Worksheets(100/pkg)
(50/pkg)
(10/pkg)(25/pkg)(25/pkg)set of 5
includes Manual, 25 QuikScore Forms, and Scoring Templates
(10/pkg)(5/pkg)
includes 1 Test Booklet, 1 Answer Sheet, 1 Profile, and Scoring Keysincludes 1 Test Booklet, 1 Answer Sheet, 1 Profile, Scoring Keys, and an audiocassetteincludes 1 Test Booklet, 1 Answer Sheet, 1 Profile, and Scoring Keys(50/pkg)
(10/pkg)
(1/pkg)(25/pkg)(1/pkg)
NEO PI-R Professional Manual, 25 NEO-FFI Form S Booklets, and 25 NEO-FFI Feedback Sheets
(10/pkg)
(25/pkg)(pad of 100)(pad of 100)
(50/pkg)includes BSI Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and BSI Bibliographyincludes BSI Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and BSI Bibliographyincludes BSI Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and BSI BibliographyPCL-R: 2nd Ed. Manual, 1 Rating Booklet, 25 QuikScore Forms, and 25 Interview Guides
includes PSI Manual, 5 Maternal and 5 Paternal Item Booklets, 25 Hand-Scorable Answer Sheet/Profile Forms
minimum purchase of 25 uses3 uses and SA-45 Getting Started Guide(10/pkg)
(10/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(100/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)minimum purchase of 50 usesSoftware Manual and 3 uses(10/pkg)Hardcover10/pkg1 lapbook/pkg
CDI Manual and 25 CDI Forms(25/pkg)CDI Manual, 25 CDI and 25 CDI-S QuikScore FormsCDI Manual and 25 CDI-S QuikScore Forms(100/pkg)(100/pkg)
CPT II Software Manual and K-CPT Software Manual, 3 CPT II Uses and 3 K-CPT UsesOnsite uses
(50/pkg)(50/pkg)
includes Examiner's Manual and 50 Summary/Response Booklets
BarOn EQ-i:YV Manual and 1 BarOn EQ-i Report- WebPPC Technical Manual and 25 QuikScore FormsBarOn EQ-i:YV English Manual, 25 Spanish EQ-i:YV QuikScore Forms, and 25 Spanish EQ-i:YV(S) QuikScore Forms(50/pkg)(50/pkg)includes MCMI-II Manual, Hand-Scoring User's Guide, 10 Test Booklets, 50 Answer Sheets, 50 Worksheets, 50 profile Forms, and Scoring KeysCLES Technical Manual and 25 QuikScore Forms for each of the CLES-P, CLES-C, and CLES-A(10/pkg)unlimited useunlimited useFor Use with Softcover Test BookletsFor Use with Softcover Test BookletsFor Use with Softcover Test Booklets(optional)(optional)
includes 50 carbonless English Answer Sheets
For use with Softcover Test Booklets
(100/pkg)(25/pkg)(25/pkg)
(25/pkg)(25/pkg)(100/pkg)(10/pkg)(25/pkg)Onsite usesminimum purchase of 25 usesBarOn EQ-i:YV English Manual and 25 Spanish EQ-i:YV QuikScore Forms(25/pkg)
minimum purchase of 25 usesFAB-C Manual and 1 FAB-C Report - WebFor Use with Softcover Test BookletsFor Use with Hardcover Test BookletsFor Use with Softcover Test BookletsFor Use with Hardcover Test BookletsCTMT Examiner's Manual and 10 CTMT Record Booklets
(21 Pictures)(25/pkg)
(10/pkg)
minimum purchase of 20 usesincludes 50 Profile Forms and 2 Worksheets
(50/pkg)(50/pkg)(50/pkg)
(25/pkg)includes a manual, 1 test item booklet, 3 carbonless answer sheets
CISS Manual and 25 Adult QuikScore Forms(100/pkg)DTS Manual (English) and 25 French QuikScore FormsDTS Manual (English) and 3 French QuikScore Forms
includes Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and SCL-90-R Bibliography
(25/pkg)(100/pkg)for 3-10 raters; includes 10 EQ-360 Rater Response Sheets, 1 EQ-i Item Booklet, 1 EQ-i Response Sheet, and 1 EQ-360 Multirater Feedback Report(3/pkg)(10/pkg)EQ-360 Technical Manual and 1 EQ-360 Multirater Feedback Report
minimum purchase of 50 usesR-SOPAC Technical Manual and 3 QuikScore Forms(reusable)
(10/pkg)(25/pkg)(100/pkg)
(25/pkg)(100/pkg)(25/pkg)(100/pkg)(25/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)CRS-R Technical Manual (English), and 25 QuikScore Forms for each of French CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, and CASS:S(100/pkg)(25/pkg)(100/pkg)(100/pkg)(100/pkg)(25/pkg)(25/pkg)SoftcoverLSI-R:SV Manual, 25 Interview Guides, and 25 QuikScore Forms(25/pkg)(10/pkg)(100/pkg)
(25/pkg)SASSI-3 Manual, SASSI-3 User's Guide, 25 Questionnaire/Profile Sheets, and Scoring Key(100/pkg)(25 uses)(50 uses)(100 uses)
SASSI-A2 Manual, SASSI-A2 User's Guide, 25 Questionnaire/Profile Sheets, and Scoring Key(25/pkg)(100/pkg)(25 uses)(50 uses)(100 uses)
(50/pkg)(50/pkg)
(10/pkg)(10/pkg)(10/pkg)(100/pkg)(25/pkg)(100/pkg)NEO PDR Software User's Manual, NEO PDR 3.5" Program Diskette, NEO PDR Key Disk with 10 uses, 10 NEO PI-R Reusable Form S Item Booklets, 25 NEO PI-R Handscorable Answer Sheets, and 1 NEO PDR Pocket Folder
(25 uses)
(10/pkg)
CRS-R Technical Manual (English), 1 QuikScore Form for each of French CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CGI-P, CGI-T, CGI-T, CADS-P, CADS-T, CADS-A, 1 CRS-R Treatment Progress ColorPlot Form (English), and 1 Feedback Handout(100/pkg)(25/pkg)(25/pkg)JI-R Technical Manual, 10 Item Booklets, 25 Response Forms, and Scoring TemplatesJI-R Technical Manual, 1 Item Booklet, 3 Response Forms, and Scoring Templates
(reusable; 10/pkg)(25/pkg)(100/pkg)
minimum purchase of 50 usesminimum purchase of 25 usesJI-R Technical Manual and 3 Profile Reportsminimum purchase of 50 usesincludes 50 Answer Sheets, 50 Worksheets, and 50 Profile Formsincludes MBMD Manual, Hand-Scoring User's Guide, 10 Test Booklets, 50 Answer Sheets, 50 Worksheets, 50 Profile Forms, and Answer Keys
(10/pkg)
(25/pkg)
includes a QOLI Manual, 50 Hand-Scoring Answer SHeets, and 50 Worksheetsincludes 50 Hand-Scoring Answer Sheets and 50 Worksheets(50/pkg)(optional; 100/pkg)
(50/pkg; self-contained booklet includes instructions for self-scoring)Softcover, 1996, 144 pagesminimum purchase of 25 uses(one of each pamphlet)3 Interpretive Report uses and a JI-R Getting Started Guide(10/pkg)(50/pkg)minimum purchase of 25 uses(10/pkg)(10/pkg)(25/pkg)four 19" x13" Color Cards, Manual, 5 Self-Assessment Forms, and 5 each of Quikscore Forms
(25/pkg)(25/pkg)(25/pkg)(25/pkg)(25 of each)(25/pkg)(50/pkg)
(10/pkg)minimum purchase of 25 uses
(25/pkg)(100/pkg)(25/pkg)(100/pkg)PCL-R: 2nd Ed. Manual, Rating Booklet, 2 QuikScore Forms, and 2 Interview GuidesSHQ-R Technical Manual, SHQ-R V.5 Getting Started Guide, and 2 Comprehensive Reports(100/pkg)(unlimited use)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(50/pkg)(25/pkg)(100/pkg)(10/pkg)minimum purchase of 50 uses(10/pkg)(10/pkg)Hardcover, 1990, 200 pages(100/pkg)includes video series and 1 Workbook
(25/pkg)(100/pkg)
minimum purchase of 25 uses
PCL-R Manual (English), French Manual Supplement, 1 Rating Booklet, 25 QuikScore Forms, and 25 Interview GuidesPCL-R Manual (English), French Manual Supplement, 1 Rating Booklet, 2 QuikScore Forms, and 2 Interview Guides(25/pkg)(25/pkg)MSCEIT User's Manual and 1 Personal Summary Report scoring(100/pkg)PDS Manual (English) and 25 French PDS QuikScore Forms(25/pkg)(25/pkg)includes Video Series, Facilitator's Guide, 15 Workbooks, and 15 Laminated Cards
(25/pkg)
TD Monitor Manual, 25 modified AIMS QuikScore Forms, 25 Modified Webster QuikScore Forms, and 25 TD Monitor History Forms
TD Monitor Manual, 1 modified AIMS QuikScore Form, 1 Modified Webster QuikScore Form, and 1 TD Monitor History Form
Examiner's Manual, Picture Book, 25 Record Forms and Administration Booklets, 25 Supplementary Analysis Forms, Facial Memory Picture Book, 15 Facial Memory Chips. Visual Selective Reminding Test Board, and a set of Delayed Recall Cue Cards
unlimited-use Software, Online Manual, 1 set of Keytops, and 25 WCST Computer Version Record Forms
unlimited-use Software, Online Manual, 1 set of Keytops, 25 WCST Computer Version Record Forms, and the Revised and Expanded WCST Professional Manual
Manual, 25 Blue Test Forms, 25 Tan Test Forms, 25 Profile/Analysis Forms, Plastic Cards for Reading/Spelling, and Soft Attache Case
Manual, 25 Drawing Forms, 25 Examiner Forms (Visual-Motor), 25 Matching Forms (Visual-Spatial), Pegboards and Pegs (Fine-Motor), and a WRAVMA Soft Attache Case
Levels 1, 2, 3, 4, & 5 Administration Manuals, Technical Manual, and 10 Booklets and 10 Forms for Levels 1, 2, 3, 4, & 5
YLS/CMI User's Manual, 25 Interview Guides, 25 QuikScore Forms, and 25 Case-Management Forms
BRIEF Manual, 25 Parent Form Questionnaires, 25 Teacher Form Questionnaires, 50 Parent Form Scoring/Summary Profile Forms, and 50 Teacher Form Scoring/Summary Profile Forms
1 set of 6 Group Leader's Guides, 10 Group Member's Workbooks, 1 Master Package, and 1 Audiotape
CAARS Technical Manual and 25 QuikScore Forms for each of the CAARS-S:L, CAARS-S:S, CAARS-S:SV, CAARS-O:L, CAARS-O:S, and CAARS-O:SV
CAARS Technical Manual and 1 QuikScore Form for each of the CAARS-S:L, CAARS-S:S, CAARS-S:SV, CAARS-O:L, CAARS-O:S, and CAARS-O:SVCASE Manual, 25 CASE Form S and 25 CASE Form R Item Booklets, 25 CASE Form S and 25 CASE Form R Handscorable Answer Sheets, and 50 CASE Profile Forms
(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, and CTRS-R:S)(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, and CTRS-R:S)(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:L, CTRS:L, and CASS:L)(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:S, CTRS-R:S, and CASS:S)(CRS-R Technical Manual and 1 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CADS-P, CADS-T, CADS-A, CGI-T, CGI-P, 1 CRS-R Treatment Progress Colorplot™ Form, 1 Feedback Handout, and 1 CTIF)
CRS-R Technical Manual, 25 CGI-T and CGI-T QuikScore Forms, and 15 CRS-R Treatment Progress ColorPlot Forms(CRS-R Technical Manual and 25 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L and CASS:S)50 CGI-T QuikScore Forms, 50 CGI-P QuikScore Forms, and 15 CRS-R Treatment Progress ColorPlot Forms
CRS-R Technical Manual (English) and 25 QuikScore forms for each of Spanish CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, and CASS:SCRS-R Technical Manual (English) and 1 QuikScore forms for each of Spanish CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CADS-P, CADS-T, CADS-A, CGI-T, CGI-P, 1 CRS-R Treatment Progress Colorplot form (English), 1 Feedback Hangdout, and 1 CTIF
CRS-R Technical Manual, 25 QuikScore Forms, and 25 Feedback Handouts for each of CADS-P, CADS-T, and CADS-A
Examiner's Manual, Analogies Book, Categories Picture Book, Sequences Picture Book, and 25 Profile/Examiner Record Forms
Examiner's Manual; Picture Book 1 for Design Sequences, Design Reproduction, and Symbolic Relations; Picture Book 2 for Story Sequences and Story Construction; 25 Profile/Summary Forms; 25 Examiner Record Booklets; 25 Response Forms; Story Sequence Chips; Design Sequence Cubes
includes BSI Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and BSI Bibliography
includes 7 Patient Videotapes, 1 Practitioner's Supplementary Video, 5 Patient Workbooks, and 1 Practitioner's Guide
Hardcover; includes 50 Answer Sheets, 50 Validity and Clinical Scale and Profile Forms and 50 new RC Scales Profile FormsSoftcover; includes 50 Answer Sheets, 50 Validity and Clinical Scale and Profile Forms and 50 new RC Scales Profile Forms
Examiner's Manual; Picture Book for Design Sequences, Quantitative Relations, Design Reporduction, Symbiotic Relations; Picture Book for Story Sequences, Form Assembly; 25 Examiner Record Booklets, 25 Profile/Summary Forms; 25 Response Forms and Story Sequence Chips, Design Sequence Cubes, and Form Assembly Pieces
NEO PI-R Manual, 10 NEO PI-R Reusable Form S Item Booklets, 10 NEO PI-R Form R Item Booklets (5 men and 5 women each), 25 NEO PI-R Handscorable Answer Sheets, 25 each of NEO PI-R Form S (self-report) and Form R (observer) Adult Profile Forms, and 25 NEO Feedback Sheets
includes Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and SCL-90-R Bibliographyincludes Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and SCL-90-R Bibliographyincludes Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and SCL-90-R Bibliography
includes Administrator's Manual, 10 Question Booklets, 25 Answer Sheets, 25 Individual Record Forms, and Scoring Keys
FAM-III Manual, 25 General Scale, 25 Dyadic Relationship Scale and 15 Self-Rating QuikScore Forms, and 5 FAM-III ColorPlot Profiles of Family PerceptionsFAM-III Manual, 5 General Scale, 10 Dyadic Relationship Scale and 5 Self-Rating QuikScore Forms, 1 FAM-III ColorPlot Profiles of Family Perceptions, and 1 Progress ColorPlot
FAM-III Manual, 25 Brief FAM General Scale, 25 Brief FAM Dyadic Relationship, and 25 Self-Rating QuikScore Forms, and 15 FAM Progress ColorPlots
FAM-III Manual, 5 Brief FAM General Scale, 10 Brief FAM Dyadic Relationship, and 5 Self-Rating QuikScore Forms, and 1 FAM Progress ColorPlots
HDI Technical Manual, 10 HDI-P and HDI-S Item Booklets, 25 HDI-P and HDI-S Background Information Questionnaires, and 25 HDI-P and HDI-S Response Forms
HDI Technical Manual, 1 HDI-P and HDI-S Item Booklet, 3 HDI-P and HDI-S Background Information Questionnaires, and 3 HDI-P and HDI-S Response Forms
HDI Technical Manual, 10 HDI-P Item Booklets, 25 HDI-P Background Information Questionnaires, and 25 HDI-P Response FormsHDI Technical Manual, 10 HDI-S Item Booklets, 25 HDI-S Background Information Questionnaires, and 25 HDI-S Response Forms
IEQ-MP Technical Manual; 25 forms each of IEQ-S, IEQ-PRO, IEQ-O, and IEQ-TX; 25 IEQ-CIP Forms
JBC Manual, 1 Observer and 1 Self-Appraisal Item Booklet, 1 Observer and 1 Self-Appraisal QuikScore Form
JBC Manual, 10 Observer and 10 Self-Appraisal Item Booklet, 25 Observer and 25 Self-Appraisal QuikScore Form
LAMB Manual, Stimulus Cards Tent, 25 Recording Dorms, 25 Profile/Summary Sheets, LAMB Standard Score Conversion Booklet, and 100 Simple and Complex Figure Drawing Forms
MSCEIT User's Manual, 1 Item Booklet, 1 Response Sheet, and 1 Mail-in/Fax-in Personal Summary Report
MTOA Technical Manual, 1 MTOA:L and 1 MTOA:S Geometric Card, 25 MTOA:L Record Forms, and 25 MTOA:S Record Forms
MTOA Technical Manual, 1 MTOA:L and 1 MTOA:S Geometric Card, 3 MTOA:L Record Forms, and 3 MTOA:S Record Forms
Guidebook and 1 pad of 50 sheets for each of the Long Term Goals Planning Sheet, Weekly Progress Report, and Goals for Kids, and 1 pad of 100 Coach Monitoring Sheets
PANSS Technical Manual, 25 PANSS QuikScore Forms, 25 SCI-PANSS Forms, and 25 IQ-PANSS Forms
the New Personality Self-Portrait book, 5 PSP reusable Item Booklets, and 20 PSP QuikScore Forms/Interpretation Guides
includes MACI Manual, Hand-Scoring User's Guide, 10 Test Booklets, 50 Answer Sheets, 50 Worksheets, 50 Profile Sheets, and Answer Keys
includes MHI Manual, 10 English Test Booklets, 50 Answer Sheets, 50 Worksheets, and 50 Profile Forms
includes PANSS Technical Manual (English), 25 PANSS QuikScore Forms, and 25 SCI-PANSS Forms
includes Technical Manual, User's Manual, Job Dictionary, 25 CWPI QuikScore Forms, 25 Worksheets, and 25 Client/Student Feedback Formsincludes Technical Manual, User's Manual, Job Dictionary, 25 French CWPI QuikScore Forms, 25 Worksheets, and 25 Client/Student Feedback Forms
For 3 to 10 raters; includes EQ-360 Technical Manual. 10 EQ-360 Item Booklets, 10 EQ-360 Rater Response Sheets, 1 EQ-i Item Booklet, 1 EQ-i Response Sheet, and 1 EQ-i Multirater Feedback Report
includes BSI Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and BSI Bibliographyincludes BSI Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and BSI Bibliographyincludes BSI Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and BSI Bibliography
includes PSI Manual, 5 Maternal and 5 Paternal Item Booklets, 25 Hand-Scorable Answer Sheet/Profile Forms
BarOn EQ-i:YV English Manual, 25 Spanish EQ-i:YV QuikScore Forms, and 25 Spanish EQ-i:YV(S) QuikScore Forms
includes MCMI-II Manual, Hand-Scoring User's Guide, 10 Test Booklets, 50 Answer Sheets, 50 Worksheets, 50 profile Forms, and Scoring Keys
includes Manual, 50 Answer Sheets, 50 Profile Forms, 2 Worksheets, Answer Keys, and SCL-90-R Bibliography
for 3-10 raters; includes 10 EQ-360 Rater Response Sheets, 1 EQ-i Item Booklet, 1 EQ-i Response Sheet, and 1 EQ-360 Multirater Feedback Report
CRS-R Technical Manual (English), and 25 QuikScore Forms for each of French CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, and CASS:S
NEO PDR Software User's Manual, NEO PDR 3.5" Program Diskette, NEO PDR Key Disk with 10 uses, 10 NEO PI-R Reusable Form S Item Booklets, 25 NEO PI-R Handscorable Answer Sheets, and 1 NEO PDR Pocket Folder
CRS-R Technical Manual (English), 1 QuikScore Form for each of French CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CGI-P, CGI-T, CGI-T, CADS-P, CADS-T, CADS-A, 1 CRS-R Treatment Progress ColorPlot Form (English), and 1 Feedback Handout
includes MBMD Manual, Hand-Scoring User's Guide, 10 Test Booklets, 50 Answer Sheets, 50 Worksheets, 50 Profile Forms, and Answer Keys
PCL-R Manual (English), French Manual Supplement, 1 Rating Booklet, 25 QuikScore Forms, and 25 Interview GuidesPCL-R Manual (English), French Manual Supplement, 1 Rating Booklet, 2 QuikScore Forms, and 2 Interview Guides
Examiner's Manual, Picture Book, 25 Record Forms and Administration Booklets, 25 Supplementary Analysis Forms, Facial Memory Picture Book, 15 Facial Memory Chips. Visual Selective Reminding Test Board, and a set of Delayed Recall Cue Cards
(CRS-R Technical Manual and 1 QuikScore™ Forms for each of CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CADS-P, CADS-T, CADS-A, CGI-T, CGI-P, 1 CRS-R Treatment Progress Colorplot™ Form, 1 Feedback Handout, and 1 CTIF)
CRS-R Technical Manual (English) and 1 QuikScore forms for each of Spanish CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CADS-P, CADS-T, CADS-A, CGI-T, CGI-P, 1 CRS-R Treatment Progress Colorplot form (English), 1 Feedback Hangdout, and 1 CTIF
Examiner's Manual; Picture Book 1 for Design Sequences, Design Reproduction, and Symbolic Relations; Picture Book 2 for Story Sequences and Story Construction; 25 Profile/Summary Forms; 25 Examiner Record Booklets; 25 Response Forms; Story Sequence Chips; Design Sequence Cubes
Examiner's Manual; Picture Book for Design Sequences, Quantitative Relations, Design Reporduction, Symbiotic Relations; Picture Book for Story Sequences, Form Assembly; 25 Examiner Record Booklets, 25 Profile/Summary Forms; 25 Response Forms and Story Sequence Chips, Design Sequence Cubes, and Form Assembly Pieces
NEO PI-R Manual, 10 NEO PI-R Reusable Form S Item Booklets, 10 NEO PI-R Form R Item Booklets (5 men and 5 women each), 25 NEO PI-R Handscorable Answer Sheets, 25 each of NEO PI-R Form S (self-report) and Form R (observer) Adult Profile Forms, and 25 NEO Feedback Sheets
For 3 to 10 raters; includes EQ-360 Technical Manual. 10 EQ-360 Item Booklets, 10 EQ-360 Rater Response Sheets, 1 EQ-i Item Booklet, 1 EQ-i Response Sheet, and 1 EQ-i Multirater Feedback Report
NEO PDR Software User's Manual, NEO PDR 3.5" Program Diskette, NEO PDR Key Disk with 10 uses, 10 NEO PI-R Reusable Form S Item Booklets, 25 NEO PI-R Handscorable Answer Sheets, and 1 NEO PDR Pocket Folder
CRS-R Technical Manual (English), 1 QuikScore Form for each of French CPRS-R:L, CPRS-R:S, CTRS-R:L, CTRS-R:S, CASS:L, CASS:S, CGI-P, CGI-T, CGI-T, CADS-P, CADS-T, CADS-A, 1 CRS-R Treatment Progress ColorPlot Form (English), and 1 Feedback Handout
Examiner's Manual; Picture Book for Design Sequences, Quantitative Relations, Design Reporduction, Symbiotic Relations; Picture Book for Story Sequences, Form Assembly; 25 Examiner Record Booklets, 25 Profile/Summary Forms; 25 Response Forms and Story Sequence Chips, Design Sequence Cubes, and Form Assembly Pieces
InvtID User1 User3 User2 User5 User4 User7 User60 CPW 0 12/31/1899 0:00 N
00278 A 0 SW 16Bit MTQ 0 12/31/1899 0:00 100284N A 0 Dongle MTQ 0 2/25/2002 0:00 Y00293 A 0 Reorder Kit 0 12/31/1899 0:00 100294 A 0 Reorder Kit 0 12/31/1899 0:00 100300D B 37 Test Booklet PFC 0 1/1/1988 0:00 N00350O B 0 Bibliography SCL 0 1/1/1988 0:00 Y003S0D B 0 Test Booklet PFC 0 1/1/1988 0:00 N00400D B 37 Test Booklet PFC 0 1/1/1988 0:00 N004S0D B 0 Test Booklet PFC 0 1/1/1988 0:00 N00500F B 21.5 Answer/Data Sheets PFC 0 1/1/1988 0:00 N00502E B 0 Mail-In CA4 1 1/1/1988 0:00 N00510J C 0 Mail-In MP4 0 1/1/1988 0:00 N00515K C 0 Mail-In MR4 0 1/1/1988 0:00 N00517K C 0 Mail-In MR4 0 1/1/1988 0:00 N00626J B 0 Mail-In AU4 1 1/1/1988 0:00 N00640E B 0 Mail-In CM2 1 1/1/1988 0:00 N00650F B 0 Mail-In CA4 1 1/1/1988 0:00 N00651A B 0 Kit BS2 0 1/1/1988 0:00 Y00652A B 0 Kit BS2 0 1/1/1988 0:00 Y00653A B 0 Kit BS2 0 1/1/1988 0:00 Y00660K C 0 Mail-In MC4 0 1/1/1988 0:00 N00676A B 0 Kit SCL 0 1/1/1988 0:00 Y00677A B 0 Kit BS2 0 1/1/1988 0:00 Y00679K C 0 SW 16Bit MC6 0 1/1/1988 0:00 N00681K C 0 SW 16Bit MR6 0 1/1/1988 0:00 N00683K C 0 SW 16Bit MH6 0 1/1/1988 0:00 N00684K C 0 SW 16Bit MP6 0 1/1/1988 0:00 N00692A B 0 Kit SCL 0 1/1/1988 0:00 Y00693A B 0 Kit SCL 0 1/1/1988 0:00 Y00694A B 0 Kit SCL 0 1/1/1988 0:00 Y00696A C 0 Kit MR2 0 1/1/1988 0:00 Y00697A C 0 Kit MR2 0 1/1/1988 0:00 Y00698A C 0 Kit MC2 0 1/1/1988 0:00 N00700E B 18 Answer/Data Sheets FRM 0 1/1/1988 0:00 N00701K C 0 SW 16Bit MR8 0 1/1/1998 0:00 N00702K C 0 Mail-In MR8 0 1/1/1998 0:00 N00719A C 0 Mail-In ML4 0 12/31/1899 0:00 N00720A C 0 Kit ML2 0 1/1/1988 0:00 Y00721A C 0 Kit ML2 0 1/1/1988 0:00 Y00726K C 0 SW 16Bit ML6 0 1/1/1988 0:00 N00737K B 0 SW 16Bit SCL 0 1/1/1988 0:00 N00740K B 0 SW 16Bit BS6 1 1/1/1988 0:00 N00742G B 0 Mail-In QSH 0 1/1/1988 0:00 N00743E B 0 SW 16Bit CM6 1 1/1/1988 0:00 N00746G B 0 SW 16Bit QSH 0 1/1/1988 0:00 N00748A C 0 Kit ISO 0 1/1/1988 0:00 Y00749A C 0 Kit ISO 0 1/1/1988 0:00 N0074AK B 0 Mail-In BS4 1 1/1/1988 0:00 N00751K C 0 SW 16Bit MR6 0 1/1/1988 0:00 N00754J B 0 SW 16Bit AU6 1 1/1/1988 0:00 N00756C B 0 Kit AU2 0 1/1/1988 0:00 Y00757G C 0 SW 16Bit IQQ 0 1/1/1988 0:00 N
00760F A 0 SW 16Bit CA6 1 1/1/1988 0:00 N00761F B 0 SW 16Bit CA6 1 1/1/1988 0:00 N00762K C 0 Mail-In MM4 0 1/1/1988 0:00 N00763K C 0 SW 16Bit MM6 0 1/1/1988 0:00 N007S0E B 0 Answer/Data Sheets FRM 0 1/1/1988 0:00 N00800H B 0 SW 16Bit PFC 0 1/1/1988 0:00 N00817K B 0 SW 16Bit BH6 1 1/1/1996 0:00 N00818K B 0 Mail-In BH4 1 1/1/1988 0:00 N00830D B 0 SW 16Bit PP3 0 1/1/1996 0:00 N00848 A 0 Upgrade MTQ 0 11/21/2002 0:00 100884A C 0 Kit GAM 0 1/1/1988 0:00 N00910A C 0 Kit GAM 0 1/23/2002 0:00 Y00957K C 0 Mail-In MM5 0 1/1/1998 0:00 N00972N C 0 Kit BS2 0 12/31/1899 0:00 Y00973N C 0 Kit BS2 0 12/31/1899 0:00 Y00995N C 0 Kit MBM 0 12/31/1899 0:00 Y00996N C 0 Kit MBM 0 12/31/1899 0:00 Y01100A B 0 Profiles PFC 0 12/31/1899 0:00 N01300L B 25 Answer/Data Sheets PFC 0 1/1/1988 0:00 N01500I B 26 Scoring Key/Material PFC 0 1/1/1988 0:00 N01800H B 17 Scoring Key/Material PFC 0 1/1/1988 0:00 N02100C B 0 Manual QOL 0 1/1/1988 0:00 Y02108A B 0 Kit QOL 0 1/1/1988 0:00 Y02109B B 0 Reorder Kit QOL 0 1/1/1988 0:00 Y02200E B 0 Mail-In PP3 0 1/1/1988 0:00 Y02201A B 0 Manual PP3 0 1/1/1996 0:00 Y02202B B 0 Answer/Data Sheets PP3 0 1/1/1996 0:00 Y02302D C 0 Manual ISO 0 1/1/1988 0:00 Y02303B C 0 Reorder Kit ISO 0 1/1/1988 0:00 Y02304B C 0 Manual ISO 0 1/1/1988 0:00 N02305 C 0 Test Booklet ISO 0 12/31/1899 0:00 102306 B 0 Test Booklet ISO 0 12/31/1899 0:00 102401F B 0 Mail-In QSH 0 1/1/1988 0:00 Y02404F B 0 Mail-In QSH 0 1/1/1988 0:00 Y02501C B 0 Manual PFC 0 1/1/1988 0:00 N02502I B 0 Mail-In PF4 0 1/1/1988 0:00 N02510C B 0 Manual PFC 0 1/1/1988 0:00 N02513Q B 0 SW 16Bit 16Q 1 1/1/1988 0:00 N02600A B 0 Manual TJT 0 1/1/1988 0:00 N026030 B 0 Test Booklet TJT 0 12/31/1899 0:00 N02606A B 0 Mail-In TJT 0 1/1/1988 0:00 N02607A B 0 Mail-In TJT 0 1/1/1988 0:00 N02608A B 0 Mail-In TJT 0 1/1/1988 0:00 N02609A B 0 Mail-In TJT 0 1/1/1988 0:00 N02720G A 0 Manual CCA 0 1/1/1988 0:00 N02721B A 0 Answer/Data Sheets CCA 0 1/1/1988 0:00 N02800J B 17.85 Workbook/Worksheet PFC 0 1/1/1988 0:00 N05265C B 0 Manual PFC 0 1/1/1988 0:00 N05300F B 21.5 Answer/Data Sheets PFC 0 1/1/1988 0:00 N05410B C 0 Test Booklet GZ2 0 1/1/1988 0:00 N05415A C 0 Manual GZ2 0 1/1/1988 0:00 N05610C B 0 Manual SCL 0 1/1/1988 0:00 Y05612L B 0 Audio SCL 0 1/1/1988 0:00 Y05614L B 0 Audio SCL 0 1/1/1988 0:00 Y
05616C B 0 Manual BS2 0 1/1/1988 0:00 Y05618B B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 Y05619D B 0 Profiles SCL 0 1/1/1988 0:00 Y05620D B 0 Profiles SCL 0 1/1/1988 0:00 Y05621D B 0 Profiles SCL 0 1/1/1988 0:00 Y05622D B 0 Profiles SCL 0 1/1/1988 0:00 Y05623D B 0 Profiles BS2 0 1/1/1988 0:00 N05624D B 0 Profiles BS2 0 1/1/1988 0:00 N05625D B 0 Profiles BS2 0 1/1/1988 0:00 N05626D B 0 Profiles BS2 0 1/1/1988 0:00 N05627B B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 Y05628A B 0 Answer/Data Sheets DPR 0 1/1/1988 0:00 N05629B B 0 Answer/Data Sheets DPR 0 1/1/1988 0:00 N05630L B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 Y05631B B 0 Reorder Kit BS2 0 1/1/1988 0:00 Y05635B B 0 Reorder Kit SCL 0 1/1/1988 0:00 N05636B B 0 Reorder Kit SCL 0 1/1/1988 0:00 N05637B B 0 Reorder Kit SCL 0 1/1/1988 0:00 N05638B B 0 Reorder Kit BS2 0 1/1/1988 0:00 Y05639B B 0 Reorder Kit BS2 0 1/1/1988 0:00 Y05640B B 0 Reorder Kit BS2 0 1/1/1988 0:00 Y05647L B 0 Audio BS3 0 1/1/1988 0:00 Y05648L B 0 Audio BS3 0 1/1/1988 0:00 Y05649E B 0 Scoring Key/Material BS2 0 1/1/1988 0:00 Y05650E B 0 Scoring Key/Material SCL 0 1/1/1988 0:00 Y05651B B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 Y05652I B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 N05653B B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 Y05654I B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 N05655I B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 N05656I B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 Y05657 B 0 Answer/Data Sheets BS2 0 12/31/1899 0:00 005658M B 0 Mail-In BS4 0 1/18/2001 0:00 Y056600 B 0 SW Refresher DPR 0 12/31/1899 0:00 N056650 B 0 SW Refresher DPR 0 12/31/1899 0:00 N05668B B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 105669B B 0 Answer/Data Sheets BS2 0 12/31/1899 0:00 105671B B 0 Answer/Data Sheets SCL 0 12/31/1899 0:00 106100L B 25 Answer/Data Sheets PFC 0 1/1/1988 0:00 N06300I B 25.75 Scoring Key/Material PFC 0 1/1/1988 0:00 N06500H B 17 Scoring Key/Material PFC 0 1/1/1988 0:00 N06700B B 50 Kit PFC 0 1/1/1996 0:00 N0737AK B 0 Mail-In SCL 0 1/1/1988 0:00 N07500D B 43 Test Booklet PFC 0 1/1/1988 0:00 N0757AG C 0 Mail-In ISO 0 1/1/1988 0:00 N07600F B 21.5 Answer/Data Sheets PFC 0 1/1/1988 0:00 N08000I B 25.75 Scoring Key/Material PFC 0 1/1/1988 0:00 N08100C B 21.5 Manual PFC 0 1/1/1988 0:00 N08200K B 21.5 Audio PFC 0 1/1/1988 0:00 N08400L B 25 Answer/Data Sheets PFC 0 1/1/1988 0:00 N08700B B 25.75 Manual CAB 0 1/1/1995 0:00 Y08800A B 50 Specimen Set CAB 1 1/1/1988 0:00 N088A0A B 33 Specimen Set CAB 1 1/1/1996 0:00 Y088B0A B 33 Specimen Set CAB 1 1/1/1996 0:00 Y
088C0A B 0 Specimen Set CAB 1 1/1/1996 0:00 Y088D0A B 45 Specimen Set CAB 1 1/1/1996 0:00 Y08900D B 17.85 Profiles CAB 0 1/1/1988 0:00 Y089S0D B 0 Profiles CAB 0 1/1/1996 0:00 N090A0E B 25.75 Scoring Key/Material CAB 0 1/1/1988 0:00 Y090B0E B 25.75 Scoring Key/Material CAB 0 1/1/1988 0:00 Y090C0E B 25.75 Scoring Key/Material CAB 0 1/1/1988 0:00 Y090D0E B 45 Scoring Key/Material CAB 0 1/1/1988 0:00 Y09100E B 32 Scoring Key/Material CAB 0 1/1/1988 0:00 Y09200F B 21.5 Answer/Data Sheets CAB 0 1/1/1988 0:00 Y092S0F B 0 Answer/Data Sheets CAB 0 1/1/1996 0:00 N09400F B 21.5 Answer/Data Sheets CAB 0 1/1/1988 0:00 Y094S0F B 0 Answer/Data Sheets CAB 0 1/1/1996 0:00 N09500F B 28.5 Audio CAB 0 1/1/1988 0:00 Y09700C B 31.5 Test Booklet CAB 0 1/1/1995 0:00 Y097S0C B 0 Test Booklet CAB 0 1/1/1996 0:00 N09800C B 31.5 Test Booklet CAB 0 1/1/1992 0:00 Y098S0C B 0 Test Booklet CAB 0 1/1/1996 0:00 N09900C B 31.5 Test Booklet CAB 0 1/1/1995 0:00 Y099S0C B 0 Test Booklet CAB 0 1/1/1996 0:00 N10000C B 31.5 Test Booklet CAB 0 1/1/1988 0:00 Y100S0C B 0 Test Booklet CAB 0 1/1/1996 0:00 N10100F B 28.5 Test Booklet HSP 0 1/1/1988 0:00 N101S0F B 0 Test Booklet HSP 0 1/1/1988 0:00 N10300D B 28.5 Test Booklet HSP 0 1/1/1995 0:00 N10500D B 40 Test Booklet HSP 0 1/1/1995 0:00 N10600G B 21.5 Answer/Data Sheets HSP 0 1/1/1988 0:00 N11000H B 17.85 Profiles HSP 0 1/1/1996 0:00 N11400H B 25 Profiles HSP 0 1/1/1992 0:00 N11600I B 21.5 Scoring Key/Material HSP 0 1/1/1988 0:00 N11800J B 17.85 Workbook/Worksheet HSP 0 1/1/1988 0:00 N12100E B 28.5 Manual HSP 0 1/1/1996 0:00 N12300C B 51.5 Kit HSP 0 1/1/1988 0:00 N12400D B 37 Mail-In HSP 0 1/1/1988 0:00 N12600G B 30 Answer/Data Sheets CPQ 0 1/1/1992 0:00 N12800J B 21.5 Scoring Key/Material CPQ 0 1/1/1992 0:00 N13100H B 21.5 Profiles CPQ 0 1/1/1992 0:00 N13200F B 28.5 Test Booklet CPQ 0 1/1/1992 0:00 N132S0F B 0 Test Booklet CPQ 0 1/1/1995 0:00 N134CPK B 35.75 Test Booklet CPQ 0 1/1/1998 0:00 N13600H B 21.5 Profiles CPQ 0 1/1/1995 0:00 N13700G B 18 Answer/Data Sheets CPQ 0 1/1/1995 0:00 N137S0G B 0 Answer/Data Sheets CPQ 0 1/1/1995 0:00 N14600E B 28.5 Manual CPQ 0 1/1/1992 0:00 N14700C B 53 Kit CPQ 0 1/1/1988 0:00 N14800D B 37 Mail-In CPQ 0 1/1/1988 0:00 N15600C B 25 Answer/Data Sheets ESP 0 1/1/1996 0:00 N15700D B 21.5 Workbook/Worksheet ESP 0 1/1/1996 0:00 N15900E B 7.5 Scoring Key/Material ESP 0 1/1/1996 0:00 N16000B B 21.5 Manual ESP 0 1/1/1996 0:00 N16300A B 45.75 Kit ESP 0 1/1/1988 0:00 N16600C B 18 Answer/Data Sheets IAS 0 1/1/1988 0:00 N16700D B 0 Scoring Key/Material IAS 0 1/1/1998 0:00 N16800B B 0 Manual IAS 0 1/1/1998 0:00 N
16900A B 28.5 Specimen Set IAS 0 1/1/1988 0:00 N17100C B 0 Answer/Data Sheets NSB 0 1/1/1988 0:00 N17300D B 0 Scoring Key/Material NSQ 0 1/1/1988 0:00 N17400B B 0 Manual NSQ 0 1/1/1988 0:00 N17500A B 0 Kit NSQ 0 1/1/1988 0:00 N18000E B 48.5 Test Booklet MAT 0 1/1/1988 0:00 N18200C B 21.5 Answer/Data Sheets MAT 0 1/1/1996 0:00 N18500I B 18 Profiles MAT 0 1/1/1988 0:00 N20400C B 0 Manual CFI 0 1/1/1996 0:00 N20600A B 0 kit CFI 0 12/31/1899 0:00 N21060 C 0 SW 16Bit MA4 0 1/1/1998 0:00 021100M B 0 Mail-In MIP 0 12/31/1899 0:00 121101M B 0 Mail-In MIP 0 12/31/1899 0:00 121400H B 18 Answer/Data Sheets CFI 0 1/1/1996 0:00 N22100A B 0 Manual CFI 0 12/31/1899 0:00 N22226 B 0 Online Use CM2 10.5 12/31/1899 0:00 N22226CISS B 0 Online Use CM2 10.5 12/31/1899 0:00 N22250B B 0 Answer/Data Sheets CM9 0 1/1/1988 0:00 N22328 B 0 Mail-In 0 12/31/1899 0:00 122329 B 0 Mail-In 0 12/31/1899 0:00 122330 B 0 Mail-In 0 12/31/1899 0:00 122331 B 0 Mail-In 0 12/31/1899 0:00 122332 B 0 Mail-In 0 12/31/1899 0:00 122333 B 0 Mail-In 0 12/31/1899 0:00 122334 B 0 Mail-In 0 12/31/1899 0:00 122335 B 0 Mail-In 0 12/31/1899 0:00 12250AB B 0 Reports CM9 0 1/1/1988 0:00 N225170 C 0 Refreshers 16Q 0 12/31/1899 0:00 N23400A B 55.75 Kit CFI 0 1/1/1988 0:00 N23700A B 0 Manual CFI 0 12/31/1899 0:00 N24001D C 0 Profiles MR2 0 1/1/1988 0:00 Y24002D C 0 Profiles MR2 0 1/1/1988 0:00 Y24003D C 0 Profiles MR2 0 1/1/1988 0:00 N24004D C 0 Profiles MR2 0 1/1/1988 0:00 Y24005D C 0 Profiles MR2 0 1/1/1988 0:00 Y24006D C 0 Profiles MR2 0 1/1/1988 0:00 Y24007L C 0 Profiles MR2 0 1/1/1988 0:00 N24009N C 0 Scoring Key/Material MR2 0 1/1/1997 0:00 N24010F C 0 Test Booklet MR2 0 1/1/1988 0:00 Y24012E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24013E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24014E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 N24015E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24016E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24017F C 0 Test Booklet MR2 0 1/1/1988 0:00 Y24019E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24020E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24022E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24023E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24024F C 0 Test Booklet MR2 0 1/1/1988 0:00 Y24025L C 0 Audio MR3 0 1/1/1988 0:00 Y24026L C 0 Audio MR3 0 1/1/1988 0:00 Y24027C C 0 Manual MR2 0 1/1/1988 0:00 Y24028C C 0 Manual MR2 0 1/1/1988 0:00 N
24029C C 0 Manual MR2 0 1/1/1988 0:00 N24031C C 0 Manual MR2 0 1/1/1988 0:00 Y24032C C 0 Manual MR2 0 1/1/1988 0:00 Y24034J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24035J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24036J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24037J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24038B C 0 Manual MR2 0 1/1/1988 0:00 N24039M C 0 Manual MR2 0 1/1/1997 0:00 N24040J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24041C C 0 Manual MR2 0 2/18/2002 0:00 Y24042F C 0 Test Booklet MR2 0 1/1/1996 0:00 Y24043J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24045J C 0 Mail-In MR4 0 1/1/1988 0:00 N24047J C 0 Mail-In MR4 0 1/1/1988 0:00 N24050J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24051 C 0 Audio MR3 0 1/1/1988 0:00 N24053J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24060J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24063J C 0 Mail-In MR4 0 1/1/1988 0:00 Y24066N C 0 Mail-In MR4 0 1/1/1988 0:00 Y24069N C 0 Mail-In MR4 0 1/1/1988 0:00 Y24076I C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 N24079I C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 N24082B C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 Y24083B C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 Y24084E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24085E C 0 Scoring Key/Material MR2 0 1/1/1988 0:00 Y24086D C 0 Profiles MR2 0 1/1/1988 0:00 Y24100D B 31.5 Test Booklet CFI 0 1/1/1988 0:00 N24101C C 0 Manual MR8 0 1/1/1998 0:00 Y24102J C 0 Mail-In MR8 0 1/1/1998 0:00 Y24103J C 0 Mail-In MR8 0 1/1/1998 0:00 Y24104N C 0 Test Booklet MR2 0 6/18/2001 0:00 Y24105N C 0 Test Booklet MR2 0 6/18/2001 0:00 Y24106N C 0 Test Booklet MR2 0 6/18/2001 0:00 Y24107N C 0 Test Booklet MR2 0 6/18/2001 0:00 Y24108N C 0 Test Booklet MR2 0 6/18/2001 0:00 Y24109N C 0 Test Booklet MR2 0 6/18/2001 0:00 Y24400H B 25.75 Answer/Data Sheets CFI 0 1/1/1988 0:00 N24700I B 8 Answer/Data Sheets CFI 0 4/19/2000 0:00 N25001E C 0 Scoring Key/Material ML2 0 1/1/1988 0:00 Y25002E C 0 Scoring Key/Material ML2 0 1/1/1988 0:00 Y25003C C 0 Manual ML2 0 1/1/1988 0:00 Y25004C C 0 Manual ML2 0 1/1/1988 0:00 N25005D C 0 Profiles ML2 0 1/1/1988 0:00 Y25006E C 0 Scoring Key/Material ML2 0 1/1/1988 0:00 Y25007E C 0 Scoring Key/Material ML2 0 1/1/1988 0:00 Y25008M C 0 Profiles ML2 0 1/1/1988 0:00 N25009D C 0 Profiles ML2 0 1/1/1988 0:00 Y25010E C 0 Scoring Key/Material ML2 0 1/1/1988 0:00 Y25011E C 0 Scoring Key/Material ML2 0 1/1/1988 0:00 Y25012B C 0 Answer/Data Sheets ML2 0 1/1/1988 0:00 Y25013B C 0 Answer/Data Sheets ML2 0 1/1/1988 0:00 Y
25015F C 0 Test Booklet ML2 0 1/1/1988 0:00 Y25016F C 0 Test Booklet ML2 0 1/1/1988 0:00 Y25018L C 0 Audio ML3 0 1/1/1988 0:00 Y25021J C 0 Mail-In ML4 0 1/1/1988 0:00 Y25022J C 0 Mail-In ML4 0 1/1/1988 0:00 Y25023J C 0 Mail-In ML4 0 1/1/1988 0:00 Y25024J C 0 Mail-In ML4 0 1/1/1988 0:00 Y25025J C 0 Mail-In ML4 0 1/1/1988 0:00 Y25026J C 0 Mail-In ML4 0 1/1/1988 0:00 Y25052 C 0 Audio MR3 0 1/1/1988 0:00 N25900C B 18 Test Booklet IDS 0 1/1/1988 0:00 N26000B B 0 Manual IDS 0 1/1/1998 0:00 N26100D B 0 Scoring Key/Material IDS 0 1/1/1998 0:00 N26200A B 0 Kit IDS 0 1/1/1988 0:00 N26304B B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 N26305E B 0 Mail-In CA4 0 1/1/1988 0:00 Y26306E B 0 Mail-In CA4 0 1/1/1988 0:00 Y26308E B 0 Mail-In CA4 0 1/1/1988 0:00 Y26310G B 0 Report Paper CA2 0 1/1/1988 0:00 N26328E B 0 Mail-In CA4 0 1/1/1988 0:00 N26355A B 0 Manual CA2 0 1/1/1988 0:00 Y26381E B 0 Mail-In CA4 0 1/1/1988 0:00 Y26382B B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 Y26400E B 0 Mail-In CA4 0 1/1/1988 0:00 Y26402E B 0 Mail-In CA4 0 1/1/1988 0:00 Y26405E B 0 Mail-In CA4 0 1/1/1988 0:00 Y26408G A 0 Report Paper CA2 0 1/1/1988 0:00 N26410A B 0 Manual CA2 0 1/1/1988 0:00 Y26461D B 0 Mail-In CM2 0 1/1/1988 0:00 Y26469A B 0 Manual CM2 0 1/1/1988 0:00 Y26471F B 0 Workbook/Worksheet CM2 0 1/1/1988 0:00 Y26479F A 0 Report Paper CM2 0 1/1/1988 0:00 Y26480B B 0 Answer/Data Sheets CM2 0 1/1/1988 0:00 N26486A B 0 Manual CM2 0 1/1/1988 0:00 Y26705A B 0 Profiles SDI 0 1/1/1988 0:00 N26724A B 0 Manual SDI 0 1/1/1988 0:00 N26805A B 0 Mail-In TVI 0 1/1/1988 0:00 N26809A B 0 Mail-In TVI 0 1/1/1988 0:00 N26823A B 0 Manual TVI 0 1/1/1988 0:00 N27000G B 35.75 Manual PFC 0 1/1/1988 0:00 N27180F C 0 Test Booklet MI2 0 1/1/1988 0:00 N27199F C 0 Test Booklet MI2 0 1/1/1988 0:00 N27205E C 0 Scoring Key/Material MI2 0 1/1/1988 0:00 N27208E C 0 Scoring Key/Material MMI 0 1/1/1988 0:00 N27209D C 0 Profiles MI2 0 1/1/1988 0:00 N27210D C 0 Profiles MI2 0 1/1/1988 0:00 N27211E C 0 Profiles MMI 0 1/1/1988 0:00 N27212D C 0 Profiles MI2 0 1/1/1988 0:00 N27223F C 0 Test Booklet MI2 0 1/1/1988 0:00 N27305C C 0 Manual MI2 0 1/1/1988 0:00 N27307C A 0 Manual MI2 0 1/1/1988 0:00 N27309D C 0 Profiles MI2 0 1/1/1988 0:00 N27317L C 0 Audio MI3 0 1/1/1988 0:00 N27330B C 0 Answer/Data Sheets MI2 0 1/1/1988 0:00 N
27332B C 0 Answer/Data Sheets MI2 0 1/1/1988 0:00 N27377J C 0 Mail-In MI4 0 1/1/1988 0:00 N27393E C 0 Profiles MMI 0 1/1/1988 0:00 N27395E C 0 Scoring Key/Material MI2 0 1/1/1988 0:00 N27396E C 0 Scoring Key/Material MI2 0 1/1/1988 0:00 N27397E C 0 Profiles MMI 0 1/1/1988 0:00 N27400B A 57 Mail-In EPS 0 1/1/1988 0:00 N27500C A 35.75 Manual EPS 0 1/1/1988 0:00 Y27700D A 28.5 Test Booklet EPS 0 1/1/1988 0:00 Y277S0D A 0 Test Booklet EPS 0 1/1/1988 0:00 N278000 B 24 SW Refresher EPS 0 12/31/1899 0:00 N278M0B A 25 Mail-In EPS 0 1/1/1988 0:00 Y27900E A 17.8 Answer/Data Sheets EPS 0 1/1/1988 0:00 Y279S0E B 0 Answer/Data Sheets EPS 0 1/1/1988 0:00 N29276L A 0 Book CON 0 1/1/1988 0:00 N29280A A 0 Book IGE 0 1/1/1988 0:00 N29422N C 0 Manual MR2 0 12/31/1899 0:00 N29433N A 0 Manual MR2 0 12/31/1899 0:00 N29433U C 0 Reports MR2 0 12/31/1899 0:00 030000A B 73 Kit CAX 0 1/1/1996 0:00 N30002 B 0 Admin. Material 0 12/31/1899 0:00 130003 B 0 Admin. Material 0 12/31/1899 0:00 130004 B 0 Admin. Material 0 12/31/1899 0:00 130005 B 0 Admin. Material 0 12/31/1899 0:00 130006 B 0 Admin. Material 0 12/31/1899 0:00 130007 B 0 Admin. Material 0 12/31/1899 0:00 130008 B 0 Answer/Data Sheets 0 12/31/1899 0:00 130009 B 0 Answer/Data Sheets 0 12/31/1899 0:00 130010 B 0 Answer/Data Sheets 0 12/31/1899 0:00 130011 B 0 Answer/Data Sheets 0 12/31/1899 0:00 130100B B 21.5 Manual CAX 0 1/1/1996 0:00 N30200C B 0 Answer/Data Sheets CAX 0 1/1/1998 0:00 N30400E B 0 Scoring Key/Material CAX 0 1/1/1998 0:00 N31000N C 0 Profiles MR2 0 12/31/1899 0:00 Y31001N C 0 Scoring Key/Material MR2 0 12/31/1899 0:00 Y31002N C 0 Scoring Key/Material MR2 0 12/31/1899 0:00 Y33002L C 0 Audio MM3 0 1/1/1988 0:00 Y33003L C 0 Audio MM3 0 1/1/1988 0:00 Y33004 C 0 Manual MA4 0 12/31/1899 0:00 033005A C 0 Kit MM2 0 1/1/1988 0:00 Y33006B C 0 Reorder Kit MM2 0 1/1/1988 0:00 Y33007E C 0 Scoring Key/Material MM2 0 1/1/1988 0:00 N33008 C 0 Answer/Data Sheets MA4 0 12/31/1899 0:00 033011F C 0 Test Booklet MM2 0 1/1/1988 0:00 Y33012J C 0 Mail-In MM4 0 1/1/1988 0:00 Y33013J C 0 Mail-In MM4 0 1/1/1988 0:00 Y33014J C 0 Mail-In MM4 0 1/1/1988 0:00 Y33015J C 0 Mail-In MM4 0 1/1/1988 0:00 Y33016C C 0 Manual MM2 0 1/1/1997 0:00 Y33017C C 0 Manual MM2 0 1/1/1998 0:00 Y33018J C 0 Mail-In MM4 0 1/1/1998 0:00 Y33019J C 0 Mail-In MM4 0 1/1/1998 0:00 N33020N C 0 Test Booklet MM2 0 12/31/1899 0:00 Y33022 C 0 Test Booklet MM2 0 12/31/1899 0:00 0
34000K A 35.75 Kit HAT 0 1/1/1998 0:00 N34100H A 0 Manual HAT 0 8/8/2001 0:00 N34200H A 0 Test Booklet HAT 0 8/8/2001 0:00 N35020B A 0 Test Booklet IDE 0 1/1/1988 0:00 Y35021A A 0 Manual IDE 0 1/1/1988 0:00 Y35022B A 0 Test Booklet IDE 0 1/1/1988 0:00 Y35023 A 0 Test Booklet IDE 0 12/31/1899 0:00 036400D B 25.75 Test Booklet API 0 1/1/1988 0:00 N36500F B 18 Answer/Data Sheets API 0 1/1/1988 0:00 N365S0F B 0 Answer/Data Sheets API 0 1/1/1988 0:00 N36600C B 35.75 Manual API 0 1/1/1988 0:00 N36700E B 17 Workbook/Worksheet API 0 1/1/1988 0:00 N37100I B 45.75 Mail-In CL2 1 1/1/1992 0:00 N37600F C 18 Answer/Data Sheets CAQ 0 1/1/1988 0:00 N37700H C 21.5 Scoring Key/Material CAQ 0 1/1/1988 0:00 N37800C C 35.75 Manual CAQ 0 1/1/1988 0:00 N37900F C 18 Answer/Data Sheets CAQ 0 1/1/1988 0:00 N379K0G C 33 Scoring Key/Material CAQ 0 1/1/1988 0:00 N379S0F C 0 Answer/Data Sheets CAQ 0 1/1/1992 0:00 N38000E C 88.5 Kit CAQ 0 1/1/1988 0:00 N38200H C 21.5 Scoring Key/Material CAQ 0 1/1/1988 0:00 N38300D C 57 Test Booklet CAQ 0 1/1/1988 0:00 N383S0D C 0 Test Booklet CAQ 0 1/1/1992 0:00 N40800C B 21.5 Manual PFC 0 1/1/1988 0:00 N409000 B 11.5 SW Refresher HSP 0 12/31/1899 0:00 N409M0B B 13.5 Mail-In HSP 0 1/1/1988 0:00 N410000 B 11.5 SW Refresher CPQ 0 12/31/1899 0:00 N410M0B B 13.5 Mail-In CPQ 0 1/1/1995 0:00 N412000 B 10 SW Refresher PFC 0 12/31/1899 0:00 N419000 B 30 SW Refresher CL2 0 12/31/1899 0:00 N419M0B B 32.5 Mail-In CL2 0 1/1/1992 0:00 N428000 B 11.5 SW Refresher MAT 0 12/31/1899 0:00 N428M0B B 13.5 Mail-In MAT 0 1/1/1988 0:00 N430000 B 15.75 SW Refresher PFC 0 12/31/1899 0:00 N430M0B B 18 Mail-In PFC 0 1/1/1988 0:00 N432000 B 30 SW Refresher PCD 0 12/31/1899 0:00 N432M0D B 33 Mail-In PCD 0 1/1/1988 0:00 N43400A B 28.5 Manual PFC 0 1/1/1995 0:00 N43500E B 55 Manual PCD 0 1/1/1988 0:00 Y44200J B 64 Mail-In PCD 0 1/1/1988 0:00 N44300F B 0 Admin. Material PCD 0 1/1/1988 0:00 N446000 B 25.75 SW Refresher PFC 0 12/31/1899 0:00 N447IRK B 26 Scoring Key/Material PFC 0 1/1/1998 0:00 N449000 B 30 SW Refresher PFC 0 12/31/1899 0:00 N449M0B B 33 Mail-In PFC 0 1/1/1988 0:00 Y45001D C 0 Test Booklet CQ2 0 1/1/1988 0:00 N45002B C 0 Mail-In CQ4 0 1/1/1988 0:00 N45099J C 0 Mail-In MH4 0 1/1/1988 0:00 Y45102J C 0 Mail-In MP4 0 1/1/1988 0:00 Y45103C C 0 Manual MP2 0 1/1/1988 0:00 Y45105J C 0 Mail-In MH4 0 1/1/1988 0:00 Y45106C C 0 Manual MH2 0 1/1/1988 0:00 Y45108J C 0 Mail-In MP4 0 1/1/1988 0:00 Y45109L C 0 Audio MP3 0 1/1/1988 0:00 Y
45110L C 0 Audio MP3 0 1/1/1988 0:00 Y45118J C 0 Mail-In MC4 0 1/1/1988 0:00 N45119C C 0 Manual MC2 0 1/1/1988 0:00 N45120J C 0 Mail-In MC4 0 1/1/1988 0:00 N45123F C 0 Test Booklet MC2 0 1/1/1988 0:00 N45126E C 0 Scoring Key/Material MC2 0 1/1/1996 0:00 N45126G C 0 Manual MC2 0 12/31/1899 0:00 N45127J C 0 Mail-In MC4 0 1/1/1988 0:00 N45128J C 0 Mail-In MC4 0 1/1/1988 0:00 N45129L C 0 Audio MC3 0 1/1/1988 0:00 N45131L C 0 Audio MC3 0 1/1/1988 0:00 N45132B C 0 Reorder Kit MC2 0 1/1/1988 0:00 N45134B C 0 Answer/Data Sheets MC2 0 1/1/1988 0:00 N45155L C 0 Audio MH3 0 1/1/1988 0:00 Y45156L C 0 Audio MH3 0 1/1/1988 0:00 Y45200K C 0 Mail-In MA4 0 1/1/1988 0:00 N45201K C 0 SW 16Bit MA6 0 1/1/1988 0:00 N45204B C 0 Reorder Kit MA2 0 1/1/1988 0:00 Y45205A C 0 Kit MA2 0 1/1/1988 0:00 Y45209C C 0 Manual MA2 0 1/1/1988 0:00 N45210C C 0 Manual MA2 0 1/1/1988 0:00 Y45211L C 0 Audio MA3 0 1/1/1988 0:00 Y45212L C 0 Audio MA3 0 1/1/1988 0:00 Y45213E C 0 Scoring Key/Material MA2 0 1/1/1988 0:00 Y45215 C 0 Profiles MA2 0 12/31/1899 0:00 045217F C 0 Test Booklet MA2 0 1/1/1988 0:00 Y45218 C 0 Test Booklet MA2 0 12/31/1899 0:00 045220J C 0 Mail-In MA4 0 1/1/1988 0:00 Y45221J C 0 Mail-In MA4 0 1/1/1988 0:00 Y45223J C 0 Mail-In MA4 0 1/1/1988 0:00 Y45224J C 0 Mail-In MA4 0 1/1/1988 0:00 Y454000 B 30 SW Refresher PCD 0 12/31/1899 0:00 N454M0B B 33 Mail-In PCD 0 1/1/1988 0:00 Y454NA B 18 SW Refresher PFC 0 2/19/2002 0:00 N455ISM B 21 Audio PFC 0 12/31/1899 0:00 N456M0C B 55.75 Mail-In PFC 0 1/1/1988 0:00 N45700D B 35.75 Test Booklet PFC 0 1/1/1998 0:00 N46100A B 0 Manual BBH 0 12/31/1899 0:00 Y46101 B 0 Audio bbh 0 12/31/1899 0:00 N46102 b 0 Mail-In bbh 0 1/1/1988 0:00 Y46105A B 0 Answer/Data Sheets BBH 0 12/31/1899 0:00 N46116 B 0 Test Booklet BBH 0 12/31/1899 0:00 046120A B 0 Manual BHH 0 12/31/1899 0:00 Y46123 B 0 Audio bbh 0 12/31/1899 0:00 Y46124 b 0 Mail-In bhh 0 1/1/1988 0:00 Y46125 B 0 Mail-In bhh 0 12/31/1899 0:00 Y46126 B 0 Mail-In bhh 0 12/31/1899 0:00 Y46128A B 0 Answer/Data Sheets BHH 0 12/31/1899 0:00 Y46145 B 0 Test Booklet BH2 0 12/31/1899 0:00 Y46200A B 0 Manual VMI 0 12/31/1899 0:00 046202 B 0 Test Booklet VMI 0 12/31/1899 0:00 146204 B 0 Test Booklet VMI 0 12/31/1899 0:00 146206 B 0 Test Booklet VMI 0 12/31/1899 0:00 146208 B 0 QuikScore Form VMI 0 12/31/1899 0:00 1
46209 B 0 Report Paper VMI 99 12/31/1899 0:00 146210C B 0 Book VMI 0 12/31/1899 0:00 146211C B 0 Report Paper VMI 0 12/31/1899 0:00 146212C B 0 Book VMI 0 12/31/1899 0:00 146214C B 0 Report Paper VMI 0 12/31/1899 0:00 146215C B 0 Report Paper VMI 0 12/31/1899 0:00 146216C B 0 Report Paper VMI 0 12/31/1899 0:00 146217C B 0 Manual VMI 0 12/31/1899 0:00 146218C B 0 Test Booklet VMI 0 12/31/1899 0:00 146219C B 0 Test Booklet VMI 0 12/31/1899 0:00 146220C B 0 Test Booklet VMI 0 12/31/1899 0:00 146221C B 0 Test Booklet VMI 0 12/31/1899 0:00 146222C B 0 Test Booklet VMI 0 12/31/1899 0:00 146223C B 0 Test Booklet VMI 0 12/31/1899 0:00 146224C B 0 QuikScore Form VMI 0 12/31/1899 0:00 146225C B 0 QuikScore Form VMI 0 12/31/1899 0:00 146300 B 0 Report Paper MIP 0 12/31/1899 0:00 146301 B 0 Test Booklet MIP 0 12/31/1899 0:00 146303 B 0 Answer/Data Sheets MIP 0 12/31/1899 0:00 146304 B 0 Answer/Data Sheets MIP 0 12/31/1899 0:00 146305 B 0 Report Paper MIP 0 12/31/1899 0:00 146411 C 0 Test Booklet MP2 0 12/31/1899 0:00 146412 C 0 Test Booklet MH2 0 12/31/1899 0:00 147300F B 60 Mail-In HRD 0 1/1/1988 0:00 N475000 B 30 SW Refresher HRD 0 12/31/1899 0:00 N475M0B B 33 Mail-In HRD 0 1/1/1988 0:00 Y475NA B 18.5 SW Refresher PFC 0 2/19/2002 0:00 N47700C B 45 Manual HRD 0 1/1/1988 0:00 Y48009A B 0 Manual AU2 0 1/1/1988 0:00 Y48010B B 0 Test Booklet AU2 0 1/1/1988 0:00 Y48011A B 0 Manual AU2 0 1/1/1988 0:00 Y48013E B 0 Scoring Key/Material AU2 0 1/1/1988 0:00 Y48015I B 0 Mail-In AU4 0 1/1/1988 0:00 N48018I B 0 Mail-In AU4 0 1/1/1988 0:00 N48020D B 0 Answer/Data Sheets AU2 0 1/1/1988 0:00 Y482000 B 30 SW Refresher 16L 0 12/31/1899 0:00 N482M0B C 32.5 Mail-In 16L 0 1/1/1988 0:00 N48400C C 28.5 Manual LEA 0 1/1/1988 0:00 N48700A A 425 SW DOS IOS 0 1/1/1988 0:00 N487U0A A 0 Upgrade IOS 0 1/1/1996 0:00 N487U2A A 0 Upgrade IOS 0 1/1/1998 0:00 N487U56 B 0 Upgrade IOS 0 9/23/1999 0:00 N487U57 B 0 Upgrade IOS 0 3/9/2000 0:00 N48900F C 50 Mail-In 16L 0 1/1/1988 0:00 N49200C B 14.25 Manual PFC 0 1/1/1988 0:00 N49300F B 35.75 Workbook/Worksheet PFC 0 1/1/1988 0:00 N4930SF B 0 Workbook/Worksheet PFC 0 1/1/1988 0:00 N498M0B B 27 Mail-In API 0 1/1/1988 0:00 N500000 B 11.5 SW Refresher HSP 0 12/31/1899 0:00 N50020 B 0 Answer/Data Sheets 0 12/31/1899 0:00 150021 B 0 Answer/Data Sheets 0 12/31/1899 0:00 150022 B 0 SW Refresher 0 12/31/1899 0:00 150023 B 0 SW Refresher 0 12/31/1899 0:00 150024 B 0 SW Refresher 0 12/31/1899 0:00 1
50025 B 0 SW Refresher 0 12/31/1899 0:00 150026 B 0 SW Refresher 0 12/31/1899 0:00 150027 B 0 SW Refresher 0 12/31/1899 0:00 150028 B 0 SW 16Bit 0 12/31/1899 0:00 150029 B 0 SW 16Bit 0 12/31/1899 0:00 150030 B 0 SW 16Bit 0 12/31/1899 0:00 150031 B 0 SW 16Bit 0 12/31/1899 0:00 150032 B 0 SW Refresher 0 12/31/1899 0:00 150033 B 0 SW Refresher 0 12/31/1899 0:00 150051I B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 N50053I B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 N50058M B 0 Mail-In SCL 0 12/4/2001 0:00 Y500M0B B 13.5 Mail-In HSP 0 1/1/1988 0:00 N50100C B 21.5 Manual HSP 0 1/1/1988 0:00 N50200F B 30 Mail-In HSP 0 1/1/1988 0:00 N50205G B 0 Feedback CA2 0 1/1/1988 0:00 N50207G B 0 Feedback CA2 0 1/1/1988 0:00 N50209G B 0 Feedback CA2 0 1/1/1988 0:00 N50213B B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 N50406I C 0 Answer/Data Sheets MH2 0 1/1/1988 0:00 N50604I C 0 Answer/Data Sheets CQ2 0 1/1/1988 0:00 N50905I C 0 Answer/Data Sheets MP2 0 1/1/1988 0:00 N510000 B 30 SW Refresher PFC 0 12/31/1899 0:00 N510M0B B 33 Mail-In PFC 0 1/1/1988 0:00 Y510NA B 13.5 SW Refresher PFC 0 2/19/2002 0:00 N511000 B 30 SW Refresher PFC 0 12/31/1899 0:00 N511M0D B 33 Mail-In PFC 0 1/1/1988 0:00 Y511NA B 8.5 SW Refresher PFC 0 2/19/2002 0:00 N51200A B 165 Kit PFC 0 1/1/1988 0:00 Y512LIA A 0 Maintenance PFC 0 1/1/1988 0:00 N51300B B 65 Manual PFC 0 1/1/1988 0:00 Y51400D B 21.5 Test Booklet PFC 0 1/1/1988 0:00 Y51400N A 0 Dongle MTQ 0 2/25/2002 0:00 N514010 B 0 SW Refresher 16Q 0 12/31/1899 0:00 N514050 B 0 SW Refresher 16Q 0 12/31/1899 0:00 N514060 B 0 SW Refresher 16Q 0 12/31/1899 0:00 N51407I C 0 Answer/Data Sheets MC2 0 1/1/1988 0:00 N51408I C 0 Answer/Data Sheets MP2 0 1/1/1988 0:00 N51409I C 0 Answer/Data Sheets MH2 0 1/1/1988 0:00 N51410I C 0 Answer/Data Sheets MC2 0 1/1/1988 0:00 N51411I C 0 Answer/Data Sheets MH2 0 1/1/1988 0:00 N51412I C 0 Answer/Data Sheets MP2 0 1/1/1988 0:00 N51413I B 0 Answer/Data Sheets PFC 0 1/1/1996 0:00 N51414I C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 N51415I C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 N51416I B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 N51417I B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 N514180 B 0 SW Refresher 16Q 0 12/31/1899 0:00 N51419I C 0 Answer/Data Sheets ML2 0 1/1/1988 0:00 N51420I C 0 Answer/Data Sheets ML2 0 1/1/1988 0:00 N51421I B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 N51422I B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 N514230 B 0 SW Refresher 16Q 0 12/31/1899 0:00 N51424I B 0 Answer/Data Sheets 16Q 0 1/1/1988 0:00 N
514250 B 0 SW Refresher AU6 0 12/31/1899 0:00 N514260 B 0 SW Refresher AU6 0 12/31/1899 0:00 N51427H B 0 Answer/Data Sheets AU2 0 1/1/1988 0:00 N51428I C 0 Answer/Data Sheets MA2 0 1/1/1988 0:00 N51429I C 0 Answer/Data Sheets MA2 0 1/1/1988 0:00 N51430N B 0 SW Refresher SCL 0 12/31/1899 0:00 N51430O B 0 SW Refresher SCL 0 12/31/1899 0:00 N514310 B 0 SW Refresher SCL 0 12/31/1899 0:00 N514320 B 0 SW Refresher SCL 0 12/31/1899 0:00 N514340 C 0 SW Refresher MC6 0 12/31/1899 0:00 N514350 C 0 SW Refresher MC6 0 12/31/1899 0:00 N514370 C 0 SW Refresher MR6 0 12/31/1899 0:00 N514380 C 0 SW Refresher MR6 0 12/31/1899 0:00 N514390 C 0 SW Refresher MR6 0 12/31/1899 0:00 N5143EJ B 0 Mail-In SCL 0 1/1/1988 0:00 Y5143FJ B 0 Mail-In SCL 0 1/1/1988 0:00 Y5143HJ B 0 Mail-In SCL 0 1/1/1988 0:00 Y514411 C 0 SW Refresher MR6 0 12/31/1899 0:00 N514420 C 0 SW Refresher MR6 0 12/31/1899 0:00 N514430 C 0 SW Refresher MR6 0 12/31/1899 0:00 N514441 B 0 SW Refresher MH6 0 12/31/1899 0:00 Y514460 C 0 SW Refresher MP6 0 12/31/1899 0:00 N514480 C 0 SW Refresher ML6 0 12/31/1899 0:00 N514490 C 0 SW Refresher ML6 0 12/31/1899 0:00 N514500 C 0 SW Refresher ML6 0 12/31/1899 0:00 N514510 B 0 SW Refresher BS6 0 12/31/1899 0:00 N51454 A 0 Manual MTQ 0 1/1/1988 0:00 051454D A 0 Manual MTQ 0 1/1/1988 0:00 N514550 C 0 SW Refresher MI6 0 12/31/1899 0:00 N514560 B 0 SW Refresher CM6 0 12/31/1899 0:00 N514570 B 0 SW Refresher BS6 0 12/31/1899 0:00 N5145EJ B 0 Mail-In BS4 0 1/1/1988 0:00 Y5145HJ B 0 Mail-In BS4 0 1/1/1988 0:00 Y514600 B 0 SW Refresher CA6 0 12/31/1899 0:00 N514610 B 0 SW Refresher CA6 0 12/31/1899 0:00 N51462B B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 N514630 B 0 SW Refresher CA6 0 12/31/1899 0:00 N514640 B 0 SW Refresher CA6 0 12/31/1899 0:00 N51465B B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 N51466B B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 Y514670 C 0 SW Refresher MI6 0 12/31/1899 0:00 N514680 C 0 SW Refresher MI6 0 12/31/1899 0:00 N51470A B 0 Manual QSH 0 1/1/1988 0:00 Y51471E B 0 Answer/Data Sheets QSH 0 1/1/1988 0:00 N51472E B 0 Answer/Data Sheets QSH 0 1/1/1988 0:00 N51473B B 0 Test Booklet QSH 0 1/1/1988 0:00 Y51474B B 0 Test Booklet QSH 0 1/1/1988 0:00 Y514750 B 0 SW Refresher QSH 0 12/31/1899 0:00 N51477I C 0 Answer/Data Sheets MR2 0 1/1/1997 0:00 N51478I C 0 Answer/Data Sheets MR2 0 1/1/1996 0:00 N514820 B 0 SW Refresher 16Q 0 12/31/1899 0:00 N514830 B 0 SW Refresher 16Q 0 12/31/1899 0:00 N514840 B 0 SW Refresher 16Q 0 12/31/1899 0:00 N514850 C 0 SW Refresher MA6 0 12/31/1899 0:00 N
514860 C 0 SW Refresher MA6 0 12/31/1899 0:00 N514870 C 0 SW Refresher MR6 0 12/31/1899 0:00 N514880 C 0 SW Refresher IQQ 0 12/31/1899 0:00 N51490C B 0 Answer/Data Sheets DPR 0 1/1/1988 0:00 N51491A B 0 Answer/Data Sheets HSQ 0 1/1/1988 0:00 Y51492A A 0 Manual HSQ 0 1/1/1988 0:00 Y51493A B 0 Manual HSQ 0 1/1/1988 0:00 Y51494H C 0 Answer/Data Sheets ISQ 0 1/1/1988 0:00 N514950 B 0 SW Refresher HSQ 0 12/31/1899 0:00 Y51496H C 0 Answer/Data Sheets ISQ 0 1/1/1988 0:00 N514970 B 0 SW Refresher HSQ 0 12/31/1899 0:00 Y51498E B 0 Answer/Data Sheets QSH 0 1/1/1988 0:00 N514F0A B 21.5 Test Booklet PFF 0 1/1/1998 0:00 Y51500E B 20 Answer/Data Sheets PFC 0 1/1/1988 0:00 Y51504A B 0 Answer/Data Sheets TJT 0 1/1/1995 0:00 N51505A B 0 Answer/Data Sheets TJT 0 1/1/1995 0:00 N515060 B 0 SW Refresher TJT 0 12/31/1899 0:00 N515070 B 0 SW Refresher TJT 0 12/31/1899 0:00 N515080 B 0 SW Refresher TJT 0 12/31/1899 0:00 N515090 B 0 SW Refresher TJT 0 12/31/1899 0:00 N515100 C 0 SW Refresher GAM 0 12/31/1899 0:00 N51510J B 0 Mail-In GAM 0 12/31/1899 0:00 N51511I C 0 Answer/Data Sheets MM2 0 1/1/1988 0:00 N51512I C 0 Answer/Data Sheets MM2 0 1/1/1988 0:00 N515130 C 0 SW Refresher MM6 0 12/31/1899 0:00 N515140 C 0 SW Refresher MM6 0 12/31/1899 0:00 N515150 C 0 SW Refresher MR8 0 12/31/1899 0:00 N51520G B 0 Answer/Data Sheets QOL 0 1/1/1988 0:00 N51521O B 0 SW Refresher QOL 0 12/31/1899 0:00 N515220 B 0 SW Refresher QOL 0 12/31/1899 0:00 N515230 B 0 SW Refresher GZ6 0 12/31/1899 0:00 N515250 B 0 SW Refresher PP3 0 12/31/1899 0:00 N51526B B 0 Answer/Data Sheets PP3 0 1/1/1996 0:00 N515270 B 0 SW Refresher PP3 0 12/31/1899 0:00 N51528I B 0 Answer/Data Sheets BH2 0 1/1/1988 0:00 N51529I B 0 Answer/Data Sheets BH2 0 1/1/1996 0:00 N515300 B 0 SW Refresher BH6 0 12/31/1899 0:00 Y515310 B 0 SW Refresher BH6 0 12/31/1899 0:00 Y515320 B 0 SW Refresher BH6 0 12/31/1899 0:00 Y515350 C 0 SW Refresher MM6 0 12/31/1899 0:00 N51536I C 0 Answer/Data Sheets MR8 0 1/1/1998 0:00 N51537I C 0 Answer/Data Sheets MR8 0 1/1/1998 0:00 N51546 B 0 Test Booklet HSQ 0 12/31/1899 0:00 151547 B 0 SW Refresher MIP 0 12/31/1899 0:00 051548 B 0 SW Refresher MIP 0 12/31/1899 0:00 051600B B 0 Reorder Kit BH2 0 1/1/1996 0:00 Y51600F B 11.5 Workbook/Worksheet PFC 0 1/1/1988 0:00 Y51601A B 0 Kit BH2 0 1/1/1996 0:00 Y51605F B 0 Test Booklet BH2 0 1/1/1996 0:00 Y51606F B 0 Test Booklet BH2 0 1/1/1996 0:00 Y51607J B 0 Mail-In BH4 0 1/1/1988 0:00 N51608J B 0 Mail-In BH4 0 1/1/1988 0:00 Y51609H B 0 Mail-In BH4 0 1/1/1988 0:00 N51610J B 0 Mail-In BH4 0 1/1/1988 0:00 Y
51611L B 0 Audio BH3 0 1/1/1988 0:00 Y51612L B 0 Audio BH3 0 1/1/1988 0:00 Y51613C B 0 Manual BH2 0 1/1/1996 0:00 Y51614A B 0 Scoring Key/Material BH2 0 2/15/2000 0:00 Y51616 B 0 SW Refresher BBH 0 12/31/1899 0:00 151616A B 0 Refreshers BBH 0 12/31/1899 0:00 N51619 B 0 Test Booklet POS 0 12/31/1899 0:00 151624 B 0 SW Refresher bhh 0 12/31/1899 0:00 Y51625A B 0 Refreshers BHH 0 12/31/1899 0:00 Y51626A B 0 Refreshers BHH 0 12/31/1899 0:00 Y51627A B 0 Refreshers BHH 0 12/31/1899 0:00 Y51700G B 39 Scoring Key/Material PFC 0 1/1/1988 0:00 Y51735G B 0 Kit POS 0 1/1/1995 0:00 Y51736D B 0 SW 16Bit POS 0 1/1/1996 0:00 N51737B B 0 Answer/Data Sheets POS 0 1/1/1995 0:00 N51738A B 0 Manual POS 0 1/1/1995 0:00 Y517390 B 0 SW Refresher POS 0 12/31/1899 0:00 N51740F B 141.75 Reorder Kit POS 0 1/1/1996 0:00 Y51750E C 0 Answer/Data Sheets GAM 0 1/1/1988 0:00 N51751B C 0 Manual GAM 0 1/1/1988 0:00 Y51752D C 0 Test Booklet GAM 0 1/1/1988 0:00 Y51753C C 0 Answer/Data Sheets GAM 0 1/1/1988 0:00 Y51754D C 0 Test Booklet GAM 0 1/1/1988 0:00 Y51757 B 0 Test Booklet GAM 0 12/31/1899 0:00 051767A C 0 Manual VIP 0 1/1/1997 0:00 Y51768B C 0 Test Booklet VIP 0 1/1/1997 0:00 Y51770C C 0 Answer/Data Sheets VIP 0 1/1/1997 0:00 N517710 C 0 SW Refresher VIP 0 12/31/1899 0:00 N51772C C 0 Mail-In VIP 0 1/1/1998 0:00 Y51773E C 0 Mail-In VIP 0 1/1/1998 0:00 N51774E C 0 SW 16Bit VIP 0 1/1/1998 0:00 N51779 C 0 Test Booklet VIP 0 12/31/1899 0:00 051800K B 70 Mail-In PFC 1 1/1/1988 0:00 N51811F B 0 Manual CM2 0 1/1/1998 0:00 Y518F0K B 75 Mail-In BIR 1 1/1/1998 0:00 N51900C B 80 Manual PFC 0 1/1/1988 0:00 Y51904N C 0 Answer/Data Sheets BS2 0 12/31/1899 0:00 Y51905N C 0 Answer/Data Sheets BS2 0 12/31/1899 0:00 Y51906N C 0 Manual BS2 0 12/31/1899 0:00 Y51907N C 0 Answer/Data Sheets BS2 0 12/31/1899 0:00 Y5190NS B 20 Manual PFC 0 2/7/2002 0:00 Y51925N C 0 Mail-In MBM 0 12/31/1899 0:00 Y51927N C 0 Mail-In MBM 0 12/31/1899 0:00 Y51929N C 0 Answer/Data Sheets MBM 0 12/31/1899 0:00 N51931N C 0 Test Booklet MBM 0 12/31/1899 0:00 Y51938N C 0 Audio MBM 0 12/31/1899 0:00 Y51940N C 0 Manual MBM 0 12/31/1899 0:00 Y51941N C 0 SW Refresher MBM 0 12/31/1899 0:00 N51942N C 0 SW Refresher MBM 0 12/31/1899 0:00 N51946 C 0 Answer/Data Sheets BS2 0 12/31/1899 0:00 051950N C 0 Manual MR2 0 12/31/1899 0:00 Y51951N C 0 Report Paper MMP 0 4/10/2000 0:00 N51952N C 0 Mail-In MR4 0 12/31/1899 0:00 Y51953N C 0 Book MR4 0 12/31/1899 0:00 Y
51954 C 0 Answer/Data Sheets MR2 0 12/31/1899 0:00 051955 C 0 Answer/Data Sheets MR2 0 12/31/1899 0:00 051968N C 0 Answer/Data Sheets MBM 0 12/31/1899 0:00 Y520000 B 32 SW Refresher PFC 0 12/31/1899 0:00 N520A0F B 35 Mail-In PFC 0 1/1/1988 0:00 Y521PFJ B 50 Mail-In CCR 0 1/1/1998 0:00 N52200C B 45 Manual CCR 0 1/1/1988 0:00 Y52300D B 25.75 Test Booklet CCR 0 1/1/1988 0:00 Y523S0D B 0 Test Booklet CCR 0 1/1/1997 0:00 N52400E B 21.5 Answer/Data Sheets CCR 0 1/1/1988 0:00 Y524S0E B 0 Answer/Data Sheets PFC 0 1/1/1997 0:00 N52900C B 35.75 Manual PFC 0 1/1/1997 0:00 Y530000 B 25 SW 16Bit 16S 0 1/30/2002 0:00 N531000 B 43 Manual 16S 0 1/30/2002 0:00 N532000 B 43 Answer/Data Sheets 16S 0 1/30/2002 0:00 N533000 B 47 SW 16Bit 16S 0 1/30/2002 0:00 N535000 B 250 SW 16Bit 16S 0 1/30/2002 0:00 N55200K A 40 Book PFC 0 1/1/1998 0:00 N55400I A 32 Book PFC 0 6/9/2000 0:00 Y560MI0 B 33 Mail-In CCP 0 12/31/1899 0:00 Y560NA B 26.5 SW Refresher PFC 0 2/19/2002 0:00 N560USE B 30 Refreshers CCP 0 12/31/1899 0:00 N561PP0 B 50 Mail-In CCP 1 12/31/1899 0:00 N562MN0 B 45 Manual CCP 0 12/31/1899 0:00 Y570BP2 B 0 SW Refresher IOS 0 12/31/1899 0:00 N570IP1 B 420 SW 16Bit IOS 0 8/4/2000 0:00 N570UP1 B 0 SW Refresher IOS 0 12/31/1899 0:00 N570UP3 A 0 SW Refresher IOS 0 12/31/1899 0:00 0571IP2 B 460 SW Refresher IOS 0 8/4/2000 0:00 N572IP1 B 35 Manual IOS 0 8/16/2000 0:00 N580000 B 0 SW Refresher PFC 0 12/31/1899 0:00 N580M0D B 30 Mail-In PFC 0 12/31/1899 0:00 Y58100A B 0 Mail-In PFC 0 1/1/1998 0:00 N58200B B 56 Manual PFC 0 1/1/1998 0:00 Y700000 B 18.5 Report Paper APQ 0 1/30/2002 0:00 Y701000 B 47 Kit APQ 0 1/30/2002 0:00 N702000 B 43 Manual APQ 0 1/30/2002 0:00 Y703000 B 28 Test Booklet APQ 0 1/30/2002 0:00 Y704000 B 21.5 Answer/Data Sheets APQ 0 1/30/2002 0:00 Y706APQ B 0 SW 16Bit APQ 0 12/31/1899 0:00 0708000 B 30 Report Paper APQ 0 1/30/2002 0:00 Y708M B 0 Mail-In APQ 0 12/31/1899 0:00 0709000 B 47 Kit APQ 0 1/30/2002 0:00 N740000 B 71 SW Refresher 16W 0 1/30/2002 0:00 N741000 B 105 SW Refresher 16W 0 1/30/2002 0:00 N88731P B 0 Interview Guide/Bklt NON 0 10/23/2000 0:00 NAAAT0T A 59.95 Audio CRS 0 1/1/1996 0:00 NAADH10 A 49.5 Book AAD 0 12/31/1899 0:00 YAASA10 A 42.95 Book AAS 0 12/31/1899 0:00 YAAVY1R A 28.5 Book ASV 0 12/20/2001 0:00 YAB13PA B 140 Kit ABC 0 1/1/1988 0:00 YAB14PA B 56 Manual ABC 0 1/1/1988 0:00 YAB15PA B 61 Test Booklet ABC 0 1/1/1988 0:00 YAB16PA B 26.5 Profiles ABC 0 1/1/1988 0:00 Y
AB18PA B 140 Kit ABC 0 1/1/1988 0:00 YAB19PA B 54 Manual ABC 0 1/1/1988 0:00 NAB1F3A B 98 SW DOS ABC 0 1/1/1988 0:00 NAB1FMA B 108 SW - Macintosh ABC 0 1/1/1988 0:00 NAB20PA B 61 Test Booklet ABC 0 1/1/1988 0:00 YAB21PA B 175 Test Booklet ABC 0 1/1/1988 0:00 NAB22PA B 27.5 Profiles ABC 0 1/1/1988 0:00 YAB23PA B 76 Profiles ABC 0 1/1/1988 0:00 NAB2F3A B 98 SW DOS ABC 0 1/1/1988 0:00 NAC1F3B B 130 SW DOS ACQ 0 1/1/1989 0:00 NAC1O3E B 0 SW DOS ACQ 0 1/1/1989 0:00 NAC1P0A B 42 Answer/Data Sheets ACZ 0 1/1/1989 0:00 NAC2P0A B 99.75 Answer/Data Sheets ACZ 0 1/1/1989 0:00 NACLR1A B 37.8 Kit AAA 0 1/1/1997 0:00 NACSR1A B 10.5 Kit AAA 0 1/1/1997 0:00 NACTFRE A 0 Freight FRE 0 12/31/1899 0:00 NAD100A B 317 Kit DTL 0 1/1/1988 0:00 YAD1R0A A 58 Book ANX 0 1/1/1988 0:00 YAD1R0S A 58 Book ANX 0 1/1/1988 0:00 0AD200A B 48.5 Manual DTL 0 1/1/1988 0:00 NAD2R0A A 40.95 Book ANG 0 1/1/1998 0:00 YAD300A B 57 Admin. Material DTL 0 1/1/1988 0:00 NAD400A B 28.5 Admin. Material DTL 0 1/1/1988 0:00 NAD500A B 55 Admin. Material DTL 0 1/1/1988 0:00 YAD600A B 27.5 Profiles DTL 0 1/1/1988 0:00 YAD700A B 27.5 Answer/Data Sheets DTL 0 1/1/1988 0:00 YAD8F3A B 120 SW DOS DTL 0 1/1/1988 0:00 NADDLDB A 12.95 Book ALD 0 1/1/1988 0:00 YADDS2A A 31.95 Book HYP 0 1/1/1988 0:00 NADHAC0 A 16.95 Book ADH 0 7/15/1999 0:00 YADHD0A A 73.95 Book ADB 0 1/1/1988 0:00 YADIR1 B 0 Interview Guide/Bklt 0 12/31/1899 0:00 0ADIR2 B 0 Interview Guide/Bklt 0 12/31/1899 0:00 0ADIR3 B 0 Manual 0 12/31/1899 0:00 0ADIR4 B 0 Manual 0 12/31/1899 0:00 0ADIR5 B 0 Manual 0 12/31/1899 0:00 0ADJBWF 700 Journal JAD 0 12/31/1899 0:00 NADJBWH 400 Journal JAD 0 12/31/1899 0:00 NADJCRF 1100 Journal JAD 0 12/31/1899 0:00 NADLR2B B 36.5 Answer/Data Sheets AAA 0 1/1/1997 0:00 NADLR5B B 18.9 Interview Guide/Bklt AAA 0 8/29/2000 0:00 NADMCVR 0 Misc 0 12/31/1899 0:00ADO1 B 0 Reorder Kit ADS 0 12/31/1899 0:00 0ADO2 B 0 Test Booklet ADS 0 12/31/1899 0:00 0ADO2M1 B 0 Test Booklet ADS 0 12/31/1899 0:00 0ADO2M2 B 0 Test Booklet ADS 0 12/31/1899 0:00 0ADO2M3 B 0 Test Booklet ADS 0 12/31/1899 0:00 0ADO2M4 B 0 Test Booklet ADS 0 12/31/1899 0:00 0ADO3 B 0 Manual ADS 0 12/31/1899 0:00 0ADS01 B 95 Kit ADS 0 12/31/1899 0:00 0ADS02 B 69 Kit ADS 0 12/31/1899 0:00 0ADS03 B 67 Kit ADS 0 12/31/1899 0:00 0ADS04 B 45 Manual ADS 0 12/31/1899 0:00 0ADS05 B 31.5 QuikScore Form ADS 0 12/31/1899 0:00 0
ADS06 B 113 QuikScore Form ADS 0 12/31/1899 0:00 0ADS07 B 29.5 QuikScore Form ADS 0 12/31/1899 0:00 0ADS08 B 108 QuikScore Form ADS 0 12/31/1899 0:00 0ADSR3C B 3.25 Answer/Data Sheets AAA 0 1/1/1997 0:00 NADSR4C B 5.25 Interview Guide/Bklt AAA 0 8/29/2000 0:00 NADT01 B 0 Video ADS 0 12/31/1899 0:00 0ADT02 B 0 Video ADS 0 12/31/1899 0:00 0ADT03 B 0 Book ADS 0 12/31/1899 0:00 0ADT04 B 0 Book ADS 0 12/31/1899 0:00 0ADYC10 A 21 Book ADY 0 12/31/1899 0:00 NAE1R0A A 0 Book AEI 0 1/1/1988 0:00 NAFV1R0 A 115 Book AFV 0 12/28/2000 0:00 YAGG1R0 A 54.95 Book AGG 0 12/31/1899 0:00 YAGLR2B B 36.5 Answer/Data Sheets AAA 0 1/1/1997 0:00 NAGLR5B B 18.9 Interview Guide/Bklt AAA 0 8/29/2000 0:00 NAGSR3C B 3.25 Answer/Data Sheets AAA 0 1/1/1997 0:00 NAGSR4C B 5.25 Interview Guide/Bklt AAA 0 8/29/2000 0:00 NAMP1RA B 89 Kit AMP 0 12/31/1899 0:00 YAMP2R0 B 54 Manual AMP 0 12/31/1899 0:00 YAMP3R0 B 40 Answer/Data Sheets AMP 0 12/31/1899 0:00 YANGM10 A 27.95 Book AMN 0 12/31/1899 0:00 YANS10A A 50.95 Book ANS 0 1/1/1998 0:00 NAP1R0A A 79.75 Book ADO 0 1/1/1988 0:00 NAPDS10 A 0 None NON 0 6/29/2000 0:00 NAPDS20 A 0 None NON 0 6/29/2000 0:00 NAPQP B 30 SW Refresher APQ 0 1/30/2002 0:00 0APS01 B 110.25 Kit APS 0 11/4/2001 0:00 YAPS02 B 47.25 Specimen Set APS 0 11/5/2001 0:00 YAPS03 B 40.75 Manual APS 0 11/5/2004 0:00 YAPS03CVR B 0 Manual APS 0 11/5/2004 0:00 0APS04 B 28.35 QuikScore Form APS 0 11/5/2001 0:00 YAPS05 B 101.85 QuikScore Form APS 0 11/5/2001 0:00 YAPS06 B 28.35 QuikScore Form APS 0 11/5/2001 0:00 YAPS07 B 101.85 QuikScore Form APS 0 11/5/2001 0:00 YAPS08 B 28.35 QuikScore Form APS 0 11/5/2001 0:00 YAPS09 B 101.85 QuikScore Form APS 0 11/5/2001 0:00 YAPVR00 A 31.95 Book ABP 0 12/31/1899 0:00 YAREAMF B 0 Manual ACQ 0 1/1/1989 0:00 NAS10PP B 15.75 Answer/Data Sheets CRO 0 1/1/1990 0:00 YAS11PP B 15.75 Answer/Data Sheets CRO 0 1/1/1990 0:00 YAS12PP B 0 Profiles CRO 0 1/1/1990 0:00 NAS13PP B 0 Admin. Material CRO 0 1/1/1990 0:00 NAS1P0P B 0 Kit CRO 0 1/1/1990 0:00 NAS1W0A A 369 SW 16Bit ASP 0 1/1/1997 0:00 NAS2D3B B 45 SW DOS CSI 0 1/1/1995 0:00 NAS2F3B B 405 SW Unlock CSI 0 1/1/1995 0:00 NAS2G3D B 100 Upgrade CSI 0 1/1/1996 0:00 NAS2O3E B 0 SW DOS CSI 0 1/1/1996 0:00 NAS2P0P B 0 Kit CRO 0 1/1/1990 0:00 NAS3G3D B 50 Upgrade DTR 0 1/1/1989 0:00 NAS3P0P B 0 Kit CRO 0 1/1/1990 0:00 NAS4P0P B 0 Kit CRO 0 1/1/1990 0:00 NAS5P0P B 54.5 Answer/Data Sheets CRO 0 1/1/1990 0:00 NAS6P0P B 54.5 Answer/Data Sheets CRO 0 1/1/1990 0:00 N
AS7P0P B 38.95 Profiles CRO 0 1/1/1990 0:00 yAS8P0P B 7.7 Manual CRO 0 1/1/1990 0:00 NAS9P0P B 39.95 Admin. Material CRO 0 1/1/1990 0:00 yASA10A A 43.95 Book 0 12/31/1899 0:00 0ASDS10 B 98 Kit ASD 0 12/24/2001 0:00 YASDS20 B 57 Manual ASD 0 12/24/2001 0:00 YASDS30 B 43 Interview Guide/Bklt ASD 0 12/24/2001 0:00 YAT1R0A A 37.75 Book ATI 0 1/1/1988 0:00 NAT2R0A A 20.95 Book TAS 0 1/1/1988 0:00 NATCP10 A 68.5 Book ATC 0 12/31/1899 0:00 YATHR4D B 1.95 Scoring Key/Material AAA 0 1/1/1997 0:00 NAUD3C3 A 0 Misc. INF 0 1/1/1998 0:00 NAUT2CE A 0 Misc. CSI 0 1/1/1988 0:00 NAUTO2E B 0 Manual CSI 0 1/1/1988 0:00 NAY2R0A A 30.95 Book AYO 0 1/1/1997 0:00 YAYM1R0 A 25 Book AYM 0 12/28/2000 0:00 NBBHIN B 0 Manual BBH 0 12/31/1899 0:00 NBC1P0B A 20 Video BCL 0 1/1/1995 0:00 YBC1V0A A 79 Video BCL 0 1/1/1995 0:00 YBC2P0B A 55 Video BCL 0 1/1/1995 0:00 YBCLP1R A 71.5 Book BCP 0 12/20/2001 0:00 YBETAPK B 0 Admin. Material INF 0 2/6/2002 0:00 NBGMC B 0 Book MIL 0 12/31/1899 0:00 YBGMCMI 0 0 12/31/1899 0:00BILLY 0 0 12/31/1899 0:00BILLYKIT 0 0 12/31/1899 0:00BIND4A B 0 Misc. INF 0 1/1/1988 0:00 NBMM1R0 A 38.5 Book BGM 0 12/31/1899 0:00 YBOEIR1 B 7.5 SW Refresher BOE 0 12/31/1899 0:00 1BP1F3A B 347 SW DOS BPS 0 1/1/1996 0:00 NBP1W0A B 239 SW 16Bit BPS 0 1/1/1996 0:00 NBP2P0A A 75 Book BIO 0 1/1/1988 0:00 NBP2PSC A 46 Book BIO 0 12/31/1899 0:00 NBP3P0A B 199 Kit BPS 0 1/1/1996 0:00 NBP4P0A B 99 Reorder Kit BPS 0 1/1/1996 0:00 NBP5P0A B 0 SW DOS BPS 0 1/1/1996 0:00 NBP6P0A B 199 SW 16Bit BPS 0 1/1/1996 0:00 NBR1F3A A 200 SW DOS BEN 0 1/1/1988 0:00 NBR1MNB A 0 Manual BEN 0 1/1/1998 0:00 NBRI10A B 197 Kit BRI 0 1/1/2001 0:00 YBRI20A B 58 Manual BRI 0 1/1/2001 0:00 YBRI30A B 46 Interview Guide/Bklt BIR 0 1/1/2001 0:00 NBRI40A B 46 Interview Guide/Bklt BIR 0 1/1/2001 0:00 NBRI50A B 32 Profiles BRI 0 1/1/2001 0:00 YBRI60A B 32 Profiles BRI 0 1/1/2001 0:00 YBRI700 B 425 SW 16Bit BRI 0 12/31/1899 0:00 0BRI800 B 579 SW 16Bit BRI 0 12/31/1899 0:00 0BRIP10 B 115.5 Reorder Kit BRI 0 12/31/1899 0:00 0BRIP20 B 55 Manual BRI 0 12/31/1899 0:00 0BRIP30 B 42.9 QuikScore Form BRI 0 12/31/1899 0:00 0BRIP40 B 29.7 QuikScore Form BRI 0 12/31/1899 0:00 0CA1R0A A 63.5 Book CAM 0 1/1/1988 0:00 YCA3R0A A 59.95 Book DRE 0 1/1/1988 0:00 YCAABSCOR c 0 SW Refresher cap 0 12/31/1899 0:00 0
CAAD1 B 33 Manual CAI 0 8/23/2001 0:00 YCAAD2 B 34.75 Kit CAI 0 8/23/2001 0:00 YCAAD3 B 34.75 Kit CAI 0 8/23/2001 0:00 YCAAD4 B 89.25 Kit CAI 0 8/23/2001 0:00 YCAAD5 B 36.75 Specimen Set CAI 0 8/23/2001 0:00 YCAADIDCVR 0 Misc 0 12/31/1899 0:00CAAQ0A A 27 Interview Guide/Bklt CRO 0 1/1/1994 0:00 YCAAQ2A A 94.5 Interview Guide/Bklt CRO 0 1/1/1994 0:00 YCAD01 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD02 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD03 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD04 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD05 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD06 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD07 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD08 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD09 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCAD10A B 167 Interview Guide/Bklt CAS 0 3/21/2000 0:00 NCADD15 B 0 Kit CRX 0 1/1/1997 0:00 NCADD25 B 0 Interview Guide/Bklt CRX 0 1/1/1997 0:00 NCADD35 B 0 Interview Guide/Bklt CRX 0 1/1/1997 0:00 NCADD45 B 0 Interview Guide/Bklt CRX 0 1/1/1997 0:00 NCALM1A A 291.5 Kit CLM 0 1/1/1997 0:00 yCALM2B A 170.5 Admin. Material CLM 0 1/1/1997 0:00 yCALM3C A 137.5 Workbook/Worksheet CLM 0 1/1/1997 0:00 yCALM4D A 0 Admin. Material CLM 0 1/1/1998 0:00 NCALM5E A 9 Audio CLM 0 1/1/1998 0:00 NCALM5ESLV 0 Audio 0 12/31/1899 0:00 0CALMGUCVR 0 Misc 0 12/31/1899 0:00CANCTA B 0 Info Pak INF 0 1/1/1995 0:00 NCANCTI B 0 Info Pak INF 0 12/4/2001 0:00 NCAR1 B 0 Reorder Kit 0 12/31/1899 0:00 0CAR10B B 201.5 Kit CAA 0 1/1/1998 0:00 yCAR10D B 109.25 QuikScore Form CAA 0 1/1/1998 0:00 yCAR11D B 29.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR12D B 106.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR13D B 29.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR14D B 106.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR15W B 0 Reorder Kit 0 12/31/1899 0:00 0CAR2 B 0 Scoring Key/Material 0 12/31/1899 0:00 0CAR20A B 44 Manual CAA 0 1/1/1998 0:00 yCAR21W B 0 Scoring Key/Material 0 12/31/1899 0:00 0CAR3 B 0 Manual 0 12/31/1899 0:00 0CAR30D B 30.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR31W B 0 Manual 0 12/31/1899 0:00 0CAR4 B 0 Video 0 12/31/1899 0:00 0CAR40D B 109.25 QuikScore Form CAA 0 1/1/1998 0:00 yCAR41W B 0 Video 0 12/31/1899 0:00 0CAR5 B 0 Video 0 12/31/1899 0:00 0CAR50D B 29.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR510 B 1.5 SW Refresher CAW 0 12/31/1899 0:00 YCAR51W B 0 Video 0 12/31/1899 0:00 0CAR520 B 3 SW Refresher CAW 0 12/31/1899 0:00 YCAR530 B 0 Manual CAW 0 12/31/1899 0:00 N
CAR540 B 45 SW 16Bit CAW 0 12/31/1899 0:00 YCAR550 B 25 Answer/Data Sheets CAW 0 12/31/1899 0:00 YCAR560 B 25 Answer/Data Sheets CAW 0 12/31/1899 0:00 YCAR570 B 25 Answer/Data Sheets CAW 0 12/31/1899 0:00 YCAR580 B 25 Answer/Data Sheets CAW 0 12/31/1899 0:00 YCAR590 B 25 Answer/Data Sheets CAW 0 12/31/1899 0:00 YCAR60D B 106.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR610 B 25 Answer/Data Sheets CAW 0 12/31/1899 0:00 YCAR70D B 29.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR80D B 106.5 QuikScore Form CAA 0 1/1/1998 0:00 yCAR90D B 30.5 QuikScore Form CAA 0 1/1/1998 0:00 yCARS0C B 47.25 Specimen Set CAA 1 1/1/1998 0:00 yCASEK B 219 Kit CAE 0 12/20/2001 0:00 YCASEM B 51 Manual CAE 0 12/20/2001 0:00 YCASEP B 27.5 Profiles CAE 0 12/20/2001 0:00 YCASERB B 27.5 Interview Guide/Bklt CAE 0 12/20/2001 0:00 YCASERS B 49.5 Answer/Data Sheets CAE 0 12/20/2001 0:00 YCASESB B 27.5 Interview Guide/Bklt CAE 0 12/20/2001 0:00 YCASESS B 49.5 Answer/Data Sheets CAE 0 12/20/2001 0:00 YCBS1R0 A 57.5 Book CBS 0 12/28/2000 0:00 YCBT1R0 A 66 Book CBT 0 12/28/2000 0:00 YCC100A A 22.95 Book CCI 0 1/1/1988 0:00 NCCM1R0 A 52.95 Book CCM 0 12/20/2001 0:00 YCCU1R0 A 21.95 Book CCS 0 12/28/2000 0:00 NCD1F3A B 295 SW DOS CDE 0 1/1/1988 0:00 NCD1MAA B 350 SW - Macintosh CDE 0 1/1/1988 0:00 NCD1O3H B 0 SW DOS CDI 0 1/1/1995 0:00 NCD1OPH B 0 SW DOS CDI 1 1/1/1995 0:00 NCD1P0A B 22 Answer/Data Sheets CDE 0 1/1/1988 0:00 YCD1R0A A 43.95 Book CLD 0 1/1/1988 0:00 NCD1S0D B 42 Specimen Set CDI 1 1/1/1993 0:00 YCD1W3A B 350 SW 16Bit CDE 0 1/1/1996 0:00 NCD2D3F B 35 SW DOS CDI 1 1/1/1995 0:00 NCD2F3E B 145 SW DOS CDI 0 1/1/1995 0:00 NCD2P0C B 31.5 QuikScore Form CDI 0 1/1/1991 0:00 YCD2PSC B 1 QuikScore Form CDI 0 1/1/1991 0:00 NCD2W3F B 350 SW 16Bit CDE 0 9/1/2000 0:00 YCD3CVR 0 Misc 0 12/31/1899 0:00CD3F3E B 260 SW DOS CDI 0 1/1/1995 0:00 NCD3P0B B 43 Manual CDI 0 1/1/1992 0:00 YCD4P0A B 63 Kit CDI 0 1/1/1992 0:00 YCD5P0C B 29.5 QuikScore Form CDI 0 1/1/1993 0:00 YCD5PSC B 1 QuikScore Form CDI 0 1/1/1993 0:00 NCD6P0A B 91 Kit CDI 0 1/1/1993 0:00 YCD7P0A B 57.75 Kit CDI 0 1/1/1993 0:00 YCD8P0C B 112.5 QuikScore Form CDI 0 1/1/1991 0:00 YCD9P0C B 108 QuikScore Form CDI 0 1/1/1993 0:00 YCDI10 B 29.5 Kit CDI 0 12/31/1899 0:00 YCDI11 B 108 Kit CDI 0 12/31/1899 0:00 YCDI20 B 29.5 Kit CDI 0 12/31/1899 0:00 YCDI21 B 108 Kit CDI 0 12/31/1899 0:00 YCDI22 B 137 Kit CDI 137 12/31/1899 0:00 1CDI23 B 85 Kit CDI 85 12/31/1899 0:00 1CDI24 B 51.5 Kit CDI 0 12/31/1899 0:00 1
CDI50 B 45 cdv 0 12/31/1899 0:00 1CDI51 B 1.5 cdv 0 12/31/1899 0:00 1CDI52 B 45 cdv 0 12/31/1899 0:00 1CDI53 B 82 Kit CDV 0 12/31/1899 0:00 1CDI54 B 25 Answer/Data Sheets CDV 0 12/31/1899 0:00 0CDI55 B 25 Answer/Data Sheets CDV 0 12/31/1899 0:00 0CDIF10 B 30 QuikScore Form CDI 0 12/31/1899 0:00 YCDIF20 B 95 QuikScore Form CDI 0 12/31/1899 0:00 YCDIF30 B 27 QuikScore Form CDI 0 12/31/1899 0:00 YCDIF40 B 95 QuikScore Form CDI 0 12/31/1899 0:00 YCDIF50 B 55 Kit CDI 0 12/31/1899 0:00 NCDIMNB B 0 Manual CDI 0 1/1/1995 0:00 NCDIP0L B 25 Answer/Data Sheets CDI 0 1/1/1997 0:00 YCDIS0L B 25 Answer/Data Sheets CDI 0 1/1/1998 0:00 YCDIS2J B 112.5 QuikScore Form CDI 0 12/31/1899 0:00 YCDIS30 B 29.5 QuikScore Form CDI 0 12/31/1899 0:00 YCDIS40 B 108 QuikScore Form CDI 0 12/31/1899 0:00 YCDIS50 B 55 Kit CDI 0 8/20/1999 0:00 NCDIS60 B 75 Kit CDI 0 8/20/1999 0:00 NCDR10A A 65 Report Paper SHR 0 5/25/2000 0:00 YCDS001 B 0 Manual CDS 0 12/31/1899 0:00 YCDS002 B 3 Refreshers CDS 0 12/31/1899 0:00 YCDS003 B 1.5 Refreshers CDS 0 12/31/1899 0:00 YCDS004 B 45 SW 16Bit CDS 0 12/31/1899 0:00 YCDS005 B 25 Answer/Data Sheets CDS 0 12/31/1899 0:00 YCDS006 B 25 Answer/Data Sheets CDS 0 12/31/1899 0:00 YCDS10C B 31.5 QuikScore Form CDI 0 1/1/1988 0:00 YCDS20B B 49.5 Manual CDS 0 1/1/1998 0:00 yCDS2CVR B 0 Manual CDS 0 1/1/1998 0:00 0CDS30C B 36.75 QuikScore Form CDS 0 1/1/1998 0:00 yCDS40C B 132.5 QuikScore Form CDS 0 1/1/1998 0:00 yCDS60C B 29.5 QuikScore Form CDS 0 1/1/1998 0:00 yCDS70C B 106 QuikScore Form CDS 0 1/1/1998 0:00 yCDS8SD B 59.95 Specimen Set CDS 1 1/1/1998 0:00 yCDSCVR B 0 Misc. CDS 0 12/31/1899 0:00 NCDSF3C B 0 QuikScore Form CDS 0 12/31/1899 0:00 NCDSF4C B 0 QuikScore Form CDS 0 12/31/1899 0:00 NCDSF6C B 0 QuikScore Form CDS 0 12/31/1899 0:00 NCDSF7C B 0 QuikScore Form CDS 0 12/31/1899 0:00 NCDSK1A B 97.5 Kit CDS 0 1/1/1998 0:00 yCDSK2A B 69.25 Kit CDS 0 1/1/1998 0:00 YCDSK30 B 74.5 Kit CDS 0 12/31/1899 0:00 YCE1F3A A 100 SW DOS CER 0 1/1/1989 0:00 NCE1O3A A 0 SW DOS CER 0 1/1/1989 0:00 NCE2R0A A 77 Book CCH 0 1/1/1988 0:00 YCG1A0A A 39 Book SCB 0 1/1/1996 0:00 YCG1R0A A 59.95 Book CGN 0 1/1/1988 0:00 NCG2A0B A 59 Audio SCA 0 1/1/1997 0:00 YCGIPR0 A 65 Book CGI 0 12/4/1999 0:00 YCH1R0A A 60.5 Book CHP 0 1/1/1988 0:00 YCH1ROA A 54 Book CPW 0 1/1/1988 0:00 NCHI10A A 8.5 Pamphlet HEJ 0 12/31/1899 0:00 YCHI20A A 15 Pamphlet HEJ 0 12/31/1899 0:00 YCHI30A A 15 Pamphlet HEJ 0 12/31/1899 0:00 Y
CHI40A A 15 Pamphlet HEJ 0 12/31/1899 0:00 YCHI50A A 15 Pamphlet HEJ 0 12/31/1899 0:00 YCHI60A A 15 Pamphlet HEJ 0 12/31/1899 0:00 YCHI70A A 15 Pamphlet HEJ 0 12/31/1899 0:00 YCHIP30 B 50.5 Kit CHI 0 12/31/1899 0:00 YCHIP40 B 33 Manual CHI 0 12/31/1899 0:00 YCHIP50 B 33.5 Specimen Set CHI 1 12/31/1899 0:00 YCHIP60 B 25.25 QuikScore Form CHI 0 12/31/1899 0:00 YCHIP70 B 90.5 QuikScore Form CHI 0 12/31/1899 0:00 YCI0P10 B 71 Kit CIS 0 4/22/1999 0:00 YCI1D3H B 35 SW DOS CIS 1 1/1/1995 0:00 NCI1F3G B 160 SW DOS CIS 0 1/1/1993 0:00 NCI1MND B 0 Manual CIS 0 1/1/1998 0:00 NCI1O3I B 0 SW DOS CIS 0 1/1/1993 0:00 NCI1OPI B 0 SW DOS CIS 1 1/1/1993 0:00 NCI1P0A B 47.25 Kit CIS 0 1/1/1991 0:00 YCI1R0A A 51.75 Book CLI 0 1/1/1988 0:00 NCI20P0 B 25.25 QuikScore Form CIS 0 4/21/1999 0:00 yCI2F3G B 0 SW DOS CIS 0 1/1/1991 0:00 NCI2P0E B 25.25 QuikScore Form CIS 0 1/1/1991 0:00 yCI2PSE B 1 QuikScore Form CIS 0 1/1/1991 0:00 NCI2R0A A 51.75 Book CLI 0 1/1/1988 0:00 NCI2S0C B 31.5 Specimen Set CIS 1 1/1/1991 0:00 yCI3P0D B 28.5 Manual CIS 0 1/1/1991 0:00 yCI4P0B B 47.25 Kit CIS 0 1/1/1991 0:00 yCI5P0F B 25.25 QuikScore Form CIS 0 1/1/1991 0:00 yCI5PSF B 1 QuikScore Form CIS 0 1/1/1991 0:00 NCI6P0L B 24 QuikScore Form CIS 0 1/1/1998 0:00 NCI7P0L B 24 QuikScore Form CIS 0 1/1/1998 0:00 NCI8P0M B 24 QuikScore Form CIS 0 1/1/1998 0:00 NCI9P0M B 24 QuikScore Form CIS 0 1/1/1998 0:00 NCIE1R0 A 49.5 Book CIE 0 12/28/2000 0:00 YCIF100 B 24 QuikScore Form CIS 0 9/30/1999 0:00 NCIF200 B 80 QuikScore Form CIS 0 9/30/1999 0:00 NCIF300 B 24 QuikScore Form CIS 0 9/30/1999 0:00 NCIF400 B 80 QuikScore Form CIS 0 9/30/1999 0:00 NCIJAPJ B 0 QuikScore Form CIS 0 1/1/1997 0:00 NCISS10 B 0 Mail-In CM2 0 12/31/1899 0:00 NCL1F3A A 195 SW DOS CLA 0 1/1/1994 0:00 NCL1O3H A 0 SW DOS CLA 0 1/1/1994 0:00 NCL1OPB A 0 SW DOS CLA 1 1/1/1994 0:00 NCL2F3A A 895 SW DOS CLA 0 1/1/1994 0:00 NCL3D3B A 25 SW DOS CLA 1 1/1/1994 0:00 NCL4F3C A 0 SW DOS CLA 0 1/1/1994 0:00 NCLA00E A 0 Manual CLA 0 1/1/1994 0:00 NCLES10 B 41 Manual CLE 0 12/31/1899 0:00 YCLES20 B 31.5 QuikScore Form CLE 0 12/31/1899 0:00 YCLES30 B 31.5 QuikScore Form CLE 0 12/31/1899 0:00 YCLES40 B 31.5 QuikScore Form CLE 0 12/31/1899 0:00 YCLES50 B 120 Kit CLE 0 12/31/1899 0:00 YCLES60 B 40 Specimen Set CLE 1 12/31/1899 0:00 YCLMR10 A 137.5 Kit CAL 0 12/31/1899 0:00 YCLMR20 A 115.5 Manual CAL 0 12/31/1899 0:00 YCLMR30 A 77 Workbook/Worksheet CAL 0 12/31/1899 0:00 Y
CLMR40 A 22 Misc. CAL 0 12/31/1899 0:00 YCLMR50 A 22 Misc. CAL 0 12/31/1899 0:00 YCMCD10 B 0 SW 16Bit CMP 0 4/28/1999 0:00 yCMCDSLKSCR 0 Misc. 0 12/31/1899 0:00 0CMDQ0A A 28.5 Interview Guide/Bklt CMR 0 1/1/1994 0:00 YCMDQ2A A 94.5 Interview Guide/Bklt CMR 0 1/1/1994 0:00 yCMDQ3 B 27 Answer/Data Sheets CMR 0 4/18/2002 0:00 YCMDQ4 B 90 Answer/Data Sheets CMR 0 4/18/2002 0:00 YCMDS20 B 0 SW 16Bit CMP 0 4/28/1999 0:00 yCMQSCVR 0 Misc 0 12/31/1899 0:00 NCN1P0A B 37.5 Kit CNQ 0 1/1/1988 0:00 NCN1R0A A 82.5 Book CNI 0 1/1/1988 0:00 NCNE1R A 82.5 Book ADO 0 12/31/1899 0:00 1CNTR0A A 76.95 Book CNT 0 12/31/1899 0:00 YCOCRDS B 0 Online Use COS 0 12/31/1899 0:00 1CONMCVR 0 Misc. 0 12/31/1899 0:00 0CONMMM B 45 Manual CRS 0 1/1/1997 0:00 NCONMNM B 35 Manual CRO 0 1/1/1996 0:00 NCONSUA A 0 Consulting ACS 0 1/1/1997 0:00 NCOPRDS B 0 Online Use COS 0 12/31/1899 0:00 1COR010 A 0 Manual CMP 0 4/5/1999 0:00 YCOTRDS B 0 Online Use COS 0 12/31/1899 0:00 1COUR1A 0 Freight NON 0 12/31/1899 0:00 NCP10PL B 109 Feedback CRO 0 1/1/1990 0:00 NCP11PK B 30.5 Feedback CRO 0 1/1/1990 0:00 yCP12PK B 110 Feedback CRO 0 1/1/1990 0:00 NCP13PA B 16 Answer/Data Sheets CPA 0 1/1/1988 0:00 NCP14PA B 21 Test Booklet CPA 0 1/1/1988 0:00 NCP1D3O B 35 SW DOS CSW 0 1/1/1995 0:00 NCP1E25 B 100 SW DOS CSW 0 1/1/1995 0:00 NCP1F3N B 145 SW DOS CSW 0 1/1/1989 0:00 NCP1O3L B 0 SW DOS CSW 0 1/1/1993 0:00 NCP1OPL B 0 SW DOS CSW 0 1/1/1993 0:00 NCP1PSA B 0 Kit CRO 0 1/1/1996 0:00 NCP1R0A A 425 Book CPP 0 1/1/1988 0:00 YCP2D3B B 35 SW DOS CPT 0 1/1/1995 0:00 NCP2F3A B 495 SW DOS CPT 0 1/1/1996 0:00 NCP2G3C B 250 Upgrade CPT 0 1/1/1996 0:00 NCP2N3B B 460 SW Unlock CPT 0 1/1/1993 0:00 NCP2O3D B 0 SW DOS CPT 0 1/1/1996 0:00 NCP2OPD B 0 SW DOS CPT 0 1/1/1996 0:00 NCP2PSB B 60 Kit CRO 0 1/1/1988 0:00 NCP3F3N B 260 SW DOS CSW 0 1/1/1993 0:00 NCP400N B 1100 SW DOS CSW 0 1/1/1995 0:00 NCP4F3A B 20 SW DOS CPA 0 1/1/1988 0:00 NCP4P0M B 38.5 Manual CRO 0 1/1/1989 0:00 NCP5F3A B 190 SW DOS CPA 0 1/1/1988 0:00 NCP5P0H B 30.5 QuikScore Form CRO 0 1/1/1989 0:00 yCP5PSH B 1 QuikScore Form CRO 0 1/1/1989 0:00 NCP6F3A B 425 SW DOS CPA 0 1/1/1988 0:00 NCP6P0H B 109 QuikScore Form CRO 0 1/1/1989 0:00 NCP7F3A B 800 SW DOS CPA 0 1/1/1988 0:00 NCP7P0H B 30.5 QuikScore Form CRS 0 1/1/1989 0:00 NCP7PSH B 1 QuikScore Form CRO 0 1/1/1989 0:00 N
CP8F3A B 1500 SW DOS CPA 0 1/1/1988 0:00 NCP8P0G B 110 QuikScore Form CRO 0 1/1/1989 0:00 YCP9F3A B 295 Refreshers CPA 0 1/1/1988 0:00 NCP9P0K B 30.5 Feedback CRO 0 1/1/1990 0:00 yCPBATA B 0 Refreshers CPA 0 1/1/1988 0:00 NCPBR0A B 12 Reports CPA 0 1/1/1988 0:00 NCPS10H B 30.5 QuikScore Form CRO 0 1/1/1995 0:00 yCPS20H B 104 QuikScore Form CRO 0 1/1/1995 0:00 NCPS30G B 30.5 QuikScore Form CRO 0 1/1/1995 0:00 yCPS40G B 104 QuikScore Form CRO 0 1/1/1995 0:00 NCPT2CVR 0 Misc 0 12/31/1899 0:00 NCPTM0E B 35 Manual CPT 0 1/1/1988 0:00 NCPTS10 B 125 SW 16Bit CPT 0 12/31/1899 0:00 NCPTSFD B 0 SW DOS CPT 0 5/2/2000 0:00 NCPTUSE B 45 SW 16Bit CPT 0 10/22/2001 0:00 NCPTW01 B 495 SW 16Bit CPT 0 12/31/1899 0:00 NCPTW02 B 290 SW 16Bit CPT 0 12/31/1899 0:00 NCPTW20 B 45 SW 16Bit CPT 0 12/31/1899 0:00 YCPTW30 B 495 SW 16Bit CPT 0 12/31/1899 0:00 YCPTW40 B 535 SW 16Bit CPT 0 12/31/1899 0:00 YCPTW50 B 675 SW 16Bit CPT 0 12/31/1899 0:00 YCPTW60 B 235 SW 16Bit CPT 0 12/31/1899 0:00 YCPTW7 B 595 SW 16Bit CPT 0 12/31/1899 0:00 0CPTW8 B 45 SW 16Bit CPT 0 12/31/1899 0:00 0CPTWM0 B 0 SW 16Bit CPT 0 12/31/1899 0:00 NCR1P0A B 180 Kit CRE 0 1/1/1988 0:00 NCR2P0A B 48.5 Manual CRE 0 1/1/1988 0:00 NCR3P0A B 61.5 Admin. Material CRE 0 1/1/1988 0:00 NCR4P0A B 37.5 Answer/Data Sheets CRE 0 1/1/1988 0:00 NCR5P0A B 37.5 Answer/Data Sheets CRE 0 1/1/1988 0:00 NCRE1R0 A 27.5 Book CRV 0 12/31/1899 0:00 YCRF01G B 29 QuikScore Form CRS 0 12/31/1899 0:00 YCRF02G B 104 QuikScore Form CRS 0 12/31/1899 0:00 YCRF03H B 27 QuikScore Form CRS 0 12/31/1899 0:00 YCRF04H B 97 QuikScore Form CRS 0 12/31/1899 0:00 YCRF05E B 29 QuikScore Form CRS 0 12/31/1899 0:00 YCRF06E B 104 QuikScore Form CRS 0 12/31/1899 0:00 YCRF07F B 27 QuikScore Form CRS 0 12/31/1899 0:00 YCRF08F B 97 QuikScore Form CRS 0 12/31/1899 0:00 YCRF09Y B 29 QuikScore Form CRS 0 12/31/1899 0:00 NCRF10Y B 104 QuikScore Form CRS 0 12/31/1899 0:00 NCRF11Z B 27 QuikScore Form CRS 0 12/31/1899 0:00 NCRF12Z B 97 QuikScore Form CRS 0 12/31/1899 0:00 NCRF13A B 193 QuikScore Form CRS 0 12/31/1899 0:00 YCRF14D B 59 Specimen Set CRS 0 12/31/1899 0:00 YCRF15K B 25 Feedback CRS 0 12/31/1899 0:00 YCRF16K B 90 Feedback CRS 0 12/31/1899 0:00 YCRF17K B 25 Feedback CRS 0 12/31/1899 0:00 YCRF18K B 90 Feedback CRS 0 12/31/1899 0:00 YCRF19I B 25 Feedback CRS 0 12/31/1899 0:00 YCRF20I B 90 Feedback CRS 0 12/31/1899 0:00 YCRF21I B 25 Feedback CRS 0 12/31/1899 0:00 YCRF22I B 90 Feedback CRS 0 12/31/1899 0:00 YCRF232 B 25 Feedback CRS 0 12/31/1899 0:00 N
CRF242 B 90 Feedback CRS 0 12/31/1899 0:00 NCRF25I B 25 Feedback CRS 0 12/31/1899 0:00 NCRF26I B 90 Feedback CRS 0 12/31/1899 0:00 NCRF27J B 134 Feedback CRS 0 12/31/1899 0:00 NCRF280 B 0 Answer/Data Sheets CRS 0 12/31/1899 0:00 YCRF290 B 0 Answer/Data Sheets CRS 0 12/31/1899 0:00 YCRF300 B 0 Answer/Data Sheets CRS 0 12/31/1899 0:00 YCRF310 B 0 Answer/Data Sheets CRS 0 12/31/1899 0:00 YCRF320 B 0 Answer/Data Sheets CRS 0 12/31/1899 0:00 YCRF330 B 0 Answer/Data Sheets CRS 0 12/31/1899 0:00 YCRF340 B 27 QuikScore Form CRS 0 12/31/1899 0:00 YCRF350 B 27 QuikScore Form CRS 0 12/31/1899 0:00 YCRF360 B 27 QuikScore Form CRS 0 12/31/1899 0:00 YCRF370 B 97 QuikScore Form CRS 0 12/31/1899 0:00 YCRF380 B 27 QuikScore Form CRS 0 12/31/1899 0:00 YCRF390 B 97 QuikScore Form CRS 0 12/31/1899 0:00 YCRF400 B 27 QuikScore Form CRS 0 12/31/1899 0:00 YCRF410 B 97 QuikScore Form CRS 0 12/31/1899 0:00 YCRI1PB A 65 Book CRI 0 1/1/1997 0:00 YCRP01K B 26.25 Feedback CRS 0 12/31/1899 0:00 yCRP02K B 94.5 Feedback CRS 0 12/31/1899 0:00 yCRP03K B 26.25 Feedback CRS 0 12/31/1899 0:00 yCRP04K B 94.5 Feedback CRS 0 12/31/1899 0:00 yCRP05I B 26.25 Feedback CRS 0 12/31/1899 0:00 yCRP06I B 94.5 Feedback CRS 0 12/31/1899 0:00 yCRP07I B 26.25 Feedback CRS 0 12/31/1899 0:00 yCRP08I B 94.5 Feedback CRS 0 12/31/1899 0:00 yCRP091 B 26.25 Feedback CRS 0 12/31/1899 0:00 yCRP101 B 94.5 Feedback CRS 0 12/31/1899 0:00 yCRP112 B 26.25 Feedback CRS 0 12/31/1899 0:00 yCRP122 B 94.5 Feedback CRS 0 12/31/1899 0:00 yCRP13J B 0 Feedback CRS 0 12/31/1899 0:00 NCRS01A B 151 Kit CRS 0 1/1/1997 0:00 yCRS02J B 241.5 Kit CRS 0 1/1/1997 0:00 yCRS03C B 118 Kit CRS 0 1/1/1997 0:00 yCRS040 B 124 Manual CRS 0 10/22/1999 0:00 NCRS05B B 118 Kit CRS 0 1/1/1997 0:00 yCRS06A B 220 Reorder Kit CRS 0 1/1/1997 0:00 NCRS07A B 446.25 Kit CRS 0 1/1/1997 0:00 NCRS08D B 62 Specimen Set CRS 0 1/1/1997 0:00 yCRS09M B 51 Manual CRS 0 1/1/1997 0:00 yCRS100 B 120 SW 16Bit CRS 0 12/31/1899 0:00 1CRS10M B 33 Manual CRS 0 1/1/1997 0:00 yCRS11G B 30.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS12G B 110 QuikScore Form CRS 0 1/1/1997 0:00 yCRS13H B 28.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS14H B 102 QuikScore Form CRS 0 1/1/1997 0:00 yCRS15E B 30.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS16E B 110 QuikScore Form CRS 0 1/1/1997 0:00 yCRS17F B 28.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS18F B 102 QuikScore Form CRS 0 1/1/1997 0:00 yCRS19Y B 30.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS1RW A 28.25 Bibliography CRS 0 1/1/1996 0:00 YCRS20Y B 110 QuikScore Form CRS 0 1/1/1997 0:00 y
CRS21Z B 28.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS22Z B 102 QuikScore Form CRS 0 1/1/1997 0:00 yCRS23K B 26.25 Feedback CRS 0 1/1/1997 0:00 yCRS24K B 94.5 Feedback CRS 0 1/1/1997 0:00 yCRS25K B 26.25 Feedback CRS 0 1/1/1997 0:00 yCRS26K B 94.5 Feedback CRS 0 1/1/1997 0:00 yCRS27I B 26.25 Feedback CRS 0 1/1/1997 0:00 yCRS28I B 94.5 Feedback CRS 0 1/1/1997 0:00 yCRS29I B 26.25 Feedback CRS 0 1/1/1997 0:00 yCRS30I B 94.5 Feedback CRS 0 1/1/1997 0:00 yCRS311 B 26.25 Feedback CRS 0 1/1/1997 0:00 yCRS321 B 94.5 Feedback CRS 0 1/1/1997 0:00 yCRS332 B 26.25 Feedback CRS 0 1/1/1997 0:00 yCRS342 B 94.5 Feedback CRS 0 1/1/1997 0:00 yCRS354 B 28.25 QuikScore Form CRS 0 1/1/1997 0:00 YCRS364 B 101.95 QuikScore Form CRS 0 1/1/1997 0:00 YCRS374 B 28.25 QuikScore Form CRS 0 1/1/1997 0:00 yCRS384 B 101.95 QuikScore Form CRS 0 1/1/1997 0:00 yCRS394 B 28.25 QuikScore Form CRS 0 1/1/1997 0:00 yCRS404 B 101.95 QuikScore Form CRS 0 1/1/1997 0:00 yCRS414 B 28.25 Feedback CRS 0 1/1/1997 0:00 YCRS424 B 94.5 Feedback CRS 0 1/1/1997 0:00 YCRS434 B 28.25 Feedback CRS 0 1/1/1997 0:00 YCRS444 B 94.5 Feedback CRS 0 1/1/1997 0:00 YCRS454 B 28.25 Feedback CRS 0 1/1/1997 0:00 YCRS464 B 94.5 Feedback CRS 0 1/1/1997 0:00 YCRS473 B 28.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS483 B 28.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS493 B 25 Profiles CRS 0 1/1/1997 0:00 yCRS503 B 91 Kit CRS 0 1/1/1997 0:00 yCRS51J B 140 Feedback CRS 0 1/1/1997 0:00 NCRS52A B 203 Kit CRS 0 1/1/1997 0:00 yCRS533 B 73.5 Reorder Kit CRS 0 1/1/1998 0:00 yCRS54 B 1.5 SW Refresher CSW 0 12/31/1899 0:00 YCRS55 B 3 SW Refresher CSW 0 12/31/1899 0:00 YCRS56 B 0 Manual CSW 0 12/31/1899 0:00 0CRS56CVR B 0 Manual 0 12/31/1899 0:00 0CRS57 B 45 SW 16Bit CSW 0 12/31/1899 0:00 1CRS58 B 0 Manual CSW 0 12/31/1899 0:00 NCRS59A B 28 QuikScore Form CRS 0 2/18/2003 0:00 YCRS60G B 30.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS61G B 110 QuikScore Form CRS 0 1/1/1997 0:00 yCRS62H B 28.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS63H B 102 QuikScore Form CRS 0 1/1/1997 0:00 yCRS64E B 30.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS65E B 110 QuikScore Form CRS 0 1/1/1997 0:00 yCRS66F B 28.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS67F B 102 QuikScore Form CRS 0 1/1/1997 0:00 yCRS68I B 30.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS69I B 110 QuikScore Form CRS 0 1/1/1997 0:00 yCRS70J B 28.5 QuikScore Form CRS 0 1/1/1997 0:00 yCRS71J B 102 QuikScore Form CRS 0 1/1/1997 0:00 yCRS72A B 203 Kit CRS 0 1/1/1998 0:00 yCRS73D B 62 Specimen Set CRS 0 1/1/1998 0:00 y
CRS74 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCRS75 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCRS76 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCRS77 B 25 Answer/Data Sheets CSW 0 12/31/1899 0:00 YCRS804 B 28.25 QuikScore Form CRS 0 1/1/1997 0:00 yCRS814 B 101.95 QuikScore Form CRS 0 1/1/1997 0:00 yCRS824 B 28.25 QuikScore Form CRS 0 1/1/1997 0:00 yCRS834 B 101.95 QuikScore Form CRS 0 1/1/1997 0:00 yCRS844 B 28.25 QuikScore Form CRS 0 1/1/1997 0:00 yCRS854 B 101.95 QuikScore Form CRS 0 1/1/1997 0:00 yCRS863 B 28.5 QuikScore Form CRS 0 1/1/1998 0:00 yCRS873 B 28.5 QuikScore Form CRS 0 1/1/1998 0:00 yCRS907 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRS917 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRS927 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRS937 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRS947 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRS957 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRS967 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 YCRS977 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 YCRS983 A 21 QuikScore Form CRS 0 1/1/1997 0:00 NCRS98A B 103 QuikScore Form CRS 0 12/31/1899 0:00 NCRS993 A 21 QuikScore Form CRS 0 1/1/1997 0:00 NCRSFLY B 0 Info Pak CSW 0 12/31/1899 0:00 0CRSK1 B 194.25 Kit CRS 0 7/16/2001 0:00 YCRSP10 B 4.75 Kit CRS 0 12/31/1899 0:00 0CRSP20 B 4.5 Kit CRS 0 12/31/1899 0:00 0CRSP30 B 0 Pamphlet CRS 0 12/31/1899 0:00CRSP40 B 0 Manual CRS 0 12/31/1899 0:00CRSPRO B 0 Info Pak CSW 0 12/31/1899 0:00 0CRSR01 B 54 Kit CSW 0 12/31/1899 0:00 1CRSR02 B 57 Kit CSW 0 12/31/1899 0:00 1CRSR03 B 1.5 Online Use CSW 0 12/31/1899 0:00 1CRSR04 B 3 Online Use CSW 0 12/31/1899 0:00 1CRSRCD B 0 Info Pak CSW 0 12/31/1899 0:00 0CRSS17 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRSS27 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRSS37 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 YCRSS47 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRSS57 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRSS67 B 25 Answer/Data Sheets CRS 0 1/1/1998 0:00 yCRSW01 B 1.5 Reports CSW 0 12/31/1899 0:00 1CRSW02 B 3 Reports CSW 0 12/31/1899 0:00 1CRSW03 B 47 Kit CSW 0 12/31/1899 0:00 1CRSW04 B 48 Kit CSW 0 12/31/1899 0:00 1CRSWNCVR 0 Misc 0 12/31/1899 0:00 0CRWWD1 B 0 SW 16Bit CRW 0 9/1/2000 0:00 NCRWWM1 B 0 Manual CRW 0 9/1/2000 0:00 NCS100A B 100 SW DOS STC 0 1/1/1989 0:00 NCS1A0A A 150 Audio CSA 0 1/1/1996 0:00 NCS1MNF B 0 Manual STC 0 1/1/1998 0:00 NCS1O3D B 0 SW DOS STC 0 1/1/1989 0:00 NCS1P0E B 70 Kit STC 0 1/1/1988 0:00 yCS1V0A A 225 Video CSA 0 1/1/1995 0:00 N
CS2P0C B 35 Answer/Data Sheets STC 0 1/1/1988 0:00 yCS2R0A A 20.95 Book CST 0 1/1/1988 0:00 YCSA01 B 0 SW 16Bit 0 12/31/1899 0:00 0CSA02 B 0 SW 16Bit 0 12/31/1899 0:00 0CSA03 B 0 SW 16Bit 0 12/31/1899 0:00 0CSA04 B 0 SW 16Bit 0 12/31/1899 0:00 0CSIMAA A 28.95 Book INM 0 1/1/1988 0:00 NCSQ010 C 0 Manual CSQ 0 12/31/1899 0:00 NCSQ020 C 15.5 Refreshers CSQ 0 12/31/1899 0:00 YCSQ030 C 55 SW 16Bit CSQ 0 12/31/1899 0:00 YCSQ04 C 25 Answer/Data Sheets CSQ 0 12/31/1899 0:00 1CSQ10A C 34 Interview Guide/Bklt CSQ 0 3/1/2001 0:00 YCSQ20A C 105 Interview Guide/Bklt CSQ 0 3/1/2001 0:00 YCSQ30A C 40 Manual CSQ 0 6/1/2001 0:00 YCSQ40A C 16.5 Mail-In CSQ 0 6/1/2001 0:00 YCSQ60A C 55 Kit CSQ 0 10/10/2001 0:00 1CSQTCHCVR 0 Misc 0 12/31/1899 0:00 0CSTD3 B 0 SW DOS STC 0 1/1/1989 0:00 0CSTF3 B 0 SW DOS STC 0 1/1/1988 0:00 NCSTOP B 0 SW DOS STC 0 1/1/1989 0:00 NCT10PI B 110 Feedback CRO 0 1/1/1990 0:00 NCT11PI B 30.5 Feedback CRO 0 1/1/1990 0:00 yCT12PI B 110 Feedback CRO 0 1/1/1990 0:00 NCT1MAA A 55 SW - Macintosh CLT 0 1/1/1988 0:00 YCT1R0A A 44 Book CLT 0 1/1/1988 0:00 YCT1W3A A 55 SW 16Bit CLT 0 1/1/1988 0:00 YCT2D3B C 45 SW DOS CAT 1 1/1/1995 0:00 YCT2F3A C 360 SW DOS CAT 0 1/1/1989 0:00 YCT2G3E C 50 Upgrade CAT 0 1/1/1988 0:00 NCT2MAA A 129.95 SW - Macintosh CLT 0 1/1/1996 0:00 NCT2N3C C 305 SW Unlock CAT 0 1/1/1995 0:00 NCT2O3D C 0 SW DOS CAT 0 1/1/1989 0:00 NCT2OPD C 0 SW DOS CAT 1 1/1/1989 0:00 NCT2W3A A 129.95 SW 16Bit CLT 0 1/1/1996 0:00 NCT300F C 0 Manual CAT 0 1/1/1989 0:00 NCT4P0F B 30.5 QuikScore Form CRO 0 1/1/1989 0:00 yCT4PSF B 1.05 QuikScore Form CRO 0 1/1/1989 0:00 NCT5P0F B 110 QuikScore Form CRO 0 1/1/1989 0:00 NCT6P0E B 30.5 QuikScore Form CRO 0 1/1/1989 0:00 yCT6PSE B 1 QuikScore Form CRO 0 1/1/1989 0:00 NCT7P0E B 110 QuikScore Form CRO 0 1/1/1989 0:00 NCT9P0I B 30.5 Feedback CRO 0 1/1/1990 0:00 yCTC1RA A 19.95 Book CTC 0 1/1/1988 0:00 0CTC20A A 79.25 Video CTC 0 1/1/1988 0:00 0CTCV0A A 65.95 Video CTC 0 1/1/1988 0:00 0CTMO0A B 44 Interview Guide/Bklt CTM 0 12/31/1899 0:00 YCTMO1A B 95 Kit CTM 0 12/31/1899 0:00 YCTMO2A B 54 Manual CTM 0 12/31/1899 0:00 YCTN1FA B 315 SW 16Bit CTO 0 1/1/1998 0:00 YCTO1PA B 320 Kit CTO 0 1/1/1988 0:00 YCTO2PA B 76 Manual CTO 0 1/1/1988 0:00 YCTO3PA B 48 Admin. Material CTO 0 1/1/1988 0:00 NCTO4PA B 48 Admin. Material CTO 0 1/1/1988 0:00 NCTO5PA B 48 Admin. Material CTO 0 1/1/1988 0:00 N
CTO6PA B 38.5 Answer/Data Sheets CTO 0 1/1/1988 0:00 YCTP1RA A 15.5 Book COG 0 1/1/1988 0:00 YCTS10F B 30.5 QuikScore Form CRO 0 1/1/1995 0:00 yCTS20F B 104 QuikScore Form CRO 0 1/1/1995 0:00 NCTS30E B 30.5 QuikScore Form CRO 0 1/1/1995 0:00 yCTS40E B 104 QuikScore Form CRO 0 1/1/1995 0:00 NCTT2PB C 47 Manual CLO 0 1/1/1995 0:00 yCTT3PE B 66 Admin. Material CLO 0 1/1/1995 0:00 yCTT4PC C 68.25 QuikScore Form CLO 0 1/1/1995 0:00 yCTT4SC C 65 QuikScore Form INF 0 1/1/1997 0:00 NCTT5PC C 245 QuikScore Form CLO 0 1/1/1995 0:00 yCTT6PD C 14 Profiles CLO 0 1/1/1995 0:00 yCTT7PD C 41 Profiles CLO 0 1/1/1995 0:00 yCTT8PA C 175 Kit CLO 0 1/1/1995 0:00 yCUSTXA A 8.5 Consulting EQI 0 1/1/1997 0:00 NCVS100 A 24 Book CVS 0 12/31/1899 0:00 NCW10PE A 0 Feedback CWP 0 1/1/1993 0:00 YCW11PJ A 0 Specimen Set CWP 0 1/1/1988 0:00 NCW1F3F A 0 SW DOS CWP 0 1/1/1988 0:00 NCW1O3I A 0 SW DOS CWP 0 1/1/1994 0:00 NCW1OFF A 0 SW DOS CWP 0 1/1/1994 0:00 NCW1OPI A 0 SW DOS CWP 0 1/1/1994 0:00 NCW1P0A A 0 Kit CWP 0 1/1/1993 0:00 YCW1PFA A 0 Kit CWP 0 1/1/1993 0:00 YCW2F3F A 0 SW DOS CWP 0 1/1/1994 0:00 NCW2P0B A 0 Manual CWP 0 1/1/1993 0:00 YCW3F3G A 0 SW DOS CWP 0 1/1/1996 0:00 NCW3O3G A 0 SW DOS CWP 0 1/1/1996 0:00 NCW3P0B A 0 Manual CWP 0 1/1/1993 0:00 YCW4D3H A 0 SW DOS CWP 0 1/1/1994 0:00 NCW4P0B A 0 Manual CWP 0 1/1/1993 0:00 YCW5P0C A 0 QuikScore Form CWP 0 1/1/1993 0:00 YCW5PFC A 0 QuikScore Form CWP 0 1/1/1993 0:00 NCW5PSC A 0 QuikScore Form CWP 0 1/1/1993 0:00 NCW5SFC A 0 QuikScore Form CWP 0 1/1/1993 0:00 NCW6P0C A 0 QuikScore Form CWP 0 1/1/1993 0:00 NCW7P0D A 0 Workbook/Worksheet CWP 0 1/1/1993 0:00 YCW7PSD A 0 Workbook/Worksheet CWP 0 1/1/1993 0:00 NCW8P0D A 0 Workbook/Worksheet CWP 0 1/1/1993 0:00 NCW9P0E A 0 Feedback CWP 0 1/1/1993 0:00 YCW9PSE A 0 Feedback CWP 0 1/1/1993 0:00 NCWFF3F A 0 SW DOS CWP 0 1/1/1994 0:00 NCWPIMB A 0 Manual CWP 0 1/1/1988 0:00 NDA1D3E B 35 SW DOS DAS 0 1/1/1995 0:00 NDA1F3D B 125 SW DOS DAS 0 1/1/1989 0:00 NDA1FAE B 125 SW - Macintosh DAS 0 1/1/1989 0:00 NDA1MNC B 0 Manual DAS 0 1/1/1998 0:00 NDA1O3F B 0 SW DOS DAS 0 1/1/1989 0:00 NDA1OAF B 0 SW - Macintosh DAS 0 1/1/1989 0:00 NDA1OPF B 0 SW DOS DAS 0 1/1/1989 0:00 NDA1P0A B 42 Kit DAS 0 1/1/1989 0:00 yDA1R0A A 32.95 Book DEV 0 1/1/1988 0:00 YDA1S0G B 23.1 Specimen Set DAS 0 1/1/1988 0:00 YDA2P0B B 30.45 QuikScore Form DAS 0 1/1/1989 0:00 y
DA2PSB B 1.3 QuikScore Form DAS 0 1/1/1989 0:00 NDA3P0C B 22 Manual DAS 0 1/1/1989 0:00 yDAB310 B 276 Kit DAB 0 12/24/2001 0:00 0DAB320 B 61 Profiles DAB 0 12/24/2001 0:00 0DAB330 B 44 Interview Guide/Bklt DAB 0 12/24/2001 0:00 0DATANA 0 Consulting NON 0 11/8/2002 0:00 0DC4R0A A 78.95 Book DRE 0 1/1/1988 0:00 YDCSCAN 0 Scoring Charges NON 0 12/31/1899 0:00 0DD3R0A A 13 Book DDI 0 1/1/1988 0:00 NDG1R0A A 65.5 Book DRE 0 1/1/1988 0:00 NDH1R0A A 46.95 Book DRE 0 1/1/1988 0:00 YDI1D3D B 45 SW DOS DCR 0 1/1/1995 0:00 NDI1F3A B 450 SW DOS DCR 0 1/1/1993 0:00 NDI1N3E B 450 SW Unlock DCR 0 1/1/1989 0:00 NDI1O3A B 0 SW DOS DCR 0 1/1/1995 0:00 NDI1OPA B 0 SW DOS DCR 0 1/1/1995 0:00 NDI2D3D B 45 SW DOS DCR 0 1/1/1995 0:00 NDI2F3B B 495 SW DOS DCR 0 1/1/1996 0:00 NDI2N3E B 405 SW Unlock DCR 0 1/1/1995 0:00 NDI2O3B B 0 SW DOS DCR 0 1/1/1995 0:00 NDI2OPB B 0 SW DOS DCR 0 1/1/1995 0:00 NDI3F3C B 825 SW DOS DCR 0 1/1/1993 0:00 NDII00G B 10 Manual DCR 0 1/1/1988 0:00 NDISCNT 0 None NON 0 12/31/1899 0:00 0DISKLABG 0 Misc. 0 12/31/1899 0:00 0DISKLABGEN 0 Misc. 0 12/31/1899 0:00 0DISKLABO 0 Misc. 0 12/31/1899 0:00 0DM1R0A A 43.95 Book DRE 0 1/1/1988 0:00 NDND00A B 0 Misc. CFA 0 1/1/1988 0:00 NDP2R0A A 167 Book DOP 0 1/1/1997 0:00 YDS5R0A A 93.5 Book DRE 0 1/1/1988 0:00 YDS6R0A A 71.95 Book DRE 0 1/1/1988 0:00 YDS7R0A A 39 Book DRE 0 1/1/1988 0:00 YDS8R0A A 35.95 Book DRE 0 1/1/1988 0:00 YDS9R3A A 119 SW DOS EDM 0 1/1/1988 0:00 NDS9RCD A 155 SW 16Bit EDM 0 12/31/1899 0:00 YDS9RMA A 119 SW - Macintosh EDM 0 1/1/1988 0:00 NDSMPC0 A 45 Book DPC 0 12/28/2000 0:00 NDT10PA B 44 Profiles DTL 0 1/1/1988 0:00 YDT11PA B 53 Admin. Material DTL 0 1/1/1988 0:00 NDT13RA A 31.95 Book DRE 0 1/1/1988 0:00 NDT16RA A 54.95 Book DRE 0 1/1/1988 0:00 NDT17PA B 23 Admin. Material DTL 0 1/1/1988 0:00 NDT18PA B 20 Admin. Material DTL 0 1/1/1988 0:00 NDT1D3A B 45 SW DOS DTR 0 1/1/1995 0:00 NDT1F3A B 395 SW DOS DTR 0 1/1/1989 0:00 NDT1N3C B 350 SW Unlock DTR 0 1/1/1989 0:00 NDT1O3A B 0 SW DOS DTR 0 1/1/1989 0:00 NDT1OPA B 0 SW DOS DTR 0 1/1/1989 0:00 NDT1R0A A 13.5 Book ANX 0 1/1/1988 0:00 NDT1UPM B 100 Upgrade DTR 0 1/1/1997 0:00 NDT2F3A B 395 SW DOS DTR 0 1/1/1989 0:00 NDT2O3G B 0 SW DOS DTR 0 1/1/1989 0:00 NDT2P0A B 48.5 Manual DTL 0 1/1/1988 0:00 N
DT3F3E B 795 SW DOS DTR 0 1/1/1989 0:00 NDT3P0A B 23 Answer/Data Sheets DTL 0 1/1/1988 0:00 NDT4F3F B 895 SW DOS DTR 0 1/1/1989 0:00 NDT4P0A B 43 Test Booklet DTL 0 1/1/1988 0:00 NDT5F3F B 1125 SW DOS DTR 0 1/1/1989 0:00 NDT5P0A B 23 Profiles DTL 0 1/1/1988 0:00 NDT7P0A B 180 Kit DTL 0 1/1/1988 0:00 YDT8F3A B 120 SW DOS DTL 0 1/1/1988 0:00 NDT8P0A B 48.5 Manual DTL 0 1/1/1988 0:00 NDT9P0A B 33 Answer/Data Sheets DTL 0 1/1/1988 0:00 YDTL1PA B 372 Kit DTL 0 1/1/1998 0:00 YDTL2PA B 27.5 Profiles DTL 0 1/1/1998 0:00 YDTL3PA B 49.5 Admin. Material DTL 0 1/1/1998 0:00 YDTL4PA B 27.5 Answer/Data Sheets DTL 0 1/1/1998 0:00 YDTL5PA B 89 Manual DTL 0 1/1/1998 0:00 YDTL6WA B 123 SW 16Bit DTL 0 1/1/1998 0:00 YDTRE2G B 0 Manual DTR 0 1/1/1988 0:00 NDTREECVR 0 Misc 0 12/31/1899 0:00 0DTREEG B 0 Manual DTR 0 1/1/1988 0:00 0DTS1PC B 59 Kit DTS 0 1/1/1996 0:00 yDTS2PA B 38.5 Manual DTS 0 1/1/1996 0:00 yDTS3PB B 26.25 QuikScore Form DTS 0 1/1/1996 0:00 yDTS4PB B 94.5 QuikScore Form DTS 0 1/1/1996 0:00 yDTS5PB B 40 Interview Guide/Bklt DTS 0 3/20/2000 0:00 YDTS6FB B 25 QuikScore Form DTS 0 1/1/1998 0:00 YDTS7FB B 90 QuikScore Form DTS 0 1/1/1998 0:00 YDTS8FC B 56 Kit DTS 0 1/1/1998 0:00 YDTS9FB B 38 Interview Guide/Bklt DTS 0 3/20/2000 0:00 YDTSP10 B 26.25 QuikScore Form DTS 0 10/12/1999 0:00 YDTSP20 B 94.5 QuikScore Form DTS 0 10/12/1999 0:00 YDTSP30 B 59 Kit DTS 0 12/31/1899 0:00 YDTSP40 B 40 Specimen Set DTS 0 12/31/1899 0:00 YDTV020 B 0 Answer/Data Sheets DTV 0 12/31/1899 0:00 NDTV030 B 0 Admin. Material DTV 0 12/31/1899 0:00 NDTVP10 B 196 Kit DTV 0 1/1/2001 0:00 YDUAD10 A 29.95 Book DDS 0 12/31/1899 0:00 YDUTC10 B 32 QuikScore Form PAN 0 12/31/1899 0:00DUTC20 B 90 Interview Guide/Bklt PAN 0 12/31/1899 0:00DW1R0A A 14.5 Book DAP 0 1/1/1988 0:00 YED2W00 B 0 SW 16Bit EDI 0 12/31/1899 0:00 0ED4P0A B 25 Answer/Data Sheets EDI 0 1/1/1988 0:00 NED7P0A B 105 Kit EDI 0 1/1/1988 0:00 NEDEIR0 A 587.5 Book EDE 0 12/28/2000 0:00 YEEW1R0 A 21.95 Book EEW 0 12/31/1899 0:00 YEFP1R0 A 34.95 Book EFP 0 12/28/2000 0:00 0EFPA10 A 38.5 Book EOF 0 12/31/1899 0:00 YEIC910 995 Workshop 0 12/31/1899 0:00 0EIED10 A 29.95 Book EIT 0 7/16/2001 0:00 YEIED20 A 65.95 Book EIE 0 12/20/2001 0:00 YEIP010 A 22 Book EIP 0 12/31/1899 0:00 NEIV010 A 99.95 Video EQI 0 12/31/1899 0:00 NEMA1P0 B 105 Kit EMA 0 12/28/2000 0:00 YEMA1R0 A 34.95 Book EMM 0 12/20/2001 0:00 YEMA2P0 B 53 Manual EMA 0 12/28/2000 0:00 Y
EMA3P0 B 32.5 QuikScore Form EMA 0 12/28/2000 0:00 YEMA4P0 B 32.5 QuikScore Form EMA 0 12/28/2000 0:00 YEMIAR A 0 Book MIL 0 12/31/1899 0:00 YEMP10B B 0 Answer/Data Sheets EMP 0 1/1/1996 0:00 NEMPS0A B 0 Answer/Data Sheets EMP 0 1/1/1996 0:00 NEMS100 B 44 Kit EMA 0 12/31/1899 0:00 YEMS200 B 21.5 Answer/Data Sheets EMA 0 12/31/1899 0:00 YEMS300 B 21.5 Profiles EMA 0 12/31/1899 0:00 YEMS400 B 11.5 Scoring Key/Material EMA 0 12/31/1899 0:00 YEMS500 B 27 Manual EMA 0 12/31/1899 0:00 YENCL00 A 0 Misc. INF 0 1/1/1988 0:00 NEOAS10 A 38.5 Book EOO 0 12/31/1899 0:00 YEOBA10 A 38.5 Book EOB 0 12/31/1899 0:00 YEONA10 A 38.5 Book EON 0 12/31/1899 0:00 1EQ1P0A B 90 Manual EQI 0 1/1/1997 0:00 0EQ1R0A A 24.95 Book EIT 0 1/1/1988 0:00 YEQ1W0W A 0 Workshop EQW 0 1/1/1997 0:00 NEQ1WRP A 0 Mail-In EQI 0 12/31/1899 0:00 NEQ2P0B B 44 Manual EQI 0 1/1/1997 0:00 YEQ2POBCVR B 0 Manual EQI 0 1/1/1997 0:00 0EQ2R0A A 16.95 Book EIT 0 1/1/1997 0:00 YEQ3601 B 210 Kit EQ3 0 12/31/1899 0:00 YEQ3602 B 150 Kit EQ3 0 12/31/1899 0:00 YEQ3603 B 42.9 Manual EQ3 0 12/31/1899 0:00 YEQ3603CVR B 0 EQ3 0 12/31/1899 0:00 0EQ3604 B 10.5 Interview Guide/Bklt EQ3 0 12/31/1899 0:00 YEQ3605 B 28.35 Interview Guide/Bklt EQ3 0 12/31/1899 0:00 YEQ3606 B 15.75 Answer/Data Sheets EQ3 0 12/31/1899 0:00 YEQ3607 B 28.35 Answer/Data Sheets EQ3 0 12/31/1899 0:00 YEQ3610 B 180 Kit EQ3 0 12/31/1899 0:00 YEQ3611 B 150 Online Use EQ3 0 12/31/1899 0:00 YEQ36DT B 329 Workshop E3W 0 12/31/1899 0:00 0EQ36IN 0 Workshop e3w 0 12/31/1899 0:00 0EQ36MT B 0 Workshop E3W 0 12/31/1899 0:00 0EQ36WSC B 0 Workshop E3W 0 12/31/1899 0:00 0EQ3INA 28.35 Workshop E3W 0 12/31/1899 0:00 0EQ3INN 28.35 Workshop E3W 0 12/31/1899 0:00 0EQ3INO 0 Workshop E3W 0 12/31/1899 0:00 0EQ3INS 28.35 Workshop E3W 0 12/31/1899 0:00 0EQ3P0C B 15 Manual EQI 0 1/1/1997 0:00 yEQ3R00 A 26.95 Book WEI 0 12/31/1899 0:00 YEQ4P0D B 55 Manual EQI 0 1/1/1997 0:00 yEQ4R00 A 15.95 Book WEI 0 12/31/1899 0:00 YEQ5P0E B 66 Manual EQI 0 1/1/1997 0:00 yEQ6P0F B 10.5 Test Booklet EQI 0 1/1/1997 0:00 yEQ7P0F B 28.35 Test Booklet EQI 0 1/1/1997 0:00 yEQ8P0F B 105 Test Booklet EQI 0 1/1/1997 0:00 yEQ9P0L B 35 Answer/Data Sheets EQI 0 1/1/1998 0:00 yEQCNS1 B 25 Misc EQW 0 4/18/2000 0:00 NEQDFX0 B 31.5 Mail-In EQI 0 9/20/1999 0:00 NEQDR0G B 29 Mail-In EQI 0 1/1/1997 0:00 yEQDT B 80 Kit EQI 0 1/14/2002 0:00 YEQED10 A 20.95 Book EQE 0 12/31/1899 0:00 NEQED20 A 14.95 Book EQE 0 9/12/2001 0:00 Y
EQF10F B 26.25 Test Booklet EQI 0 1/1/1998 0:00 YEQF200 B 17.25 Mail-In EQI 0 12/31/1899 0:00 YEQF2D0 B 29 Mail-In EQI 0 12/31/1899 0:00 YEQF2P B 27.5 Mail-In EQI 0 12/31/1899 0:00 YEQF2R0 B 36.75 Mail-In EQI 0 12/31/1899 0:00 YEQF5D0 B 0 Mail-In EQI 0 12/31/1899 0:00 0EQF5I0 B 0 Mail-In EQI 0 12/31/1899 0:00 0EQF5R0 B 0 Mail-In EQI 0 12/31/1899 0:00 0EQFPV0 B 68.25 Mail-In EQI 0 12/31/1899 0:00 0EQGRPG B 40 Reports EQI 0 12/31/1899 0:00 yEQI06222001 A 0 Workshop EQI 0 6/22/2001 0:00 0EQI200 B 0 QuikScore Form EQI 0 12/31/1899 0:00 0EQI201 B 35 Interview Guide/Bklt EQI 0 12/31/1899 0:00 YEQI33 B 10.5 Test Booklet EQ5 0 12/31/1899 0:00 1EQI34 B 26.25 Test Booklet EQ5 0 12/31/1899 0:00 1EQI35 B 105 Test Booklet EQ5 0 12/31/1899 0:00 1EQI36 B 17.25 Answer/Data Sheets EQ5 0 12/31/1899 0:00 1EQI37 B 29 Answer/Data Sheets EQ5 0 12/31/1899 0:00 1EQI38 B 36.75 Answer/Data Sheets EQ5 0 12/31/1899 0:00 1EQI39 B 35 SW Refresher EQI 0 12/31/1899 0:00 YEQI41 B 29 Admin. Material EQ5 0 12/31/1899 0:00 1EQI50 B 0 Manual EQV 0 2/6/2002 0:00 NEQI51 B 11.5 Refreshers EQV 0 2/6/2002 0:00 YEQI52 B 22.5 Refreshers EQV 0 2/6/2002 0:00 YEQI53 B 22.5 Refreshers EQV 0 2/6/2002 0:00 YEQI54 B 116 Kit EQV 0 2/6/2002 0:00 YEQI55 B 116 Kit EQV 0 2/6/2002 0:00 YEQI57 B 55 SW Refresher EQV 0 12/31/1899 0:00 YEQI58 B 55 SW Refresher EQV 0 12/31/1899 0:00 YEQI59 B 55 SW Refresher EQV 0 12/31/1899 0:00 YEQI60 B 55 SW Refresher EQV 0 12/31/1899 0:00 YEQI61 B 63 Answer/Data Sheets EQV 0 12/31/1899 0:00 YEQI62 B 63 Answer/Data Sheets EQV 0 12/31/1899 0:00 YEQI63 B 63 Answer/Data Sheets EQV 0 12/31/1899 0:00 YEQI64 B 63 Answer/Data Sheets EQV 0 12/31/1899 0:00 YEQI70 B 131.25 Kit EQI 0 5/28/2002 0:00 YEQI71 B 47.25 Specimen Set EQS 0 5/28/2002 0:00 YEQI72 B 44 Manual EQS 0 5/28/2002 0:00 YEQI73 B 99.75 Test Booklet EQS 0 1/31/2002 0:00 YEQI74 B 70 Kit EQI 0 12/31/1899 0:00 1EQI75 B 16.5 Online Use EQI 0 12/31/1899 0:00 1EQI80 B 290 Kit EQI 0 12/31/1899 0:00 0EQIAE0 B 0 Refreshers EQI 0 10/5/2001 0:00 0EQIAFG B 0 Reports EQI 0 1/1/1997 0:00 NEQIANO B 0 Misc. EQV 0 3/5/2002 0:00 NEQIBI0 B 10 Refreshers EQI 0 10/27/2000 0:00 NEQIBPG C 0 Misc. EQW 0 12/31/1899 0:00 1EQIDSD B 37.5 Online Use EQI 0 12/31/1899 0:00 1EQIDST B 1650 Kit EQW 0 12/31/1899 0:00 0EQIDU1 B 0 Misc. EQV 0 12/31/1899 0:00 0EQIDU2 B 0 Online Use EQI 0 12/31/1899 0:00 0EQIEN0 B 0 Misc. EQV 0 3/5/2002 0:00EQIFCCVR 0 Misc 0 12/31/1899 0:00 0EQIHB1 B 0 QuikScore Form EQI 0 9/17/2001 0:00
EQIINS 0 Workshop eqw 0 12/31/1899 0:00 0EQIMN0 B 0 Misc. EQV 0 3/5/2002 0:00EQINCH A 0 Info Pak EQI 0 1/1/1997 0:00 NEQINUH A 0 Info Pak EQI 0 1/1/1997 0:00 NEQIOR1 B 0 Online Use EQI 0 11/9/2000 0:00 NEQIRES B 12.6 Answer/Data Sheets EQI 0 12/31/1899 0:00 0EQIRFEE B 5 Online Use EQI 0 12/31/1899 0:00 0EQIRFX B 42 Mail-In EQI 0 9/20/1999 0:00 NEQIRRG B 36.75 Mail-In EQI 0 1/1/1998 0:00 YEQIRSD B 37.5 Online Use EQI 0 12/31/1899 0:00 1EQIS10 B 50 QuikScore Form EQI 0 3/13/2002 0:00 NEQISCOR b 0 SW Refresher eqi 0 12/31/1899 0:00 0EQISES B 150 None EQI 0 12/31/1899 0:00 0EQISFX B 21 Mail-In EQI 0 9/20/1999 0:00 NEQISN0 B 0 Misc. EQV 0 3/5/2002 0:00EQISQ1 B 21 QuikScore Form EQI 0 6/7/2000 0:00 NEQISRG B 17.25 Mail-In EQI 0 1/1/1988 0:00 yEQIT0G B 0 Reports EQI 0 1/1/1998 0:00 NEQIW01 B 1.5 Online Use EQY 0 12/31/1899 0:00 YEQIW02 B 34 Kit EQY 0 12/31/1899 0:00 YEQIWB1 B 50 Admin. Material EQW 0 4/18/2000 0:00 NEQIWB2 B 0 Admin. Material EQW 0 12/31/1899 0:00 0EQIWC1 C 10 Admin. Material EQW 0 4/18/2000 0:00 NEQIWM1 B 450 Kit EQI 0 8/16/2000 0:00 NEQOAUS B 0 Online Use EQI 0 12/31/1899 0:00 0EQOD B 27.5 Online Use EQI 0 1/23/2002 0:00 YEQODK0 B 82 SW Refresher EQI 0 12/31/1899 0:00 YEQODUN B 0 Misc. EQI 0 12/31/1899 0:00 0EQOENN B 0 Misc. EQI 0 12/31/1899 0:00 0EQOFIN B 0 Misc. EQI 0 12/31/1899 0:00 0EQOGA B 60 Online Use EQI 0 12/31/1899 0:00 1EQOGR B 40 Online Use EQI 0 12/31/1899 0:00 1EQOI B 16.5 Online Use EQI 0 1/23/2002 0:00 YEQOIA B 60 Online Use EQI 0 12/31/1899 0:00 1EQOIG B 60 Online Use EQI 0 12/31/1899 0:00 1EQOMIN B 0 Misc. EQI 0 12/31/1899 0:00 0EQOMXN B 0 Misc. EQI 0 12/31/1899 0:00 0EQORAW B 0 Online Use EQI 0 12/31/1899 0:00EQORB B 27.5 Online Use EQI 0 1/23/2002 0:00 YEQORC B 35 Online Use EQI 0 1/23/2002 0:00 0EQORK0 B 82 SW Refresher EQI 0 12/31/1899 0:00 YEQOSWN B 0 Online Use EQI 0 12/31/1899 0:00 0EQOTG B 60 Online Use EQI 0 12/31/1899 0:00 1EQPA0J B 5 Refreshers EQI 0 1/1/1997 0:00 NEQPPCVR 0 Misc 0 12/31/1899 0:00 0EQPRR B 27.5 Mail-In EQI 0 1/14/2002 0:00 YEQPV0K B 65 Mail-In EQI 0 1/1/1998 0:00 0EQRT B 85 Kit EQI 0 1/14/2002 0:00 YEQRV00 B 75 Mail-in EQI 0 1/17/2000 0:00 NEQS10F B 26.25 Test Booklet EQI 0 1/1/1998 0:00 yEQS20G B 17.25 Mail-In EQI 0 1/1/1998 0:00 yEQS2DG B 29 Mail-In EQI 0 1/1/1998 0:00 yEQS2P B 27.5 Mail-In EQI 0 1/14/2002 0:00 YEQS2RG B 36.75 Mail-In EQI 0 1/1/1998 0:00 y
EQS30F B 10.5 Test Booklet EQI 0 1/1/1998 0:00 NEQS40F B 105 Test Booklet EQI 0 1/1/1998 0:00 NEQS5D0 B 31.5 Answer/Data Sheets EQI 0 12/31/1899 0:00EQS5I0 B 21 Answer/Data Sheets EQI 0 12/31/1899 0:00EQS5R0 B 42 Answer/Data Sheets EQI 0 12/31/1899 0:00EQSPCV B 0 Admin. Material EQW 0 12/31/1899 0:00 0EQSWAJ B 0 SW 16Bit EQI 0 1/1/1997 0:00 NEQSWBJ B 8.1 Refreshers EQI 0 1/1/1997 0:00 NEQTECHCVR 0 Misc 0 12/31/1899 0:00 0EQTP B 150 Kit EQI 0 1/14/2002 0:00 YEQYS1 B 31.5 QuikScore Form EQY 0 4/25/2002 0:00 YEQYS2 B 110.25 QuikScore Form EQY 0 4/25/2002 0:00 YEQYS3 B 31.5 QuikScore Form EQY 0 4/25/2002 0:00 YEQYS4 B 110.25 QuikScore Form EQY 0 4/25/2002 0:00 YEQYS5 B 63 Kit EQY 0 4/25/2002 0:00 YEQYS6 B 99.75 Kit EQY 0 4/25/2002 0:00 YEQYV10 B 63 Kit EQY 0 12/31/1899 0:00 YEQYV21 B 44 Manual EQY 0 5/8/2000 0:00 YEQYV2CVR 0 Misc 0 12/31/1899 0:00 0EQYV30 B 31.5 QuikScore Form EQY 0 12/31/1899 0:00 YEQYV40 B 110.25 QuikScore Form EQY 0 12/31/1899 0:00 YEQYV50 B 47.25 Kit EQY 0 12/31/1899 0:00 YEQYV51 B 0 Manual EQY 0 12/31/1899 0:00 YEQYV52 B 1.5 Profiles EQY 0 12/31/1899 0:00 YEQYV53 B 45 Manual EQY 0 12/31/1899 0:00 YEQYV54 B 25 Answer/Data Sheets EQY 0 12/31/1899 0:00 YEQYV55 B 25 Answer/Data Sheets EQY 0 12/31/1899 0:00 YEQYV60 B 99.75 Kit EQY 0 12/31/1899 0:00 YEQYV70 B 31.5 Kit EQY 0 12/31/1899 0:00 YEQYV80 B 110.25 kit EQY 0 12/31/1899 0:00 YERA1R0 A 38.5 Book ESR 0 12/20/2001 0:00 YERPRDS B 0 Online Use ERS 0 12/31/1899 0:00 1ERYRDS B 0 Online Use ERS 0 12/31/1899 0:00 1ETP1R0 A 0 Book ETT 0 12/28/2000 0:00 NEUIA0A A 25 Audio EUG 0 1/1/1996 0:00 NEW1R00 A 43.95 Book EWC 0 12/31/1899 0:00 0EW2R00 A 32.95 Book EWC 0 1/23/2002 0:00 0EWA1R0 A 38.5 Book EWA 0 12/28/2000 0:00 YFA12PB B 29.5 QuikScore Form FAM 0 1/1/1992 0:00 yFA13PC B 29.5 QuikScore Form FAM 0 1/1/1992 0:00 yFA14PD B 29.5 QuikScore Form FAM 0 1/1/1992 0:00 yFA15PF B 25.25 Profiles FAM 0 1/1/1995 0:00 yFA15SF B 1.05 Profiles FAM 0 1/1/1995 0:00 NFA16PM B 46 Manual FAM 0 1/1/1988 0:00 yFA1GPH B 25.25 Profiles FAM 0 1/1/1996 0:00 YFA1P0A B 141.75 Kit FAM 0 1/1/1992 0:00 yFA1R0A A 38.5 Book FAS 0 1/1/1988 0:00 YFA2P0G B 49.5 Specimen Set FAM 0 1/1/1992 0:00 yFA3P0O B 20 Answer/Data Sheets FAM 0 1/1/1998 0:00 YFA4P0O B 20 Answer/Data Sheets FAM 0 1/1/1998 0:00 YFA5P0O B 20 Answer/Data Sheets FAM 0 1/1/1998 0:00 YFA7PSB B 0 QuikScore Form FAM 0 1/1/1988 0:00 NFA8PSC B 0 QuikScore Form FAM 0 1/1/1988 0:00 NFA9PSD B 0 QuikScore Form FAM 0 1/1/1988 0:00 N
FAB1PA B 63 Kit FAC 0 1/1/1996 0:00 yFAB1SD B 40 Specimen Set FAC 0 1/1/1996 0:00 yFAB2PB B 41 Manual FAC 0 1/1/1996 0:00 yFAB3PC B 31.5 QuikScore Form FAC 0 1/1/1996 0:00 yFAB3SE B 1.05 QuikScore Form FAC 0 1/1/1996 0:00 NFABCCVR 0 Misc 0 12/31/1899 0:00 0FABW01 B 1.5 Online Use FAC 0 12/31/1899 0:00 YFABW02 B 44 Kit FAC 0 12/31/1899 0:00 YFAF01B B 28 QuikScore Form FAM 0 12/31/1899 0:00 YFAF02C B 28 QuikScore Form FAM 0 12/31/1899 0:00 YFAF03D B 28 QuikScore Form FAM 0 12/31/1899 0:00 YFAF04I B 26 QuikScore Form FAM 0 12/31/1899 0:00 YFAF05J B 26 QuikScore Form FAM 0 12/31/1899 0:00 YFAF06K B 26 QuikScore Form FAM 0 12/31/1899 0:00 YFAM1PH B 136.5 Kit FAM 0 1/1/1995 0:00 yFAM2PI B 27.25 QuikScore Form FAM 0 1/1/1988 0:00 yFAM3PJ B 27.25 QuikScore Form FAM 0 1/1/1988 0:00 yFAM4PK B 27.25 QuikScore Form FAM 0 1/1/1988 0:00 yFAM5PH B 48.25 Specimen Set FAM 1 1/1/1996 0:00 yFAM6PO B 20 Answer/Data Sheets FAM 0 1/1/1998 0:00 YFAM7PO B 20 Answer/Data Sheets FAM 0 1/1/1998 0:00 YFAM8PO B 20 Answer/Data Sheets FAM 0 1/1/1998 0:00 YFAMNT B 10 SW Refresher FAM 0 4/3/2000 0:00 NFAS01B B 29.5 QuikScore Form FAM 0 12/31/1899 0:00 yFAS02C B 29.5 QuikScore Form FAM 0 12/31/1899 0:00 yFAS03D B 29.5 QuikScore Form FAM 0 12/31/1899 0:00 yFAS04I B 27.25 QuikScore Form FAM 0 12/31/1899 0:00 yFAS05J B 27.25 QuikScore Form FAM 0 12/31/1899 0:00 yFAS06K B 27.25 QuikScore Form FAM 0 12/31/1899 0:00 yFB1R0A A 26.5 Book FBN 0 1/1/1988 0:00 NFEJR0A A 40.5 Book FEJ 0 12/31/1899 0:00 YFMHA10 A 60.5 Book FMH 0 12/31/1899 0:00 YFR1R00 A 19.75 Book FRT 0 12/31/1899 0:00 NFREN10 B 32 QuikScore Form PAN 0 12/31/1899 0:00FREN20 B 90 Interview Guide/Bklt PAN 0 12/31/1899 0:00FRGT00 A 0 Freight FRG 0 12/31/1899 0:00 NFRMD10 A 0 Consulting FMD 0 12/31/1899 0:00 NFTT001 B 120.75 Kit FIT 0 12/31/1899 0:00 YFTT002 BOEI Product 41 Manual FIT 0 12/31/1899 0:00 YFTT002CVR BOEI Product 0 Manual FIT 0 12/31/1899 0:00 NFTT003 B 19.95 Admin. Material FIT 0 12/31/1899 0:00 YFTT004 B 69.3 Interview Guide/Bklt FIT 0 12/31/1899 0:00 YGADS10 B 98 Kit GAD 0 12/31/1899 0:00 YGADS20 B 57 Manual GAD 0 12/31/1899 0:00 YGADS30 B 43 Interview Guide/Bklt GAD 0 12/31/1899 0:00 YGAFMNB B 35 Manual GAF 0 1/1/1996 0:00 NGARS10 B 94.5 Kit GAR 0 12/24/2001 0:00 YGARS20 B 56 Manual GAR 0 12/24/2001 0:00 YGARS30 B 44 Interview Guide/Bklt GAR 0 12/24/2001 0:00 YGFP10K B 295 SW 16Bit PFC 0 1/1/1998 0:00 NGFP20K B 0 Manual GFP 0 12/31/1899 0:00 NGO1P0A B 173 Kit GRT 0 1/1/1988 0:00 NGO1R0A B 217 Kit GRT 0 6/28/2001 0:00 YGO2P0A B 48.5 Manual GRT 0 1/1/1988 0:00 N
GO2R0A B 79 Manual GRT 0 6/28/2001 0:00 YGO3P0A B 43 Admin. Material GRT 0 1/1/1988 0:00 NGO3R0A B 52 Admin. Material GRT 0 6/28/2001 0:00 YGO4P0A B 43 Answer/Data Sheets GRT 0 1/1/1988 0:00 NGO4R0A B 45 Answer/Data Sheets GRT 0 6/28/2001 0:00 YGO5P0A B 43 Answer/Data Sheets GRT 0 1/1/1988 0:00 NGO5R0A B 45 Answer/Data Sheets GRT 0 6/28/2001 0:00 YGSR2XA A 140 Biofeedback GSR 0 1/1/1988 0:00 NGSTCR0 A 0 None NON 0 12/31/1899 0:00 NGT1R0A A 21.5 Book PFC 0 1/1/1988 0:00 NHA1F3A A 595 SW DOS HED 0 1/1/1988 0:00 yHA1R0A A 71.5 Book HAD 0 1/1/1988 0:00 YHA2F3A A 495 SW DOS HED 0 1/1/1988 0:00 yHA3F3A A 1895 SW DOS HED 0 1/1/1988 0:00 NHA4F3A A 1895 SW DOS HED 0 1/1/1988 0:00 NHA5F3A A 2495 SW DOS PAU 0 1/1/1988 0:00 NHA6F3A A 2995 SW DOS PAU 0 1/1/1988 0:00 NHA7F3A A 1495 SW DOS HED 0 1/1/1988 0:00 NHAR2PA A 105 Book CNS 0 1/1/1988 0:00 YHAR4PA B 74 Answer/Data Sheets CNS 0 1/1/1988 0:00 YHAR7PA A 165 Book CNS 0 1/1/1998 0:00 YHC1R0A A 27.5 Book NCG 0 1/1/1988 0:00 NHD1R0A A 82.5 Book HDS 0 1/1/1988 0:00 NHDE1R A 82.5 Book ADO 0 12/31/1899 0:00 1HDI01 B 221 Kit HDI 0 12/31/1899 0:00 YHDI01A B 0 Manual HDI 0 12/31/1899 0:00 NHDI02 B 17 Test Booklet HDI 0 12/31/1899 0:00 YHDI02B B 0 Answer/Data Sheets HDI 0 12/31/1899 0:00 NHDI03 B 17 Test Booklet HDI 0 12/31/1899 0:00 YHDI04 B 41 QuikScore Form HDI 0 12/31/1899 0:00 YHDI05 B 41 QuikScore Form HDI 0 12/31/1899 0:00 YHDI06 B 30.5 QuikScore Form HDI 0 12/31/1899 0:00 YHDI07 B 115.5 QuikScore Form HDI 0 12/31/1899 0:00 YHDI08 B 30.5 QuikScore Form HDI 0 12/31/1899 0:00 YHDI09 B 115.5 QuikScore Form HDI 0 12/31/1899 0:00 YHDI10 B 52.5 Specimen Set HDI 0 12/31/1899 0:00 YHDI11 B 48.5 Manual HDI 0 12/31/1899 0:00 YHDI12 B 121 Kit HDI 0 12/31/1899 0:00 YHDI13 B 121 Kit HDI 0 12/31/1899 0:00 YHDICVR 0 Misc. 0 12/31/1899 0:00 0HDVI10 A 55 Book DVI 0 12/31/1899 0:00 1HE1D3A A 10 SW DOS HED 0 1/1/1988 0:00 yHE1F3A A 595 SW DOS HED 0 1/1/1988 0:00 NHE2F3A A 595 SW DOS HED 0 1/1/1988 0:00 NHE3F3A A 495 SW DOS HED 0 1/1/1988 0:00 NHE4F3A A 495 SW DOS HED 0 1/1/1988 0:00 NHE5F3A A 795 SW DOS HED 0 1/1/1988 0:00 NHE6F3A A 1495 SW DOS HED 0 1/1/1988 0:00 NHEAA0A A 29 Audio HEA 0 1/1/1998 0:00 yHEAB0B A 0 Audio HEA 0 1/1/1998 0:00 NHEAC0C A 0 Audio HEA 0 1/1/1998 0:00 NHEI1R0 A 82.5 Book EIT 0 10/30/2000 0:00 YHFP1R0 A 148.5 Book HFP 0 12/28/2000 0:00 YHJF1R A 82.5 Book FDO 0 12/31/1899 0:00 N
HOAT1R A 175 Book HOF 0 12/20/2001 0:00 YHPFRKT B 53 Kit HPS 0 12/31/1899 0:00 NHPFRSS B 33 Specimen Set HPS 0 12/31/1899 0:00 NHPS001 A 126 Kit 0 12/31/1899 0:00 0HPS002 A 25 0 12/31/1899 0:00 0HPS10A B 56 Kit HPS 0 1/1/1996 0:00 yHPS20B B 35.25 Manual HPS 0 1/1/1996 0:00 yHPS30C B 28.5 QuikScore Form HPS 0 1/1/1996 0:00 yHPS3FF B 27 QuikScore Form HPS 0 1/1/1998 0:00 NHPS3SC B 0 QuikScore Form HPS 0 1/1/1996 0:00 NHPS40D B 102 QuikScore Form HPS 0 1/1/1996 0:00 yHPS5SD B 34.5 Specimen Set HPS 0 1/1/1996 0:00 yHPS60 B 0 Manual HPS 0 12/31/1899 0:00 NHPS61 B 1.5 SW Refresher HPS 0 12/31/1899 0:00 YHPS62 B 45 SW 16Bit HPS 0 12/31/1899 0:00 YHPS63 B 25 Answer/Data Sheets HPS 0 4/26/2002 0:00 YHPS6CVR B 0 Misc. HPS 0 12/31/1899 0:00 NHPSICVR 0 Misc 0 12/31/1899 0:00HR1F3A C 125 SW DOS HER 0 1/1/1988 0:00 NHR1O3F C 0 SW DOS HER 0 1/1/1989 0:00 NHR3F3A B 449 SW DOS CNS 0 1/1/1988 0:00 NHR4F3A B 395 SW DOS CNS 0 1/1/1988 0:00 NHR5F3A C 645 SW DOS HER 0 1/1/1997 0:00 yHRC2R0 A 14.5 Book HRC 0 1/1/1997 0:00 YHRCATA A 0 Info Pak INF 0 1/1/1988 0:00 NHRINCA A 0 Info Pak INF 0 1/1/1997 0:00 NHRMANM C 35 Manual HER 0 1/1/1997 0:00 NHS1F3A A 595 SW DOS HED 0 1/1/1988 0:00 NHS2F3A A 495 SW DOS HED 0 1/1/1988 0:00 NHS3F3A A 795 SW DOS HED 0 1/1/1988 0:00 NHS6F3A A 595 SW DOS HED 0 1/1/1988 0:00 NHS7F3A A 495 SW DOS HED 0 1/1/1988 0:00 NHSC1R0 A 35 Book HSG 0 12/20/2001 0:00 0HSG00A A 40 Pamphlet HSG 0 1/1/1994 0:00 YHSG10A A 150 Pamphlet HSG 0 1/1/1994 0:00 yHSGF10 A 17 Book SSH 0 12/31/1899 0:00 0HT2F3A A 495 SW DOS HED 0 1/1/1988 0:00 yHT3F3A A 595 SW DOS HED 0 1/1/1988 0:00 yHT4F3A A 795 SW DOS HED 0 1/1/1988 0:00 yHT5F3A A 595 SW DOS HED 0 1/1/1988 0:00 yHT6F3A A 495 SW DOS HED 0 1/1/1988 0:00 yHV1R A 82.5 Book FDO 0 12/31/1899 0:00 NIAM20A A 99 Book INT 0 1/1/1997 0:00 YIC1P0B A 39.95 Workbook/Worksheet IBC 0 1/1/1995 0:00 YIC1V0A A 235 Video IBC 0 1/1/1995 0:00 YIC2P0B A 110 Workbook/Worksheet IBC 0 1/1/1995 0:00 YICPR0A A 31 Book PFC 0 1/1/1997 0:00 YICPSE0 A 43.95 Book IPS 0 12/20/2001 0:00 YICPSK0 A 43.95 Book CPS 0 12/20/2001 0:00 YICPSP0 A 43.95 Book ICP 0 12/20/2001 0:00 YICSAVA A 105 Video ICS 0 12/31/1899 0:00 YIE1F3A B 275 SW 16Bit IER 0 1/1/1988 0:00 NIE1FMA B 325 SW - Macintosh IER 0 1/1/1988 0:00 NIE1P0A B 22 Answer/Data Sheets IER 0 1/1/1988 0:00 Y
IE1W3A B 325 SW 16Bit IER 0 1/1/1996 0:00 NIE2W3F B 325 SW 16Bit IER 0 9/1/2000 0:00 YIEQ01A B 0 Manual IEQ 0 12/31/1899 0:00 NIEQ02B B 0 Answer/Data Sheets IEQ 0 12/31/1899 0:00 NIEQ03 B 199.5 Kit IEQ 0 12/31/1899 0:00 YIEQ04 B 57.75 Specimen Set IEQ 0 12/31/1899 0:00 YIEQ05 B 41 Manual IEQ 0 12/31/1899 0:00 YIEQ06 B 36.75 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ07 B 139 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ08 B 36.75 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ09 B 139 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ10 B 36.75 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ11 B 139 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ12 B 36.75 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ13 B 139 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ14 B 32.5 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQ15 B 123 QuikScore Form IEQ 0 12/31/1899 0:00 YIEQMNCVR 0 Misc 0 12/31/1899 0:00II2R10 A 55.95 Book IIB 0 12/20/2001 0:00 YII3R10 A 104.5 Book IIB 0 12/20/2001 0:00 YIN16PA A 0 Info Pak PFC 1 1/1/1997 0:00 NIN16UA A 0 Info Pak INF 0 1/1/1998 0:00 NINBBHI B 0 Reports BBH 0 1/1/1988 0:00 NINBHIM A 0 Info Pak INF 1 1/1/1997 0:00 NINBSIM A 0 Info Pak INF 0 1/1/1997 0:00 NINCAIG A 0 Info Pak INF 1 1/1/1997 0:00 NINCALF A 0 Info Pak INF 1 1/1/1998 0:00 yINCARA A 0 Info Pak INF 1 1/1/1997 0:00 yINCCVA A 0 Info Pak INF 1 1/1/1997 0:00 yINCDIM A 0 Info Pak INF 1 1/1/1997 0:00 yINCDS0 D 0 Info Pak INF 0 9/10/2001 0:00 0INCHIP D 0 Info Pak INF 0 9/10/2001 0:00 0INCIIC A 0 Info Pak INF 1 1/1/1997 0:00 yINCISG A 0 Info Pak INF 1 1/1/1997 0:00 NINCLAF A 0 Info Pak INF 1 1/1/1997 0:00 yINCLES D 0 Info Pak INF 0 9/10/2001 0:00 0INCMUJ A 0 Info Pak INF 1 1/1/1998 0:00 yINCPTN A 0 Info Pak INF 0 1/1/1997 0:00 yINCRR7 A 0 Info Pak INF 0 1/1/1997 0:00 yINCRV7 A 0 Info Pak INF 0 1/1/1997 0:00 NINCRW0 D 0 Info Pak INF 0 9/10/2001 0:00 0INCTUG A 0 Info Pak INF 1 1/1/1997 0:00 yINCWCG A 0 Info Pak INF 0 1/1/1997 0:00 NINDAUG A 0 Info Pak INF 0 1/1/1998 0:00 yINDICM A 0 Info Pak INF 0 1/1/1997 0:00 yINDSM0 D 0 Info Pak INF 0 9/10/2001 0:00 0INDTRP A 0 Info Pak INF 0 1/1/1997 0:00 yINDTUD A 0 Info Pak INF 0 1/1/1997 0:00 yINEQCL D 0 Info Pak INF 0 9/10/2001 0:00 0INF3UN A 0 Info Pak INF 0 1/1/1997 0:00 yINFAUF A 0 Info Pak INF 0 1/1/1998 0:00 yINGAFC A 0 Info Pak INF 0 1/1/1997 0:00 yINGAMG A 0 Info Pak INF 0 1/1/1997 0:00 NINHLPU B 0 Info Pak HEL 0 12/31/1899 0:00 N
INHPUE A 0 Info Pak INF 0 1/1/1997 0:00 yINHRCAT A 0 Info Pak INF 0 3/14/2002 0:00 0INISC1 B 0 Info Pak INF 0 5/16/2000 0:00 NINISS0 D 0 Info Pak INF 0 9/10/2001 0:00 0INJI0W A 0 Info Pak INF 0 1/1/1998 0:00 yINJIRB c 0 Info Pak INF 0 12/31/1899 0:00 0INKCPA A 0 Info Pak INF 0 1/1/1997 0:00 yINLAMB D 0 Info Pak INF 0 9/10/2001 0:00 0INLMUK A 0 Info Pak INF 0 1/1/1997 0:00 yINLSUM A 0 Info Pak INF 0 1/1/1997 0:00 yINMACM A 0 Info Pak INF 0 1/1/1997 0:00 NINMAPL A 0 Info Pak INF 0 1/1/1998 0:00 NINMASE A 0 Info Pak INF 0 1/1/1997 0:00 yINMBHJ A 0 Info Pak INF 0 1/1/1997 0:00 NINMCMJ A 0 Info Pak INF 0 1/1/1997 0:00 NINMM2O A 0 Info Pak INF 0 1/1/1997 0:00 NINMMAN A 0 Info Pak INF 0 1/1/1997 0:00 NINMSC B 0 Info Pak INF 0 12/31/1899 0:00 0INMTQH A 0 Info Pak INF 0 1/1/1998 0:00 NINO001 A 2.85 Online Use CWP 0 6/15/2001 0:00 NINP3CF A 0 Info Pak INF 0 1/1/1997 0:00 NINPAUG A 0 Info Pak INF 0 1/1/1997 0:00 yINPCUW A 0 Info Pak INF 0 1/1/1997 0:00 yINPCYV c 0 Info Pak INF 0 12/31/1899 0:00 0INPCYV0 c 0 Info Pak INF 0 12/31/1899 0:00 0INPDSH A 0 Info Pak INF 0 1/1/1997 0:00 yINPSHD A 0 Info Pak INF 0 1/1/1997 0:00 yINPSPK A 0 Info Pak INF 0 1/1/1997 0:00 yINPWUE A 0 Info Pak INF 0 1/1/1998 0:00 yINQLUK A 0 Info Pak INF 0 1/1/1998 0:00 yINS4UI A 0 Info Pak INF 0 1/1/1998 0:00 yINSARU A 0 Info Pak SAR 0 4/12/1999 0:00 NINSASR D 0 Info Pak INF 0 9/10/2001 0:00 0INSCLP A 0 Info Pak INF 0 1/1/1997 0:00 NINSET0 A 0 Info Pak SET 0 3/23/1999 0:00 NINSPSI D 0 Info Pak INF 0 9/10/2001 0:00 0INSPUF A 0 Info Pak INF 0 1/1/1997 0:00 yINSSPI A 0 Info Pak INF 0 1/1/1997 0:00 yINTCAI A 0 Info Pak INF 0 12/31/1899 0:00 1INTCAT A 0 Info Pak INF 0 12/31/1899 0:00 0INTMUE A 0 Info Pak INF 0 1/1/1997 0:00 yINTOL0 D 0 Info Pak INF 0 9/10/2001 0:00 0INVCO1 A 49.95 Admin. Material STO 0 12/31/1899 0:00INVICG A 0 Info Pak INF 0 1/1/1997 0:00 NIPD1R0 A 55 Book IPD 0 12/20/2001 0:00 0IPDR0A A 57 Book IPD 0 1/1/1998 0:00 NIR1R0A A 29.95 Book IRH 0 1/1/1988 0:00 YIS1R0A A 22.5 Book PFC 0 1/1/1988 0:00 NISS010 B 35.5 Manual ISS 0 5/11/1999 0:00 YISS020 B 28.5 Answer/Data Sheets ISS 0 5/11/1999 0:00 YISS030 B 20 Admin. Material ISS 0 12/31/1899 0:00 YISS040 B 77 Kit ISS 0 12/31/1899 0:00 YISS050 B 38 Specimen Set ISS 0 12/31/1899 0:00 YISSCVR 0 Misc 0 12/31/1899 0:00
ITA1RA A 66 Book IMP 0 1/1/1997 0:00 YJAD_VOL2 0 Journal JAD 0 12/31/1899 0:00 NJAD1RA A 55 Journal JAD 0 1/1/1996 0:00 NJAD2RB A 105 Journal JAD 0 1/1/1996 0:00 YJAD3RC A 15 Journal JAD 0 1/1/1996 0:00 NJADADV A 0 Journal JAD 0 11/12/2002 0:00 NJADB11 A 15 Journal JAD 0 12/31/1899 0:00 NJADB12 A 15 Journal JAD 0 12/31/1899 0:00 NJADB13 A 15 Journal JAD 0 12/31/1899 0:00 NJADB14 A 15 Journal JAD 0 12/31/1899 0:00 NJADB21 A 15 Journal JAD 0 12/31/1899 0:00 NJADB22 A 15 Journal JAD 0 12/31/1899 0:00 NJADB23 A 15 Journal JAD 0 12/31/1899 0:00 NJADB24 A 15 Journal JAD 0 12/31/1899 0:00 NJADB31 A 15 Journal JAD 0 12/31/1899 0:00 NJADB32 A 15 Journal JAD 0 12/31/1899 0:00 NJADB33 A 15 Journal JAD 0 12/31/1899 0:00 NJADB34 A 15 Journal JAD 0 12/31/1899 0:00 NJADB41 A 15 Journal JAD 0 12/31/1899 0:00 NJADB42 A 15 Journal JAD 0 12/31/1899 0:00 NJADB43 A 15 Journal JAD 0 12/31/1899 0:00 NJADB44 A 15 Journal JAD 0 12/31/1899 0:00 NJADB51 A 15 Journal JAD 0 12/31/1899 0:00 NJADB52 A 15 Journal JAD 0 12/31/1899 0:00 NJADB53 A 15 Journal JAD 0 12/31/1899 0:00 NJADB54 A 15 Journal JAD 0 4/23/2002 0:00 NJADB61 A 15 Journal JAD 0 6/20/2002 0:00 NJADB62 A 15 Journal JAD 0 6/20/2002 0:00 NJADB63 A 15 Journal JAD 0 6/20/2002 0:00 NJADB64 A 15 Journal JAD 0 6/20/2002 0:00 NJADB71 A 15 Journal JAD 0 6/20/2002 0:00 0JADB72 A 15 Journal JAD 0 6/20/2002 0:00 0JADBSU A 30 Journal JAD 0 12/31/1899 0:00 YJADQ1C A 0 Journal JAD 0 1/1/1998 0:00 NJADQ2C A 0 Journal JAD 0 1/1/1998 0:00 NJADQ3C A 0 Journal JAD 0 1/1/1998 0:00 NJADQ4C A 0 Journal JAD 0 1/1/1998 0:00 NJADSU2 A 30 Journal JAD 0 12/9/2002 0:00 NJADV54 A 13.75 Journal JAD 0 4/10/2002 0:00 NJADV61 A 13.75 Journal JAD 0 6/10/2002 0:00 NJADV62 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV63 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV64 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV71 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV72 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV73 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV74 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV81 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV82 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV83 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV84 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV91 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV92 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADV93 A 13.75 Journal JAD 0 12/31/1899 0:00 N
JADV94 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADVX1 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADVX2 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADVX3 A 13.75 Journal JAD 0 12/31/1899 0:00 NJADVX4 A 13.75 Journal JAD 0 12/31/1899 0:00 NJB1D3L B 45 SW DOS JES 0 1/1/1995 0:00 NJB1F3K B 160 SW DOS JES 0 1/1/1989 0:00 NJB1MND B 0 Manual JES 0 1/1/1998 0:00 NJB1O3P B 0 SW DOS JES 0 1/1/1989 0:00 NJB1OPP B 0 SW DOS JES 0 1/1/1989 0:00 NJB2F3K B 300 SW DOS JES 0 1/1/1997 0:00 NJB3P0B B 23 Specimen Set JES 0 1/1/1989 0:00 yJB8P0M B 20 Answer/Data Sheets JES 0 1/1/1998 0:00 YJB9P0M B 20 Answer/Data Sheets JES 0 1/1/1998 0:00 YJBC1PA B 110 Kit JES 0 1/1/1996 0:00 yJBC2PR B 24 Test Booklet JES 0 1/1/1996 0:00 yJBC2SR B 0 Test Booklet JES 0 1/1/1989 0:00 NJBC3PS B 23 QuikScore Form JES 0 1/1/1996 0:00 yJBC3SS B 0 QuikScore Form JES 0 1/1/1989 0:00 NJBC4PCVR B 0 JES 0 12/31/1899 0:00 0JBC4PD B 35 Manual JES 0 1/1/1989 0:00 yJBC5PF B 24 Test Booklet JES 0 1/1/1996 0:00 yJBC5SF B 0 Test Booklet JES 0 1/1/1989 0:00 NJBC6PU B 27 QuikScore Form JES 0 1/1/1996 0:00 yJBC6SU B 0 QuikScore Form JES 0 1/1/1989 0:00 NJBC7PU B 95 QuikScore Form JES 0 1/1/1996 0:00 yJBC8PF B 10 Profiles JES 0 1/1/1989 0:00 NJBC8SF B 0 Profiles JES 0 1/1/1989 0:00 NJBC9PS B 95 QuikScore Form JES 0 1/1/1997 0:00 YJBPR0O B 58 Answer/Data Sheets JES 0 1/1/1991 0:00 NJBPRSO B 0 Answer/Data Sheets JES 0 1/1/1996 0:00 NJD1R A 54.95 Book ADO 0 12/31/1899 0:00 1JI12F0 B 13 Test Booklet JES 0 12/31/1899 0:00 0JI12PH B 160 Kit JES 0 1/1/1993 0:00 yJI12SE B 13 Test Booklet JES 0 1/1/1988 0:00 yJI13PG B 49.5 Manual JES 0 1/1/1996 0:00 yJI14PD B 36.75 QuikScore Form JES 0 1/1/1993 0:00 yJI14SD B 1.2 QuikScore Form JES 0 1/1/1993 0:00 NJI15PA B 96.6 Kit JES 0 1/1/1994 0:00 yJI16PD B 131.25 QuikScore Form JES 0 1/1/1994 0:00 yJI17PM B 25 Answer/Data Sheets JES 0 1/1/1988 0:00 yJI180 B 155 Kit JIR 0 12/31/1899 0:00 0JI1D3L B 36.75 SW DOS JES 0 1/1/1995 0:00 NJI1F3K B 183.75 SW DOS JES 0 1/1/1989 0:00 NJI1MNG B 0 Manual JES 0 1/1/1998 0:00 NJI1O3P B 0 SW DOS JES 0 1/1/1989 0:00 NJI1OPL B 0 SW DOS JES 0 1/1/1997 0:00 NJI2F3K B 330.75 SW DOS JES 0 1/1/1994 0:00 NJI2P0B B 44.1 Specimen Set JES 0 1/1/1988 0:00 yJI4SCR B 52.5 Scoring Key/Material JES 0 6/18/1999 0:00 YJI5P0C B 15.75 Test Booklet JES 0 1/1/1991 0:00 YJI5PSC B 0 Test Booklet JES 0 1/1/1991 0:00 NJI8P0O B 99.75 Mail-In JES 0 1/1/1994 0:00 NJIDT00 B 47.25 SW 16Bit JES 0 12/31/1899 0:00 N
JIIM00 B 8 Mail-In JES 0 1/1/1997 0:00 YJIPM00 B 4 Mail-In JES 0 1/1/1997 0:00 YJIPR0O B 60.9 Answer/Data Sheets JES 0 1/1/1991 0:00 NJIPR2O B 141.75 Answer/Data Sheets JES 0 1/1/1994 0:00 NJIPRSO B 0 Answer/Data Sheets JES 0 1/1/1988 0:00 NJIR001 B 147 Kit JIR 0 12/31/1899 0:00 YJIR002 B 49.5 Manual JIR 0 12/31/1899 0:00 YJIR002CVR B 45 Manual JIR 0 12/31/1899 0:00 0JIR003 B 15.75 Test Booklet JIR 0 12/31/1899 0:00 YJIR004 B 36.75 QuikScore Form JIR 0 12/31/1899 0:00 YJIR005 B 131.25 QuikScore Form JIR 0 12/31/1899 0:00 YJIR006 B 52.5 Scoring Key/Material JIR 0 12/31/1899 0:00 YJIR007 B 105 Specimen Set JIR 0 12/31/1899 0:00 YJIR010 B 4 Mail-In jir 0 1/1/1997 0:00 YJIR011 B 8 Mail-In jir 0 1/1/1997 0:00 YJIR015 B 57.5 Kit JIR 0 12/31/1899 0:00 YJIR016 B 4 Online Use JIR 0 12/31/1899 0:00 YJIR017 B 65.5 Kit JIR 0 12/31/1899 0:00 YJIR018 B 8 Online Use JIR 0 12/31/1899 0:00 YJIR020 B 0 Manual JIR 0 12/31/1899 0:00 NJIR021 B 4 Refreshers JIR 0 12/31/1899 0:00 YJIR022 B 45 Refreshers JIR 0 12/31/1899 0:00 YJIR023 B 25 Answer/Data Sheets JIR 0 12/31/1899 0:00 YJIR024 B 8 Refreshers JIR 0 12/31/1899 0:00 YJISCRQ B 0 Refreshers JES 0 1/1/1997 0:00 NJISFTCVR 0 Misc 0 12/31/1899 0:00JISP10 B 30 QuikScore Form JES 0 12/31/1899 0:00 NJISP20 B 105 QuikScore Form JES 0 12/31/1899 0:00 NJSO1R0 A 55 Book JSO 0 12/28/2000 0:00 YKCPT10 B 200 SW 16Bit KPT 0 12/31/1899 0:00 YKCPT20 B 45 SW 16Bit KPT 0 12/31/1899 0:00 YKCPT31 B 200 SW 16Bit KPT 0 12/31/1899 0:00 NKCPT32 B 45 SW 16Bit KPT 0 12/31/1899 0:00 NKCPT40 B 45 SW 16Bit KPT 0 10/22/2001 0:00 0KCPTCVR 0 Misc 0 12/31/1899 0:00KCPTM B 35 Manual KPT 0 12/31/1899 0:00 NLA1P0A C 331 Kit LAM 0 1/1/1995 0:00 yLA2P0B C 65 Manual LAM 0 1/1/1995 0:00 yLA2W3H C 0 SW 16Bit LAM 0 1/1/1996 0:00 NLA4P0C C 73.5 Admin. Material LAM 0 1/1/1995 0:00 yLA5P0D C 14 Profiles LAM 0 1/1/1995 0:00 yLA6P0E C 14 Scoring Key/Material LAM 0 1/1/1995 0:00 yLA7P0F C 11.5 Admin. Material LAM 0 1/1/1995 0:00 yLA8P0J C 203 Admin. Material LAM 0 1/1/1995 0:00 yLA9P1J C 0 Admin. Material LAM 0 1/1/1997 0:00 NLA9P2J C 0 Admin. Material LAM 0 1/1/1997 0:00 NLB1R0A A 25 Book LBS 0 12/31/1899 0:00 YLBP1R A 44 Book ADO 0 12/31/1899 0:00 1LDCB1R A 53.5 Book LDC 0 12/20/2001 0:00 YLDDI1A B 120 Kit LDD 0 12/31/1899 0:00 YLDDI2B B 47 Manual LDD 0 12/31/1899 0:00 YLDDI3C B 78 Scoring Key/Material LDD 0 12/31/1899 0:00 YLO1P0A A 14 Book LOP 0 12/31/1899 0:00 YLS10PI A 90 Admin. Material LSI 0 1/1/1996 0:00 y
LS11PI A 300 Admin. Material LSI 0 1/1/1996 0:00 yLS12P b 18 Profiles LSI 0 1/1/1995 0:00 YLS13P b 65 Profiles LSI 0 1/1/1995 0:00 YLS14P B 15 Manual LSI 0 12/31/1899 0:00 YLS15P b 15 Profiles LSI 0 1/1/1995 0:00 1LS1P0A A 130 Kit LSI 0 1/1/1995 0:00 yLS2P0C A 45 Manual LSI 0 1/1/1995 0:00 yLS2PFC A 45 Manual LSI 0 1/1/1996 0:00 NLS3FP0 A 60 Interview Guide/Bklt LSI 0 12/31/1899 0:00 YLS3P0D A 60 Interview Guide/Bklt LSI 0 1/1/1995 0:00 yLS3PSD A 0 Interview Guide/Bklt LSI 0 1/1/1995 0:00 NLS3SPD A 62 Interview Guide/Bklt LSI 0 1/1/1998 0:00 yLS4FP0 A 225 Interview Guide/Bklt LSI 0 12/31/1899 0:00 YLS4P0D A 225 Interview Guide/Bklt LSI 0 1/1/1995 0:00 yLS4SPD A 225 Interview Guide/Bklt LSI 0 1/1/1998 0:00 yLS5P0E A 35 QuikScore Form LSI 0 1/1/1995 0:00 yLS5PFE A 72 QuikScore Form LSI 0 1/1/1996 0:00 YLS5PSE A 0 QuikScore Form LSI 0 1/1/1995 0:00 NLS5SPE A 37 QuikScore Form LSI 0 1/1/1998 0:00 yLS6P0E A 130 QuikScore Form LSI 0 1/1/1995 0:00 yLS6PFE A 130 QuikScore Form LSI 0 1/1/1996 0:00 yLS6SPE A 130 QuikScore Form LSI 0 1/1/1998 0:00 yLS7P0F A 18 Profiles LSI 0 1/1/1995 0:00 yLS7PF0 A 18 Profiles LSI 0 12/31/1899 0:00 yLS7PSF A 0 Profiles LSI 0 1/1/1995 0:00 NLS7SPF A 20 Profiles LSI 0 1/1/1998 0:00 yLS8P0F A 65 Profiles LSI 0 1/1/1995 0:00 yLS8PF0 A 65 Profiles LSI 0 12/31/1899 0:00 YLS8SPF A 75 Profiles LSI 0 1/1/1998 0:00 YLS9P0B A 55 Specimen Set LSI 0 1/1/1995 0:00 yLS9PFB A 0 Specimen Set LSI 0 1/1/1995 0:00 NLSCR10 B 18 Profiles LSI 0 12/31/1899 0:00 0LSCR20 B 60 Interview Guide/Bklt LSI 0 12/31/1899 0:00 0LSCR30 B 53 QuikScore Form LSI 0 12/31/1899 0:00 0LSFRKT A 145 Kit LSI 0 12/31/1899 0:00 NLSI1VH A 45 Video LSI 0 1/1/1996 0:00 0LSI2PQ A 20 Answer/Data Sheets LSI 0 1/1/1998 0:00 yLSI2VH A 45 Video LSI 0 1/1/1996 0:00 0LSI3VH A 45 Video LSI 0 1/1/1996 0:00 0LSI4VH A 245 Video LSI 0 1/1/1996 0:00 yLSI51 B 7 SW Refresher LSI 0 12/31/1899 0:00 YLSI52 B 45 SW Refresher LSI 0 12/31/1899 0:00 YLSI53 B 0 Manual LSI 0 12/31/1899 0:00LSI5DM B 0 Manual LSI 0 12/31/1899 0:00LSIM1J A 0 Video LSI 0 1/1/1996 0:00 NLSIM2J A 0 Video LSI 0 1/1/1996 0:00 NLSIM3J A 0 Video LSI 0 1/1/1996 0:00 NLSIRMF B 0 Maintenance LSI 0 7/6/2000 0:00 NLSIRT1 B 0 Consulting LSI 0 12/31/1899 0:00LSIRTM B 0 Admin. Material LSI 0 7/6/2000 0:00 NLSIRWCVR 0 Misc 0 12/31/1899 0:00LSIS0 A 185 Kit LSI 0 12/31/1899 0:00 0LSIS1A A 85 Kit LSI 0 12/31/1899 0:00 YLSIS2B A 40 Manual LSI 0 4/21/1999 0:00 y
LSIS3C A 50 QuikScore Form LSI 0 12/31/1899 0:00 yLSIS4C A 175 QuikScore Form LSI 0 12/31/1899 0:00 yLSIS5E A 22 Interview Guide/Bklt LSI 0 12/31/1899 0:00 yLSIS6E A 80 Interview Guide/Bklt LSI 0 12/31/1899 0:00 yLSIS7D A 37 QuikScore Form LSI 0 12/31/1899 0:00 yLSIS8D A 130 QuikScore Form LSI 0 12/31/1899 0:00 yLSISSF A 45 Specimen Set LSI 0 12/31/1899 0:00 yLSIT1K A 37 Workbook/Worksheet LSI 0 1/1/1996 0:00 NLSITRA A 0 Kit LSI 0 1/1/1996 0:00 NLSIV1H A 0 Video LSI 0 1/1/1996 0:00 NLSIV1SLV A 0 Video LSI 0 1/1/1996 0:00 0LSIV2H A 0 Video LSI 0 1/1/1996 0:00 NLSIV2SLV A 0 Video LSI 0 1/1/1996 0:00 0LSIV3H A 0 Video LSI 0 1/1/1996 0:00 NLSIV3SLV A 0 Video LSI 0 1/1/1996 0:00 0LSJ01A A 0 Answer/Data Sheets LSI 0 12/31/1899 0:00 NLSJ02B A 0 Scoring Key/Material LSI 0 12/31/1899 0:00 NLSJ030 A 10 manual lsi 0 12/31/1899 0:00 NLSS510 A 6 SW 16Bit LSI 0 6/12/2001 0:00 YLSS520 A 45 SW 16Bit LSI 0 6/12/2001 0:00 YLSS530 A 0 Manual LSI 0 6/12/2001 0:00 NLSS54 A 20 Answer/Data Sheets LSI 0 6/15/2001 0:00 YLSS5DM A 0 Manual LSI 0 6/12/2001 0:00 0LSSVCVR 0 Misc 0 12/31/1899 0:00 0LSSVRV A 10 Manual LSI 0 12/31/1899 0:00 NLSVIDCVR 0 Misc 0 12/31/1899 0:00M21R0A A 38.5 Book PST 0 1/1/1988 0:00 YM22R0A A 76.95 Book ASS 0 1/1/1988 0:00 YM24R0A A 94.5 Book AIM 0 1/1/1988 0:00 YM2MC0A A 40 Book MMC 0 1/1/1997 0:00 NMA1F3A C 450 SW DOS INS 0 1/1/1988 0:00 NMA1W3A C 575 SW 16Bit INS 0 1/1/1996 0:00 NMA3UPA C 259 SW 16Bit CPW 0 1/1/1996 0:00 YMA3W3A C 619 SW 16Bit CPW 0 1/1/1996 0:00 0MAAA0A A 60.95 Book AAP 0 1/1/1988 0:00 YMACR0A A 33.95 Book CSC 0 1/1/1988 0:00 NMADC20 A 126.5 Book MAC 0 12/31/1899 0:00 YMAIFEE 0 mfe 0 12/31/1899 0:00 0MALD0A A 82.5 Book MAN 0 1/1/1988 0:00 NMAPLEA B 0 None NON 0 12/31/1899 0:00 NMAPLEB B 0 None NON 0 12/31/1899 0:00 NMAPLEC B 0 None NON 0 12/31/1899 0:00 NMAPLEE B 0 None NON 0 12/31/1899 0:00 NMASC1A B 63 Kit MAS 0 1/1/1997 0:00 yMASC2 0 0 12/31/1899 0:00MASC2B B 42 Specimen Set MAS 0 1/1/1997 0:00 yMASC3C B 41 Manual MAS 0 1/1/1997 0:00 yMASC4D B 31.5 QuikScore Form MAS 0 1/1/1997 0:00 yMASC5D B 113 QuikScore Form MAS 0 1/1/1997 0:00 yMASC6A B 91 Kit MAS 0 1/1/1997 0:00 yMASC7D B 29.5 QuikScore Form MAS 0 1/1/1997 0:00 yMASC8D B 108 QuikScore Form MAS 0 1/1/1997 0:00 yMC1R0L A 69.5 Book MIL 0 1/1/1998 0:00 YMCI1RA A 0 Book ING 0 1/1/1988 0:00 Y
MDIARA A 27.5 Book MLL 0 12/31/1899 0:00 YMH1R0A A 29.95 Book MHG 0 1/1/1988 0:00 NMI3W3A C 595 SW 16Bit MMP 0 1/1/1998 0:00 NMINISH B 0 Manual SSP 0 1/1/1990 0:00 NMIRGMD B 0 Maintenance SSP 0 1/1/1988 0:00 NMISCSW 0 Misc. NON 0 1/1/1988 0:00 NMISCVD B 0 Video MIS 0 1/1/1988 0:00 NMKTC 0 None non 0 12/31/1899 0:00MKTE 0 None non 0 12/31/1899 0:00MKTMAPLEC B 0 None NON 0 11/30/2001 0:00 0MKTMAPLEE B 0 NONE NON 0 11/30/2001 0:00 0MM100A A 45 Video MMT 0 1/1/1998 0:00 NMM200A A 45 Video MMT 0 1/1/1998 0:00 NMM2BR0 A 54.95 Book ESS 0 12/31/1899 0:00 YMM2R0A A 76.95 Book CRT 0 12/31/1899 0:00 YMM2WB0 A 21.95 Book ESS 0 12/20/2001 0:00 YMM300A A 80 Video MMT 0 1/1/1998 0:00 NMMAR0A A 0 Book ACX 0 1/1/1988 0:00 NMMIM1R A 65 Book IMC 0 12/20/2001 0:00 0MMPI0A A 0 Book USS 0 1/1/1988 0:00 NMMSE100 B 98 Kit MMS 0 12/20/2001 0:00 YMMSE50 B 53 Kit MMS 0 12/20/2001 0:00 YMN1R00 A 40 Book MIH 0 12/31/1899 0:00 YMOSCAB B 10000 SW Unlock CMA 0 6/26/2003 0:00MOSCON A 0 Consulting CMA 0 6/26/2003 0:00MOSDNA B 30000 Consulting CMA 0 6/26/2003 0:00MOSEQI B 10000 SW Unlock CMA 0 6/26/2003 0:00MOSEXP A 0 Consulting CMA 0 6/26/2003 0:00MOSTSP A 0 Consulting CMA 0 12/31/1899 0:00 0MPS01A B 10 Answer/Data Sheets MPS 0 1/1/1998 0:00 NMPS1 B 0 SW 16Bit 0 12/31/1899 0:00 0MPS2 B 0 SW 16Bit 0 12/31/1899 0:00 0MPS3 B 0 SW 16Bit 0 12/31/1899 0:00 0MPS4 B 0 Manual 0 12/31/1899 0:00 0MPS5 B 0 SW 16Bit 0 12/31/1899 0:00 0MPS6 B 0 Answer/Data Sheets 0 12/31/1899 0:00 0MPSRDS B 5 Online Use MPS 0 12/31/1899 0:00 1MR295A C 495 SW 16Bit MMP 0 1/1/1988 0:00 NMR295D C 0 SW 16Bit MMP 0 1/1/1988 0:00 NMR2F3A C 395 SW DOS MMP 0 1/1/1988 0:00 NMR2W0A C 495 SW 16Bit MMP 0 1/1/1996 0:00 NMR2WDO C 0 SW 16Bit MMP 0 1/1/1988 0:00 NMR2WMN C 0 Manual MMP 0 1/1/1988 0:00 NMS1D3B B 45 SW DOS SSP 0 1/1/1995 0:00 NMS1F3A B 395 SW DOS SSP 0 1/1/1990 0:00 NMS1G3G B 100 SW DOS SSP 0 1/1/1996 0:00 NMS1O3A B 0 SW DOS SSP 0 1/1/1996 0:00 NMS1OPA B 0 SW DOS SSP 0 1/1/1996 0:00 NMS1UNC B 350 SW Unlock SSP 0 1/1/1995 0:00 NMS2F3E B 750 SW DOS SSP 0 1/1/1990 0:00 NMS4F3D B 795 SW DOS SSP 0 1/1/1990 0:00 NMS5F3F B 1095 SW DOS SSP 0 1/1/1990 0:00 NMS5W3F B 0 SW DOS SSP 0 1/1/1996 0:00 NMSC010 B 25 Admin. Material MSC 0 12/31/1899 0:00 N
MSC02 B 50 Specimen Set MSC 0 1/15/2002 0:00 YMSC03 B 40 Manual MSC 0 1/15/2002 0:00 YMSC03CVR B 0 Manual MSC 0 1/15/2002 0:00 0MSC04 B 25 Online Use MSC 0 1/15/2002 0:00 YMSC05 B 40 Test Booklet MSC 0 3/15/2002 0:00 YMSC06 B 30 Mail-In MSC 0 3/26/2002 0:00 YMSC07 B 50 SW 16Bit MSC 0 12/31/1899 0:00 YMSC100 B 0 Manual MSC 0 12/31/1899 0:00 NMSC101 B 25 Refreshers MSC 0 12/31/1899 0:00 NMSC102 B 55 SW 16Bit MSC 0 12/31/1899 0:00 NMSC103 B 35 Answer/Data Sheets MSC 0 12/31/1899 0:00 NMSC11 B 30 Online Use MSC 0 12/31/1899 0:00 1MSC12 B 25 Online Use MSC 0 6/18/2002 0:00 1MSC13 B 25 Online Use MSC 0 12/31/1899 0:00 1MSCBPG B 0 Admin. Material MSC 0 12/31/1899 0:00 0MSCDATA B 5 Misc. MSC 0 6/18/2002 0:00 NMSCDST B 1650 Kit MSW 0 12/31/1899 0:00 0MSCE10 B 10 Manual 0 12/31/1899 0:00 0MSCE20 B 3 Test Booklet 0 12/31/1899 0:00 0MSCE30 B 1.5 Permission 0 12/31/1899 0:00 0MSCE40 B 5 Manual 0 12/31/1899 0:00 0MSCMT B 329 Workshop MSW 0 12/31/1899 0:00 0MSCRES B 12 Answer/Data Sheets MSC 0 12/31/1899 0:00 0MSCSPC B 0 Admin. Material MSW 0 12/31/1899 0:00 0MSCWSC B 0 Admin. Material MSW 0 12/31/1899 0:00 0MSFDFJ B 0 SW DOS SSP 0 1/1/1998 0:00 NMSFF3I B 395 SW DOS SSP 0 1/1/1994 0:00 NMSPSSD B 35 Online Use MSC 0 12/31/1899 0:00 1MT1P0A A 52 Book MAX 0 1/1/1988 0:00 NMT1PLA A 36.95 Pamphlet PTT 0 1/1/1994 0:00 yMT2P0A A 32.95 Pamphlet PTG 0 1/1/1994 0:00 yMT2PLA A 36.95 Pamphlet PTG 0 1/1/1994 0:00 yMTG1PA A 32.95 Pamphlet PTT 0 1/1/1994 0:00 yMTOA10 C 104 Kit MTO 0 12/31/1899 0:00 YMTOA20 C 41 Manual MTO 0 12/31/1899 0:00 YMTOA30 C 36 QuikScore Form MTO 0 12/31/1899 0:00 YMTOA40 C 131.25 QuikScore Form MTO 0 12/31/1899 0:00 YMTOA50 C 36 QuikScore Form MTO 0 12/31/1899 0:00 YMTOA60 C 131.25 QuikScore Form MTO 0 12/31/1899 0:00 YMTOA70 C 75 Kit MTO 0 12/31/1899 0:00 NMTOA80 C 75 Kit MTO 0 12/31/1899 0:00 NMTOA90 C 54 Specimen Set MTO 0 12/31/1899 0:00 YMTOACVR C 0 Manual MTO 0 12/31/1899 0:00 0MTQ503 B 0 SW 16Bit MTQ 0 7/10/2001 0:00 NMTQ504 B 0 SW 16Bit MTQ 0 1/18/2002 0:00 NMTQ505 B 0 SW 16Bit MTQ 0 1/18/2002 0:00 NMTQ506 B 0 SW 16Bit MTQ 0 12/31/1899 0:00 NMTQ507 A 0 SW 16Bit MTQ 0 12/31/1899 0:00 1MTQ508 A 0 SW 16Bit MTQ 0 12/31/1899 0:00 1MTQ50D C 0 Upgrade MTQ 0 4/14/2000 0:00 NMTQ54P B 0 Upgrade MTQ 0 1/18/2002 0:00 NMTQ55P B 0 Upgrade MTQ 0 11/21/2002 0:00 NMTQ56P B 0 Upgrade MTQ 0 11/21/2002 0:00 NMTQ57P A 0 Upgrade MTQ 0 11/21/2002 0:00 1
MTQ58P A 0 Upgrade MTQ 0 12/31/1899 0:00 1MTQ58P-C A 0 Upgrade MTQ 0 12/31/1899 0:00 1MTQ5PD A 0 Upgrade MTQ 0 12/31/1899 0:00 NMTQ5UP C 0 Upgrade MTQ 0 7/10/2001 0:00 NMTQCD3 B 0 SW 16Bit MTQ 0 12/31/1899 0:00 NMTQD0G A 0 Dongle MTQ 0 1/1/1996 0:00 NMTQMFE A 0 Maintenance AMF 0 1/1/1989 0:00 NMUM1RA A 18.95 Book MUM 0 1/1/1988 0:00 YNA1R0A A 86.95 Book NAS 0 1/1/1988 0:00 YNEO010 B 255 Kit NEO 0 12/31/1899 0:00 YNEO020 B 43 Manual NEO 0 12/31/1899 0:00 YNEO030 B 37.5 Interview Guide/Bklt NEO 0 12/31/1899 0:00 YNEO040 B 37.5 Interview Guide/Bklt NEO 0 12/31/1899 0:00 YNEO050 B 39.5 Answer/Data Sheets NEO 0 12/31/1899 0:00 YNEO060 B 144 Answer/Data Sheets NEO 0 12/31/1899 0:00 YNEO070 B 39 Profiles NEO 0 12/31/1899 0:00 YNEO080 B 144 Profiles NEO 0 12/31/1899 0:00 YNEO090 B 39 Profiles NEO 0 12/31/1899 0:00 YNEO100 B 143 Profiles NEO 0 12/31/1899 0:00 YNEO110 B 39.5 Profiles NEO 0 12/31/1899 0:00 YNEO120 B 32 Feedback Forms NEO 0 12/31/1899 0:00 YNEO130 B 42 Manual NEO 0 12/31/1899 0:00 YNEO140 B 37.5 Interview Guide/Bklt NEO 0 12/31/1899 0:00 YNEO150 B 33 Feedback Forms NEO 0 12/31/1899 0:00 YNEO200 B 144 Kit NEO 0 12/31/1899 0:00 YNEO220 B 76 Interview Guide/Bklt NEO 0 12/31/1899 0:00 YNEO230 B 285 Interview Guide/Bklt NEO 0 12/31/1899 0:00 YNEO240 B 32 Feedback Forms NEO 0 12/31/1899 0:00 0NEO250 B 76 Test Booklet NEO 0 12/31/1899 0:00 0NEO260 B 76 Test Booklet NEO 0 12/31/1899 0:00 0NEO270 B 76 Test Booklet NEO 0 12/31/1899 0:00 0NEO300 B 419 Kit NEO 0 12/31/1899 0:00 YNEO310 B 46 Manual NEO 0 12/31/1899 0:00 YNEO320 B 499 Refreshers NEO 0 12/31/1899 0:00 YNEO340 B 37 Admin. Material NEO 0 12/31/1899 0:00 YNES010 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES020 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES100 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES200 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES300 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES400 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES500 B 30 Pamphlet NEs 0 10/18/1999 0:00 YNES600 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES700 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES800 B 30 Pamphlet NES 0 10/18/1999 0:00 YNES900 B 30 pamphlet nes 0 10/18/1999 0:00 YNESPV0 B 17.5 Pamphlet NES 0 10/18/1999 0:00 YNIM010 B 26.25 Kit NIM 0 5/11/1999 0:00 NNIM020 B 0 Admin. Material NIM 0 5/11/1999 0:00 NNIM030 B 0 Admin. Material NIM 0 5/11/1999 0:00 NNIM040 B 0 Manual NIM 0 5/11/1999 0:00 NNIMS50 A 84 Kit nim 0 12/31/1899 0:00 YNIMS60 A 10.5 Answer/Data Sheets nim 0 12/31/1899 0:00 YNIMS70 A 78.75 Admin. Material NIM 0 12/31/1899 0:00 Y
NIMS80 A 10.5 Specimen Set nim 0 12/31/1899 0:00 YNL1A0A A 225 Audio NEU 0 1/1/1996 0:00 NNL1AOA A 0 Audio NEU 0 1/1/1996 0:00 NNL1B0A A 39.95 Book NEU 0 1/1/1996 0:00 NNL1V0A A 325 Video NEU 0 1/1/1996 0:00 NNL1VOA A 0 Video NEU 0 1/1/1996 0:00 NNLFEEA A 0 Maintenance NCO 0 1/1/1988 0:00 NNOTE: A 0 None NON 0 12/31/1899 0:00 0NOVJAD 35 Journal JAD 0 12/31/1899 0:00 NOA1R0A A 47 Kit CAD 0 1/1/1998 0:00 YOA2R0B A 29 Admin. Material CAD 0 1/1/1998 0:00 yOA3R0C A 24 Admin. Material CAD 0 1/1/1998 0:00 yOA4R0D A 35 Admin. Material CAD 0 1/1/1998 0:00 yOA5R0E A 24 Admin. Material CAD 0 1/1/1998 0:00 yOA6R0F A 24 Admin. Material CAD 0 1/1/1998 0:00 yOB1R0A A 34 Book OBM 0 1/1/1998 0:00 YOCD1RA A 44 Book OCD 0 1/1/1998 0:00 YOIN1V0 A 99.95 Video OPI 0 12/28/2000 0:00 YOLFA10 B 1000 Maintenance EQI 0 4/18/2000 0:00 NPA10PA B 99.75 Kit PAN 0 8/11/2000 0:00 YPA1P0A B 141.75 Kit PAN 0 1/1/1992 0:00 yPA1R0A A 38.5 Book PAL 0 1/1/1988 0:00 NPA2P0C B 33 Manual PAN 0 1/1/1992 0:00 yPA2POCCVR B 0 Manual PAN 0 1/1/1992 0:00 0PA3P0D B 33 QuikScore Form PAN 0 1/1/1992 0:00 yPA3PSF B 1 QuikScore Form PAN 0 1/1/1992 0:00 NPA4P0D B 99.75 QuikScore Form PAN 0 1/1/1992 0:00 yPA5P0E B 58 Interview Guide/Bklt PAN 0 1/1/1992 0:00 yPA5PSF B 2 Interview Guide/Bklt PAN 0 1/1/1992 0:00 NPA6P0E B 195 Interview Guide/Bklt PAN 0 1/1/1992 0:00 yPA7P0A B 199 Kit PAS 0 1/1/1996 0:00 NPA7P0B B 35 Specimen Set PAN 0 1/1/1988 0:00 YPA8P0A B 99 Reorder Kit PAS 0 1/1/1996 0:00 NPA9P0E B 55 Interview Guide/Bklt PAN 0 1/1/1998 0:00 YPA9PSE B 2 Interview Guide/Bklt PAN 0 1/1/1998 0:00 NPACVRA A 75 Book PSO 0 12/31/1899 0:00 YPAD1AA A 25 Audio PAD 0 1/1/1996 0:00 YPAD2AB A 39 Audio PAD 0 1/1/1996 0:00 YPAD3AC A 25 Audio PAD 0 1/1/1996 0:00 YPAD4AD A 80 Audio PAD 0 1/1/1996 0:00 YPAFR10 B 32 QuikScore Form PAN 0 2/21/2000 0:00 YPAFR20 B 95 QuikScore Form PAN 0 2/22/2000 0:00 YPAFR30 B 135 kit PAN 0 8/16/2000 0:00 YPAGR20 B 32 QuikScore Form PAN 0 2/25/2000 0:00 NPAGR30 B 95 QuikScore Form PAN 0 2/25/2000 0:00 NPAGR40 B 55 QuikScore Form PAN 0 2/25/2000 0:00 NPAGR50 B 185 QuikScore Form PAN 0 2/25/2000 0:00 NPAHG10 B 10 Profiles PAN 0 12/31/1899 0:00 0PAIQ10 B 52.5 Interview Guide/Bklt PAN 0 11/5/1999 0:00 YPAIQ20 B 189 Interview Guide/Bklt PAN 0 11/5/1999 0:00 YPANP10 B 55 Interview Guide/Bklt PAN 0 3/15/2000 0:00 NPANP20 B 0 Interview Guide/Bklt PAN 0 12/31/1899 0:00PANRC1 B 10 Interview Guide/Bklt PAN 0 12/31/1899 0:00 NPANSSCVR 0 Misc 0 12/31/1899 0:00
PARS10 B 10 Profiles PAN 0 12/31/1899 0:00 0PAS1R A 38.5 Book 0 12/31/1899 0:00 1PASP10 B 55 Interview Guide/Bklt PAN 0 2/17/2000 0:00 NPASP20 B 10 Scoring Key/Material PAN 0 2/17/2000 0:00 NPB20MM B 0 Misc. TOL 0 12/31/1899 0:00 0PB22MM B 0 Misc. TOL 0 12/31/1899 0:00 NPC1F3A A 195 SW DOS PCW 0 1/1/1995 0:00 NPC1O3D A 0 SW DOS PCW 0 1/1/1995 0:00 yPCC1RA A 59.95 Book PCC 0 1/1/1988 0:00 YPCCBR0 A 59.95 Book POC 0 12/31/1899 0:00 YPCL1AN A 62.95 Audio PCL 0 1/1/1996 0:00 YPCL1BO A 0 Audio PCL 0 1/1/1996 0:00 NPCL1CP A 0 Audio PCL 0 1/1/1996 0:00 NPCL1CSLV A 0 Audio PCL 0 1/1/1996 0:00 0PCL1FQ C 0 Kit PCL 0 1/1/1996 0:00 YPCL1HN A 95 Audio PCL 0 1/1/1998 0:00 yPCL1PA C 263 Kit PCL 0 1/1/1991 0:00 yPCL2HN A 160 Audio PCL 0 1/1/1998 0:00 yPCL2PD C 105 Manual PCL 0 1/1/1991 0:00 yPCL3PF C 42 Scoring Key/Material PCL 0 1/1/1991 0:00 yPCL3QF C 30 Scoring Key/Material PCL 0 1/1/1994 0:00 NPCL4FQ C 0 QuikScore Form PCL 0 1/1/1996 0:00 YPCL4PE C 52.5 QuikScore Form PCL 0 1/1/1991 0:00 yPCL4SQ C 0 QuikScore Form PCL 0 1/1/1996 0:00 NPCL55V C 31.5 Admin. Material PCL 0 1/1/1997 0:00 NPCL5FQ C 0 Interview Guide/Bklt PCL 0 1/1/1996 0:00 YPCL5PG C 105 Interview Guide/Bklt PCL 0 1/1/1991 0:00 yPCL5SQ C 0 Interview Guide/Bklt PCL 0 1/1/1996 0:00 NPCL6FQ C 0 Scoring Key/Material PCL 0 1/1/1996 0:00 NPCL6PE C 179 QuikScore Form PCL 0 1/1/1991 0:00 yPCL7FQ C 0 Specimen Set PCL 0 1/1/1996 0:00 YPCL7PG C 357 Interview Guide/Bklt PCL 0 1/1/1991 0:00 yPCL7SS C 131.25 Specimen Set PCL 0 12/31/1899 0:00 YPCL8PB C 225 Kit PCL 0 1/1/1994 0:00 yPCLG10 C 45 QuikScore Form PCL 0 11/3/1999 0:00 NPCLG20 C 5 Manual PCL 0 11/4/1999 0:00 NPCLG30 C 160 QuikScore Form PCL 0 7/25/2000 0:00 NPCLG40 C 45 QuikScore Form PCL 0 7/25/2000 0:00 NPCLG50 C 160 Interview Guide/Bklt PCL 0 7/25/2000 0:00 NPCLG60 C 42 Specimen Set PCL 0 7/25/2000 0:00 NPCLG70 C 120 Kit PCL 0 7/25/2000 0:00 NPCLIGG C 0 Interview Guide/Bklt PCL 0 1/1/1991 0:00 NPCLQSE C 0 QuikScore Form PCL 0 1/1/1991 0:00 NPCLR01 C 225 Kit PC2 0 12/31/1899 0:00 YPCLR02 C 75 Manual PC2 0 12/31/1899 0:00 YPCLR03 C 45 Manual PC2 0 12/31/1899 0:00 YPCLR04 C 50 QuikScore Form PC2 0 12/31/1899 0:00 YPCLR05 C 170 QuikScore Form PC2 0 12/31/1899 0:00 YPCLR06 C 82 Interview Guide/Bklt PC2 0 12/31/1899 0:00 YPCLR07 C 290 Interview Guide/Bklt PC2 0 12/31/1899 0:00 YPCLR08 C 110 Specimen Set PC2 0 12/31/1899 0:00 YPCLR2CVR C 0 Manual PC2 0 12/31/1899 0:00 NPCLRCVR C 0 Manual PC2 0 12/31/1899 0:00 NPCLRTAB C 0 Manual PC2 0 12/31/1899 0:00 0
PCLS1H C 120 Kit PCL 0 1/1/1988 0:00 yPCLS2J C 40 Manual PCL 0 1/1/1988 0:00 yPCLS3L C 90 Admin. Material PCL 0 1/1/1988 0:00 yPCLS4L C 320 Admin. Material PCL 0 1/1/1988 0:00 yPCLS5K C 30 Admin. Material PCL 0 1/1/1988 0:00 NPCLS6T C 45 Interview Guide/Bklt PCL 0 1/1/1991 0:00 yPCLS7I C 42 Specimen Set PCL 0 1/1/1988 0:00 yPCLS8J C 10 Manual PCL 0 1/1/1998 0:00 NPCLS8T C 160 Interview Guide/Bklt PCL 0 1/1/1988 0:00 YPCLS9S C 45 QuikScore Form PCL 0 1/1/1988 0:00 yPCLSFQ C 0 Manual PCL 0 1/1/1996 0:00 NPCLSQS C 160 QuikScore Form PCL 0 1/1/1988 0:00 yPCLSSK C 0 QuikScore Form PCL 0 1/1/1988 0:00 NPCLSSL C 0 Interview Guide/Bklt PCL 0 1/1/1988 0:00 NPCLSWK C 18.95 Admin. Material PCL 0 1/1/1997 0:00 NPCLY10 C 10 Mail-In PCL 0 12/31/1899 0:00 NPCLY2F C 25 Scoring Key/Material PCL 0 12/31/1899 0:00 NPCLY3G C 20 Interview Guide/Bklt PCL 0 12/31/1899 0:00 NPCLY4E C 10 QuikScore Form PCL 0 12/31/1899 0:00 NPCMANB A 0 Manual PCW 0 1/1/1995 0:00 NPCT1PA A 45 Kit PCP 0 1/1/1997 0:00 YPCT2PB A 25 Manual PCP 0 1/1/1997 0:00 yPCT3PC A 25 Admin. Material PCP 0 1/1/1997 0:00 yPCT4PC A 90 Admin. Material PCP 0 1/1/1997 0:00 yPCW1FJ A 0 Specimen Set CWP 0 1/1/1995 0:00 NPCW1PJ A 0 Specimen Set CWP 0 1/1/1988 0:00 NPCYV01 C 225 Kit pcy 0 12/31/1899 0:00 YPCYV02 C 60 Manual pcy 0 1/1/1991 0:00 1PCYV02CVR C 0 Manual PCY 0 12/31/1899 0:00 NPCYV03 C 45 Manual pcy 0 12/31/1899 0:00 1PCYV03CVR C 0 Manual PCY 0 12/31/1899 0:00 NPCYV04 C 50 QuikScore Form pcy 0 12/31/1899 0:00 YPCYV05 C 170 QuikScore Form pcy 0 12/31/1899 0:00 1PCYV06 C 82 Interview Guide/Bklt pcy 0 12/31/1899 0:00 1PCYV07 C 290 Interview Guide/Bklt pcy 0 12/31/1899 0:00 1PCYV08 C 110 Specimen Set PCY 0 12/31/1899 0:00 1PDRFRA A 71.5 Book PDR 0 12/31/1899 0:00 YPDS1PC B 52.5 Kit PDX 0 4/5/1999 0:00 yPDS2PA B 33 Manual PDX 0 4/5/1999 0:00 yPDS3PB B 25 QuikScore Form PDX 0 4/5/1999 0:00 yPDS4PB B 90 QuikScore Form PDX 0 4/5/1999 0:00 yPDS5P0 B 44.1 Specimen Set POS 0 12/31/1899 0:00 NPDSF10 B 25 QuikScore Form PDX 0 8/22/2000 0:00 YPDSF20 B 90 QuikScore Form PDX 0 8/22/2000 0:00 YPDSF30 B 50 Kit PDX 0 8/22/2000 0:00 YPE1R0A A 86 Book PEC 0 1/1/1997 0:00 YPER10H A 0 Permission PSP 0 1/1/1997 0:00 NPER11S B 0 Permission CRS 0 1/1/1998 0:00 NPER12E B 7 Permission SPA 0 1/1/1998 0:00 NPER13E B 0 Permission DTS 0 1/1/1998 0:00 NPER14S B 0 Permission CRS 0 1/1/1998 0:00 NPER15U C 0 Permission PCL 0 1/1/1998 0:00 NPER16L B 0 Permission EQI 0 1/1/1998 0:00 NPER17E B 0 Permission CDS 0 1/1/1998 0:00 N
PER18E B 0 Permission MAS 0 1/1/1998 0:00 NPER19P B 0 Permission FAM 0 1/1/1998 0:00 NPER1PC A 0 Permission PCL 0 4/20/1999 0:00 NPER200 A 0 Permission JAD 0 12/31/1899 0:00 NPER210 B 0 Permission PDX 0 8/9/1999 0:00 NPER220 B 0 Permission FAM 0 8/23/1999 0:00 NPER230 B 0 Permission FAM 0 8/23/1999 0:00 NPER240 B 0 Permission CDI 0 8/23/1999 0:00 NPER250 B 0 Permission CDS 0 8/23/1999 0:00 NPER260 B 0 Permission PCL 0 8/23/1999 0:00 NPER270 B 0 Permission PCL 0 8/23/1999 0:00 NPER280 B 0 Permission CAA 0 8/23/1999 0:00 NPER290 B 0 Permission CAA 0 8/23/1999 0:00 NPER300 B 0 Permission CAA 0 8/23/1999 0:00 NPER310 B 0 Permission CAA 0 8/23/1999 0:00 NPER320 B 0 Permission CAA 0 8/23/1999 0:00 NPER330 B 0 Permission CAA 0 8/23/1999 0:00 NPER340 B 0 Permission MAS 0 8/23/1999 0:00 NPER350 B 0 Permission CRS 0 8/23/1999 0:00 NPER360 B 0 Permission CRS 0 8/23/1999 0:00 NPER370 B 0 Permission CRS 0 8/23/1999 0:00 NPER380 B 0 Permission CRS 0 8/23/1999 0:00 NPER390 B 0 Permission CRS 0 8/23/1999 0:00 NPER400 B 0 Permission EQI 0 8/23/1999 0:00 NPER410 B 0 Permission CIS 0 8/23/1999 0:00 NPER420 B 0 Permission JES 0 8/23/1999 0:00 NPER430 B 0 Permission JES 0 8/23/1999 0:00 NPER440 B 0 Permission LSI 0 8/23/1999 0:00 NPER450 B 0 Permission SPC 0 8/23/1999 0:00 NPER460 B 0 Permission PDX 0 8/23/1999 0:00 NPER470 B 0 Permission SAS 0 8/23/1999 0:00 NPER480 B 0 Permission SAS 0 8/23/1999 0:00 NPER490 B 0 Permission QLQ 0 8/23/1999 0:00 NPER500 B 0 Permission HPS 0 8/23/1999 0:00 NPER510 B 0 Permission CAS 0 8/23/1999 0:00 NPER520 B 0 Permission CAS 0 8/23/1999 0:00 NPER530 B 0 Permission CRS 0 8/23/1999 0:00 NPER540 B 0 Permission CRS 0 8/23/1999 0:00 NPER550 B 0 Permission CRS 0 8/23/1999 0:00 NPER560 B 0 Permission SPS 0 8/26/1999 0:00 NPER570 B 0 Permission ISS 0 10/12/1999 0:00 NPER580 B 14 Permission MSC 0 12/31/1899 0:00 0PER590 B 1 Permission FAC 0 12/31/1899 0:00 0PER600 B 1 Permission EQY 0 12/31/1899 0:00 NPER610 B 1 Permission EQY 0 12/31/1899 0:00 NPER620 B 1 Permission EQ3 0 12/31/1899 0:00 0PER630 B 1 Permission EQ3 0 12/31/1899 0:00 0PERAPS B 1 Permission APS 0 12/31/1899 0:00 0PERCAAD B 1 Permission CAI 0 12/31/1899 0:00 0PERCHI b 0 Permission chi 0 12/31/1899 0:00 0PERCLE B 1 Permission CLE 0 12/31/1899 0:00 0PERCMI A 1 Permission YLS 0 12/31/1899 0:00 NPEREDG A 0 Permission EQE 0 12/31/1899 0:00 0PEREQS B 1 Permission EQI 0 12/31/1899 0:00 0
PERJBC B 0 Permission JES 0 12/31/1899 0:00PERLS1 A 1 Permission LSI 0 8/15/2001 0:00 0PERM1K B 0 Permission QLQ 0 1/1/1990 0:00 NPERM1U C 0 Permission PCL 0 1/1/1996 0:00 NPERM2I B 0 Permission CDI 0 1/1/1988 0:00 NPERM3S B 0 Permission CRO 0 1/1/1988 0:00 NPERM4P A 0 Permission CRO 0 1/1/1988 0:00 NPERM5H B 0 Permission DAS 0 1/1/1988 0:00 NPERM6F B 0 Permission PAN 0 1/1/1988 0:00 NPERM6I B 2.25 Permission PAN 0 10/16/2001 0:00PERM6Q B 0 Permission PAN 0 12/31/1899 0:00 NPERM6R B 0 Permission PCL 0 12/31/1899 0:00 NPERM6S B 0 Permission PAN 0 12/31/1899 0:00 NPERM7J B 0 Permission CIS 0 1/1/1988 0:00 NPERM8R B 0 Permission JES 0 1/1/1996 0:00 NPERM9L B 0 Permission LSI 0 12/31/1899 0:00 0PERMP1 B 1 Permission MPS 0 8/31/2000 0:00 NPERMPR B 0 Permission PAN 0 12/31/1899 0:00 NPERPOB B 0 Permission POM 0 12/31/1899 0:00 0PERPOL B 0 Permission POM 0 12/31/1899 0:00 0PERPOM B 0 Permission POM 0 12/31/1899 0:00 0PERPOS B 0 Permission POM 0 12/31/1899 0:00 NPERSA4 B 1 Permission sa4 0 1/1/1998 0:00 0PERSPN B 0 Permission SPN 0 4/23/2001 0:00 0PERYLS A 1 Permission LSI 0 8/15/2001 0:00 0PF13SD B 0 Test Booklet PFC 0 1/1/1992 0:00 NPF14SE B 0 Answer/Data Sheets PFC 0 1/1/1988 0:00 NPFEC1B B 0 Kit PFC 0 12/31/1899 0:00 YPFEC2C B 0 Manual PFC 0 12/31/1899 0:00 YPFEC3D B 0 Scoring Key/Material PFC 0 12/31/1899 0:00 YPFEC4E B 0 QuikScore Form PFC 0 12/31/1899 0:00 YPFEC5E B 0 QuikScore Form PFC 0 12/31/1899 0:00 YPFF1RA A 20 Book 16B 0 1/1/1988 0:00 NPFF2RA A 20 Book PFC 0 1/1/1988 0:00 NPFF4PE B 0 Answer/Data Sheets PFC 0 1/1/1988 0:00 NPFFR10 B 153 Kit PFF 0 12/31/1899 0:00 YPFH1RA A 23.95 Book PFC 0 1/1/1988 0:00 NPFN1RA A 56.5 Book PFN 0 1/1/1997 0:00 YPG1R0A A 78 Book PGC 0 1/1/1988 0:00 YPGAS10 A 19.75 Book PGA 0 12/31/1899 0:00 YPGT1R A 17.95 Book ADO 0 12/31/1899 0:00 1PM1R0A A 50 Book PSM 0 1/1/1988 0:00 YPMTA1T A 0 Audio PMT 0 1/1/1996 0:00 NPMTAAT A 49.95 Audio PMT 0 1/1/1996 0:00 yPMTACT A 0 Audio PMT 0 1/1/1996 0:00 NPMTHBM A 0 Audio PMT 0 1/1/1996 0:00 NPO1W0A A 55 SW 16Bit PAO 0 1/1/1988 0:00 NPOCR00 A 23 Book PCO 0 12/31/1899 0:00 YPOFR00 A 23 Book PCO 0 12/31/1899 0:00 YPOM02 B 27.5 Kit POM 0 12/31/1899 0:00 NPOM03 B 22 Manual POM 0 12/31/1899 0:00 NPOM04 B 12.6 Scoring Key/Material POM 0 12/31/1899 0:00 NPOM05 B 78.75 QuikScore Form POM 0 12/31/1899 0:00 NPOM06 B 21 QuikScore Form POM 0 12/31/1899 0:00 N
POM07 B 78.75 QuikScore Form POM 0 12/31/1899 0:00 NPOM08 B 21 QuikScore Form POM 0 12/31/1899 0:00 NPOM09 B 78.75 QuikScore Form POM 0 12/31/1899 0:00 NPOM10 B 15.75 Profiles POM 0 12/31/1899 0:00 NPOM11 B 15.75 Profiles POM 0 12/31/1899 0:00 NPOM12 B 15.75 Profiles POM 0 12/31/1899 0:00 NPOM13 B 31.5 Scoring Key/Material POM 0 12/31/1899 0:00 NPOM14 B 31.5 Scoring Key/Material POM 0 12/31/1899 0:00 NPOM15 B 31.5 Scoring Key/Material POM 0 12/31/1899 0:00 NPOM16 B 36.75 Manual pom 0 12/31/1899 0:00 NPOM17 B 0 Scoring Key/Material P02 0 12/31/1899 0:00 0POM18 B 21 Scoring Key/Material P02 0 12/31/1899 0:00 NPOM19 B 78.75 Scoring Key/Material P02 0 12/31/1899 0:00 NPOM20 B 21 Scoring Key/Material P02 0 12/31/1899 0:00 NPOM21 B 78.75 Scoring Key/Material P02 0 12/31/1899 0:00 NPOM22 B 21 Scoring Key/Material P02 0 12/31/1899 0:00 YPOM23 B 78.75 Scoring Key/Material P02 0 12/31/1899 0:00 YPOM24 B 25 Specimen Set P02 25 12/31/1899 0:00 NPOM25 B 40 Specimen Set P02 38 12/31/1899 0:00 NPOM26 B 8 Manual P02 0 12/31/1899 0:00 NPOM27 B 25 Kit P02 0 12/31/1899 0:00 NPOM28 B 40 Kit P02 0 12/31/1899 0:00 0POM29 B 48 Kit P02 0 12/31/1899 0:00 0POSR00 A 65.95 Book PS5 0 12/31/1899 0:00 NPOSR20 A 33.95 Book PS5 0 12/20/2001 0:00 YPP1A0A A 150 Audio POP 0 1/1/1996 0:00 NPP1B0A A 16.5 Book POB 0 1/1/1988 0:00 NPP1F3A B 250 SW DOS PPS 0 1/1/1988 0:00 NPP1FMA B 295 SW - Macintosh PPS 0 1/1/1988 0:00 NPP1P0A B 199 Kit PPC 0 1/1/1996 0:00 NPP1V0A A 225 Video POV 0 1/1/1996 0:00 NPP1W3A B 295 SW 16Bit PPS 0 1/1/1996 0:00 NPP2P0A B 104 Reorder Kit PPC 0 1/1/1996 0:00 NPP2W3F B 295 SW 16Bit PPS 0 9/1/2000 0:00 YPPC001 B 62 Kit PPT 0 12/31/1899 0:00 YPPC002 B 40 Manual PPT 0 12/31/1899 0:00 YPPC003 B 28.5 QuikScore Form PPT 0 12/31/1899 0:00 YPPC004 B 102 QuikScore Form PPT 0 12/31/1899 0:00 YPPCCVR 41 Misc. 0 12/31/1899 0:00PRCD10 B 0 SW 16Bit PPO 0 4/28/1999 0:00 yPRCDSLKSCR 0 Misc. 0 12/31/1899 0:00 0PRDS20 B 0 SW 16Bit PPO 0 4/28/1999 0:00 yPRI1R0 A 65.95 Book PRI 0 12/31/1899 0:00 YPRICETEST 16.5 None 0 12/31/1899 0:00PRIL10 A 26.95 Book PRL 0 12/31/1899 0:00 YPROCES 0 Admin. Material ACS 0 12/31/1899 0:00PROG0A A 0 Consulting INF 0 1/1/1996 0:00 NPRON10 A 0 Book NON 0 8/8/2001 0:00 0PS10PA B 60 Answer/Data Sheets PSI 0 1/1/1988 0:00 YPS11FA B 56 Test Booklet PSI 0 1/1/1996 0:00 YPS11PA B 42 Test Booklet PSS 0 1/1/1988 0:00 NPS12FA B 56 Test Booklet PSI 0 1/1/1988 0:00 YPS12PA B 33 Test Booklet PSS 0 1/1/1988 0:00 NPS13FA B 56 Test Booklet PSI 0 1/1/1988 0:00 N
PS1F3F A 125 SW DOS PSP 0 1/1/1995 0:00 NPS1O3F A 0 SW DOS PSP 0 1/1/1995 0:00 NPS1OPF A 0 SW DOS PSP 0 1/1/1995 0:00 NPS1P0A A 15 Admin. Material PSH 0 1/1/1988 0:00 NPS1R0A A 59.95 Book PSY 0 1/1/1988 0:00 NPS2F0A B 191.4 Kit PSF 0 1/1/1996 0:00 YPS2F3F A 235 SW DOS PSP 0 1/1/1995 0:00 NPS2P0A B 167 Kit PSI 0 1/1/1988 0:00 YPS3D3G A 40 SW DOS PSP 0 1/1/1995 0:00 NPS3F0A B 62.7 Manual PSF 0 1/1/1996 0:00 YPS3P0A B 60 Manual PSI 0 1/1/1988 0:00 YPS3R0A A 43 Book PRO 0 1/1/1988 0:00 YPS4F0A B 56 Answer/Data Sheets PSI 0 1/1/1996 0:00 YPS4P0A B 58 Answer/Data Sheets PSI 0 1/1/1988 0:00 YPS6F3A B 465 SW DOS PSS 0 1/1/1996 0:00 NPS7F3A B 569 SW DOS PSS 0 1/1/1988 0:00 NPS7P0A B 44 Answer/Data Sheets PSI 0 1/1/1988 0:00 NPS8F3A B 145 SW DOS PSI 0 1/1/1988 0:00 YPS8P0A B 52 Test Booklet PSI 0 1/1/1988 0:00 YPS9F3A B 265 SW DOS PSI 0 1/1/1988 0:00 YPS9P0A B 113 Kit PSI 0 1/1/1988 0:00 YPSC01 B 6.25 SW Refresher PSC 0 12/31/1899 0:00 NPSC02 B 0 Manual PSC 0 12/31/1899 0:00 NPSC03 B 47.25 SW Refresher PSC 0 12/31/1899 0:00 NPSC04 B 21 Answer/Data Sheets PSC 0 4/26/2002 0:00 NPSCKB0 A 60 Kit PSC 0 12/31/1899 0:00 yPSCKK0 A 44 Kit PSC 0 12/31/1899 0:00 yPSCN10 A 21 Manual PSC 0 12/31/1899 0:00 yPSCN20 A 94.5 QuikScore Form PSC 0 12/31/1899 0:00 yPSCN30 A 25.25 QuikScore Form PSC 0 12/31/1899 0:00 yPSCNS0 A 23 Specimen Set PSC 0 12/31/1899 0:00 yPSCNU1 A 0 Info Pak PSC 0 12/31/1899 0:00 NPSCSDS B 0 Online Use PSC 0 12/31/1899 0:00 1PSCW01 B 3.5 Online Use PSC 0 12/31/1899 0:00 NPSGS1R A 16.5 Book PSG 0 12/20/2001 0:00 YPSIFRCVR 0 Misc 0 12/31/1899 0:00PSP1PA B 136.5 Kit PSP 0 1/1/1994 0:00 yPSP1RB B 15.95 Book PSB 0 1/1/1988 0:00 YPSP25D B 25.2 QuikScore Form PSP 0 1/1/1994 0:00 NPSP2PD B 101 QuikScore Form PSP 0 1/1/1994 0:00 yPSP3PC B 33.6 Test Booklet PSP 0 1/1/1994 0:00 yPSP4PD B 22 QuikScore Form PSP 0 1/1/1997 0:00 yPSP5PE B 31.5 Specimen Set PSP 0 1/1/1994 0:00 yPSP6PD B 78.75 Scoring Key/Material PSP 0 1/1/1997 0:00 yPSP7PJ B 20 Answer/Data Sheets PSP 0 1/1/1997 0:00 NPSPMNA B 35 Manual PSP 0 1/1/1995 0:00 NPSPW01 A 5 Online Use PSP 0 12/31/1899 0:00 YPSS1R A 54.95 Book FDO 0 12/31/1899 0:00 NPST1R0 A 47.5 Book PBT 0 12/28/2000 0:00 0PSTCR0 A 0 None FCM 0 12/31/1899 0:00 NPSYCHSLKSCRN 0 Misc 0 12/31/1899 0:00PTDK10 b 0 Maintenance LSI 0 12/31/1899 0:00PTDK20 B 0 Maintenance EQI 0 12/31/1899 0:00 0PTRT10 A 54.95 Book PER 0 12/31/1899 0:00 Y
PTS1RA A 27.5 Book PTS 0 1/1/1988 0:00 NPTSK1 0 SW 16Bit UNK 0 12/31/1899 0:00 YPTSK5 0 SW 16Bit UNK 0 12/31/1899 0:00PTSM2 0 Manual UNK 0 12/31/1899 0:00PTSM3 0 Manual UNK 0 12/31/1899 0:00PTSM4 0 Manual UNK 0 12/31/1899 0:00PTSSLKSCR 0 Misc. 0 12/31/1899 0:00 0PUBMAN C 0 Manual NON 0 9/5/2001 0:00 0PYTS10 A 21 Book PYT 0 12/31/1899 0:00 NQL1D3G B 35 SW DOS QLQ 0 1/1/1995 0:00 NQL1F3F B 125 SW DOS QLQ 0 1/1/1990 0:00 NQL1MNC B 0 Manual QLQ 0 1/1/1998 0:00 NQL1O3H B 0 SW DOS QLQ 0 1/1/1990 0:00 NQL1OPH B 0 SW DOS QLQ 0 1/1/1990 0:00 NQL1P0A B 54 Kit QLQ 0 1/1/1990 0:00 yQL1S0B B 30 Specimen Set QLQ 0 1/1/1996 0:00 yQL2P0D B 19.95 QuikScore Form QLQ 0 1/1/1988 0:00 yQL2PSD B 0 QuikScore Form QLQ 0 1/1/1988 0:00 NQL3P0C B 23 Manual QLQ 0 1/1/1988 0:00 yQL3POC-CVR B 0 Manual QLQ 0 1/1/1988 0:00 0QL4P0D B 71.5 QuikScore Form QLQ 0 1/1/1988 0:00 yQL5P0E B 18 Test Booklet QLQ 0 1/1/1988 0:00 yQL5PSE B 0 Test Booklet QLQ 0 1/1/1988 0:00 NQLQW01 B 5 Online Use QLQ 0 12/31/1899 0:00 YQLQW02 B 33 Online Use QLQ 0 12/31/1899 0:00 YQRT00A A 55 Audio QRT 0 1/1/1988 0:00 NRA1R0A A 59.5 Book RAS 0 1/1/1988 0:00 YRCL1PC B 86 Kit REH 0 12/31/1899 0:00 yRCL2PA B 44 Manual REH 0 12/31/1899 0:00 yRCL2PACVR B 0 Manual REH 0 12/31/1899 0:00 0RCL3PB B 48 QuikScore Form REH 0 12/31/1899 0:00 yRE10PA A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE11PA A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE12PA A 20 Pamphlet RHC 0 1/1/1996 0:00 yRE1P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE2P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE3P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE4P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE5P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE6P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE7P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE8P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yRE9P0A A 32 Pamphlet RHC 0 1/1/1996 0:00 yREFINV B 0 None NON 0 12/31/1899 0:00 NREPR00 A 0 Misc. INF 0 1/1/1988 0:00 NRI1F3F C 595 SW DOS RIA 0 1/1/1996 0:00 NRI1W00 C 625 SW 16Bit RIA 0 8/16/1999 0:00 YRIA5CD C 625 SW 16Bit RIA 0 12/31/1899 0:00 0RIAP5 C 403.5 SW 16Bit RIA 0 12/31/1899 0:00 0RIAP5S C 399 SW 16Bit RIA 0 12/31/1899 0:00 0RIAPS C 399 SW 16Bit RIA 0 2/25/2002 0:00 YRIAS1 B 372.9 Reorder Kit 0 12/31/1899 0:00 0RIAS2 B 58.3 Reorder Kit 0 12/31/1899 0:00 0RIAS3 B 80.3 Book 0 12/31/1899 0:00 0
RIAS4 B 80.3 Book 0 12/31/1899 0:00 0RIAS5 B 104.5 Book 0 12/31/1899 0:00 0RIAS6 B 181.5 Reorder Kit 0 12/31/1899 0:00 0RIAS7 B 104.5 Manual 0 12/31/1899 0:00 0RIST1 B 99 Book 0 12/31/1899 0:00 0RIST2 B 33 Book 0 12/31/1899 0:00 0RIST3 B 77 Book 0 12/31/1899 0:00 0RIST4 B 207 Reorder Kit 0 12/31/1899 0:00 0RL1P0A C 36 Admin. Material RSH 0 1/1/1988 0:00 YRMRKVA A 67 Video RMR 0 1/1/1997 0:00 YRMS1R A 25.5 Book ADO 0 12/31/1899 0:00 1RNTFEE 0 None RNT 0 11/19/2001 0:00 0RP1P0A C 83 Admin. Material RSH 0 1/1/1988 0:00 YRQ1P0A C 14.95 Admin. Material RSQ 0 1/1/1995 0:00 YRR1P0A C 22 Admin. Material RSH 0 1/1/1988 0:00 YRRA1R0 A 41.5 Book RRA 0 12/20/2001 0:00 YRRE1R A 19.95 Book ADO 0 12/31/1899 0:00 1RSP01 B 71 Kit RSO 0 12/7/2001 0:00 YRSP02 B 51 Specimen Set RSO 0 12/7/2001 0:00 YRSP03 B 50 Manual RSO 0 12/7/2001 0:00 YRSP04 B 30 QuikScore Form RSO 0 12/7/2001 0:00 YRSP05 B 114 QuikScore Form RSO 0 12/7/2001 0:00 YRT100A A 46 Audio RTP 0 1/1/1988 0:00 YRT1W0A C 269 SW 16Bit RSH 0 1/1/1988 0:00 NRT200A A 46 Audio RTP 0 1/1/1988 0:00 YRTCW1R B 21.95 Book RTC 0 12/20/2001 0:00 0RTFRT1 0 Freight FRG 0 12/31/1899 0:00RW1P0A B 22.5 Admin. Material RWC 0 1/1/1988 0:00 NRWC1R A 0 Book ADO 0 12/31/1899 0:00 1SA1P0A A 55 Kit SAR 0 4/5/1999 0:00 ySA1PSD A 30 Specimen Set SAR 0 4/5/1999 0:00 ySA2P0B A 28 Manual SAR 0 4/5/1999 0:00 ySA3P0C A 23 Admin. Material SAR 0 4/5/1999 0:00 ySA410A B 56 Kit SA4 0 1/1/1998 0:00 ySA420B B 35 Manual SA4 0 1/1/1998 0:00 ySA430C B 29 QuikScore Form SA4 0 1/1/1998 0:00 ySA44SH B 37 Specimen Set SA4 0 1/1/1998 0:00 ySA4501 B 0 Manual SA4 0 12/31/1899 0:00 NSA4501CVR 0 0 12/31/1899 0:00SA4502 B 3 Refreshers SA4 0 12/31/1899 0:00 YSA4503 B 45 SW 16Bit SA4 0 12/31/1899 0:00 YSA45MANCVR 0 Misc 0 12/31/1899 0:00SA4P0C A 85 Admin. Material SAR 0 4/5/1999 0:00 ySA5P00 A 15 Admin. Material SAR 0 4/5/1999 0:00 ySA6P00 A 55 Admin. Material SAR 0 4/5/1999 0:00 ySAAP0A A 16.95 Book SAB 0 1/1/1998 0:00 NSAAP1 B 0 Reorder Kit 0 12/31/1899 0:00 0SAAP2 B 0 Manual 0 12/31/1899 0:00 0SAAP3 B 0 SW 16Bit 0 12/31/1899 0:00 0SAAP4 B 0 SW 16Bit 0 12/31/1899 0:00 0SAAP5 B 0 Answer/Data Sheets 0 12/31/1899 0:00 0SAGL10 A 39.5 Book SNG 0 12/31/1899 0:00 YSAR10A A 200 None NON 0 8/15/2001 0:00 0SARAMNCVR 0 Misc 0 12/31/1899 0:00
SAS100 B 49.5 Manual SSS 0 12/27/2002 0:00 YSAS200 B 33 Manual SSS 0 12/27/2002 0:00 YSAS300 B 71.5 Video SSS 0 12/27/2002 0:00 YSAS400 B 53 Profiles SSS 0 12/27/2002 0:00 YSAS410 B 132 Kit SSS 0 12/27/2002 0:00 YSAS500 B 176 Profiles SSS 0 12/27/2002 0:00 YSAS600 B 192.5 Refreshers SSS 0 12/27/2002 0:00 YSAS700 B 368.5 Refreshers SSS 0 12/27/2002 0:00 YSAS800 B 726 Refreshers SSS 0 12/27/2002 0:00 YSAS900 B 11 Scoring Key/Material SSS 0 12/31/1899 0:00 YSASA10 B 49.5 Manual SSS 0 12/27/2002 0:00 YSASA20 B 33 Manual SSS 0 12/27/2002 0:00 YSASA3 B 11 Scoring Key/Material SSS 0 12/31/1899 0:00 YSASA30 33 0 12/31/1899 0:00SASA40 B 132 Kit SSS 0 12/27/2002 0:00 YSASA50 B 52.25 Profiles SSS 0 12/27/2002 0:00 YSASA60 B 176 Profiles SSS 0 12/27/2002 0:00 YSASA70 B 192.5 Refreshers SSS 0 12/27/2002 0:00 YSASA80 B 368.5 Refreshers SSS 0 12/27/2002 0:00 YSASA90 B 726 Refreshers SSS 0 12/27/2002 0:00 YSASC10 B 27 Interview Guide/Bklt SAS 0 8/18/2000 0:00 NSASF10 B 38 QuikScore Form SAS 0 10/12/2000 0:00 YSASF20 B 27 Interview Guide/Bklt SAS 0 10/12/2000 0:00 YSASF30 B 0 QuikScore Form SAS 0 12/31/1899 0:00 YSASKT0 B 107 Kit SAS 0 5/14/1999 0:00 ySASP10 B 53 Manual SAS 0 5/14/1999 0:00 ySASP40 B 40 QuikScore Form SAS 0 12/31/1899 0:00 ySASP50 B 144 QuikScore Form SAS 0 5/14/1999 0:00 ySASP60 B 28.5 Test Booklet SAS 0 5/14/1999 0:00 ySASPK0 B 107 Kit SAS 0 5/14/1999 0:00 NSASPS0 B 57.75 Specimen Set SAS 0 5/14/1999 0:00 ySASQ10 A 89 Refreshers SSQ 0 12/31/1899 0:00 YSASQ1O A 89 Refreshers SSQ 0 12/31/1899 0:00 NSASQ20 A 0 Refreshers SSQ 0 12/31/1899 0:00 NSASS10 B 40 QuikScore Form SAS 0 10/18/1999 0:00 NSASS20 B 144 QuikScore Form SAS 0 10/18/1999 0:00 NSASS30 B 28.5 Interview Guide/Bklt SAS 0 10/18/1999 0:00 NSASUSCVR 0 Misc 0 12/31/1899 0:00SAT1R A 43.95 Book FDO 0 12/31/1899 0:00 YSC2D0A B 66 Manual SCD 0 1/1/1988 0:00 YSC3D0A B 39.5 Answer/Data Sheets SCD 0 1/1/1988 0:00 YSC4D0A B 101.5 Kit SCD 0 1/1/1988 0:00 YSCBE10 B 91 Kit SBE 0 12/31/1899 0:00 YSCBE20 B 53 Manual SBE 0 12/31/1899 0:00 YSCBE30 B 44 Answer/Data Sheets SBE 0 12/31/1899 0:00 YSCCZ10 B 55 Profiles PAN 0 12/31/1899 0:00 0SCFN10 B 55 Profiles PAN 0 12/31/1899 0:00 0SCHG10 B 55 Profiles PAN 0 12/31/1899 0:00 0SCID1A B 126.5 Kit SCV 0 1/1/1988 0:00 ySCID2A B 47.5 Manual SCV 0 1/1/1988 0:00 ySCID3A B 43.25 Test Booklet SCV 0 1/1/1988 0:00 ySCID4A B 39.5 Answer/Data Sheets SCV 0 1/1/1988 0:00 ySCID5A B 85.5 Kit SCV 0 1/1/1997 0:00 ySCID6A B 83 Manual SCV 0 1/1/1997 0:00 y
SCID7A B 39.5 Interview Guide/Bklt SCV 0 1/1/1997 0:00 ySCIDCVR 0 Misc 0 12/31/1899 0:00SCIPS1 B 55 Interview Guide/Bklt PAN 0 12/31/1899 0:00 NSCP1RA A 32.95 Book SCP 0 1/1/1998 0:00 YSCQ1 B 0 Answer/Data Sheets 0 12/31/1899 0:00 0SCQ2 B 0 Scoring Key/Material 0 12/31/1899 0:00 0SCQ3 B 0 Scoring Key/Material 0 12/31/1899 0:00 0SCQ4 B 0 Manual 0 12/31/1899 0:00 0SCQ5 B 0 Scoring Key/Material 0 12/31/1899 0:00 0SCQ6 B 0 Scoring Key/Material 0 12/31/1899 0:00 0SCRS10 B 55 Profiles PAN 0 12/31/1899 0:00 0SCSSPQCVR 0 Misc 0 12/31/1899 0:00SEC01 B 130 Kit SEC 0 12/31/1899 0:00 1SEC02 B 70 Kit SEC 0 12/31/1899 0:00 1SEC03 B 0 Manual SEC 0 12/31/1899 0:00 1SEC04 B 0 Admin. Material SEC 0 12/31/1899 0:00 1SEC05 B 0 Admin. Material SEC 0 12/31/1899 0:00 1SEC06 B 0 Admin. Material SEC 0 12/31/1899 0:00 1SEC07 B 0 Admin. Material SEC 0 12/31/1899 0:00 1SEC08 B 0 Admin. Material SEC 0 12/31/1899 0:00 1SEC09 B 0 Admin. Material SEC 0 12/31/1899 0:00 1SEC10 B 0 Admin. Material SEC 0 12/31/1899 0:00 0SEC11 B 0 Admin. Material SEC 0 12/31/1899 0:00 1SEC13 B 30 Manual SEC 0 12/31/1899 0:00 1SEC14 B 0 Manual SEC 0 12/31/1899 0:00 1SETKTA A 74 Kit SET 0 1/1/1997 0:00 YSETMNC A 38.5 Manual SET 0 1/1/1997 0:00 ySETW1B A 38 Workbook/Worksheet SET 0 1/1/1997 0:00 ySETW2B A 74 Workbook/Worksheet SET 0 1/1/1997 0:00 ySH1BD2 A 0 SW DOS SHR 0 1/1/1996 0:00 NSH1BM2 A 0 SW DOS SHR 0 1/1/1996 0:00 NSH1D3O A 45 SW DOS SHR 0 1/1/1996 0:00 NSH1DDO A 0 SW DOS SHR 0 1/1/1996 0:00 NSH1F3M A 695 SW DOS SHR 0 1/1/1996 0:00 NSH1FDP A 0 SW DOS SHR 0 1/1/1996 0:00 NSH1FGP A 0 SW DOS SHR 0 1/1/1996 0:00 NSH1MF1 A 125 Maintenance SHR 0 1/1/1989 0:00 NSH1NGX A 550 SW DOS SHR 0 1/1/1996 0:00 NSH1PGT A 200 SW DOS SHR 0 1/1/1996 0:00 NSH1U3N A 750 SW Unlock SHR 0 1/1/1996 0:00 NSH1W38 A 0 SW 16Bit SHR 0 1/1/1996 0:00 NSH2BD2 A 0 SW DOS SHR 0 1/1/1996 0:00 NSH2BM2 A 0 SW DOS SHR 0 1/1/1996 0:00 NSH2D3S A 45 SW DOS SHR 0 1/1/1996 0:00 NSH2DDS A 0 SW DOS SHR 0 1/1/1995 0:00 NSH2F3Q A 790 SW DOS SHR 0 1/1/1996 0:00 NSH2FDT A 0 SW DOS SHR 0 1/1/1996 0:00 NSH2FGT A 0 SW DOS SHR 0 1/1/1996 0:00 NSH2NGX A 550 SW DOS SHR 0 1/1/1996 0:00 NSH2U3R A 950 SW DOS SHR 0 1/1/1996 0:00 NSH3F3Y A 1345 SW DOS SHR 0 1/1/1996 0:00 NSH3FDX A 0 SW DOS SHR 0 1/1/1996 0:00 NSH3FGT A 0 SW DOS SHR 0 1/1/1996 0:00 NSH3MF1 A 250 Maintenance SHR 0 1/1/1992 0:00 N
SH3N1X A 250 SW DOS SHR 0 1/1/1993 0:00 NSH3N4X A 925 SW DOS SHR 0 1/1/1993 0:00 NSH4F3Y A 1545 SW DOS SHR 0 1/1/1996 0:00 NSH4FDY A 0 SW DOS SHR 0 1/1/1996 0:00 NSH4FGT A 0 SW DOS SHR 0 1/1/1996 0:00 NSH5BD2 A 0 SW DOS SHR 0 1/1/1989 0:00 NSH5D3C A 45 SW DOS SHR 0 1/1/1989 0:00 NSH5DDC A 0 SW DOS SHR 0 1/1/1989 0:00 NSH5F3A A 395 SW DOS SHR 0 1/1/1989 0:00 NSH5FDD A 0 SW DOS SHR 0 1/1/1989 0:00 NSH5FGD A 0 SW DOS SHR 0 1/1/1989 0:00 NSH5G3D A 400 SW DOS SHR 0 1/1/1989 0:00 NSH5PGD A 550 SW DOS SHR 0 1/1/1989 0:00 NSH5U3B A 350 SW Unlock SHR 0 1/1/1989 0:00 NSH6CEW A 125 EMC SHR 0 1/1/1992 0:00 0SH6FDU A 0 EMC SHR 0 1/1/1993 0:00 0SH6MCW A 17.55 EMC SHR 0 1/1/1995 0:00 0SH6MMW A 0 EMC SHR 0 1/1/1995 0:00 0SH6MNZ A 0 Manual SHR 0 1/1/1988 0:00 NSH7F35 A 0 SW DOS SHR 0 1/1/1992 0:00 NSH7FD5 A 45 SW DOS SHR 0 1/1/1992 0:00 NSH7MF1 A 0 SW DOS SHR 0 1/1/1992 0:00 NSH7U35 A 0 SW Unlock SHR 0 1/1/1992 0:00 NSH8CN6 A 100 SW Conversion SHR 0 1/1/1996 0:00 NSH8D3O A 45 SW DOS SHR 0 1/1/1996 0:00 NSH8F3M A 595 SW DOS SHR 0 1/1/1996 0:00 NSH8U3N A 550 SW Unlock SHR 0 1/1/1996 0:00 NSH9D3S A 45 SW DOS SHR 0 1/1/1996 0:00 0SH9F3Q A 795 SW DOS SHR 0 1/1/1996 0:00 NSH9U3R A 750 SW Unlock SHR 0 1/1/1996 0:00 NSHCNV5 A 250 SW Conversion SHR 0 1/1/1993 0:00 NSHCON5 A 0 SW Conversion SHR 0 1/1/1993 0:00 NSHDD3C A 45 SW DOS SHR 0 1/1/1989 0:00 NSHDRGP A 0 Misc. SHR 0 1/1/1988 0:00 NSHED30 A 0 SW 16Bit SHR 0 12/31/1899 0:00SHEK10 A 0 SW 16Bit SHR 0 12/31/1899 0:00SHEM20 A 0 Admin. Material SHR 0 12/31/1899 0:00SHRMNZ A 35 Manual SHR 0 1/1/1988 0:00 NSHROT1 A 75 SW 16Bit SHT 0 5/30/2000 0:00 NSHRVCV A 0 Video SHR 0 1/1/1996 0:00 NSHRVTP A 0 Video SHR 0 1/1/1996 0:00 NSHTR10 A 75 SW 16Bit SHT 0 4/13/2000 0:00 NSHTR20 A 100 SW 16Bit SHT 0 4/13/2000 0:00 NSHTRNE A 39 Video SHR 0 1/1/1996 0:00 NSHWKP9 A 165 Workshop SHR 0 1/1/1996 0:00 NSHWWKB B 35 Workbook/Worksheet SHR 0 12/31/1899 0:00 NSINMR0 25 Book SMR 0 12/31/1899 0:00SIPA10 B 125 Kit SIP 0 12/31/1899 0:00 YSIPA20 B 44 Manual SIP 0 12/31/1899 0:00 YSIPA30 B 44 Admin. Material SIP 0 12/31/1899 0:00 YSIPA40 B 44 Answer/Data Sheets SIP 0 12/31/1899 0:00 YSIT10A B 48.5 Manual SIT 0 12/31/1899 0:00 YSIT20A B 33 Answer/Data Sheets SIT 0 12/31/1899 0:00 YSIT30A B 48 Manual SIT 0 12/31/1899 0:00 Y
SIT40A B 108 Kit SIT 0 12/31/1899 0:00 NSIT50A B 108 Kit SIT 0 12/31/1899 0:00 YSIT60A B 11 Manual SIT 0 1/1/1988 0:00 YSM1R0A A 15.5 Book SMT 0 1/1/1988 0:00 YSM2R0A A 23.95 Book SMA 0 1/1/1997 0:00 NSMDCVR 0 Misc 0 12/31/1899 0:00SNT1RA A 47.5 Book STN 0 1/1/1988 0:00 NSO1R0A A 12 Book SOH 0 1/1/1988 0:00 NSO1RCA A 0 Book SOH 0 1/1/1998 0:00 NSO2TAA A 11.95 Audio HTU 0 1/1/1988 0:00 NSO3R0A A 175 Video SOH 0 1/1/1988 0:00 NSO4R0A A 15.5 Book SOE 0 1/1/1998 0:00 YSOPACCVR 0 Misc 0 12/31/1899 0:00SP1P0A B 63 Kit SPA 0 1/1/1988 0:00 ySP1R0A A 25.5 Book PFC 0 1/1/1988 0:00 NSP2P0B B 41 Manual SPA 0 1/1/1996 0:00 ySP3P0C B 31.5 QuikScore Form SPA 0 1/1/1988 0:00 ySP3PSC B 0 QuikScore Form SPA 0 1/1/1988 0:00 NSP4P0C B 116 QuikScore Form SPA 0 1/1/1988 0:00 ySP5P0D B 42 Specimen Set SPA 0 1/1/1988 0:00 ySP6PRT B 30 QuikScore Form SPA 0 2/19/1999 0:00 NSP7PRT B 110 QuikScore Form SPA 0 2/19/1999 0:00 NSP8FR0 B 30 QuikScore Form SPA 0 11/5/1999 0:00 YSPAN01 B 94 Kit SPA 0 3/6/2002 0:00 NSPAN02 B 74 Kit SPA 0 3/6/2002 0:00 1SPAN03 B 40 Answer/Data Sheets SPA 0 3/6/2002 0:00 1SPARDS B 0 Online Use SPA 0 12/31/1899 0:00 0SPC10A B 63 Kit SPC 0 1/1/1997 0:00 ySPC20B B 40.75 Manual SPA 0 1/1/1997 0:00 NSPC30C B 31.5 QuikScore Form SPA 0 1/1/1997 0:00 NSPC40D B 40 Specimen Set SPA 0 1/1/1997 0:00 NSPC5FR B 37 QuikScore Form SPA 0 11/5/1999 0:00 NSPC6SP B 31.5 QuikScore Form SPC 0 2/21/2000 0:00 YSPCP10 B 30 QuikScore Form SPA 0 12/31/1899 0:00 0SPKSO1 A 0 Online Use wks 0 12/31/1899 0:00 0SPLRDS B 0 Online Use SPS 0 12/31/1899 0:00 1SPS01 B 90.5 Kit SPS 0 12/31/1899 0:00 YSPS02 B 64 Kit SPS 0 12/31/1899 0:00 YSPS03 B 62 Kit SPS 0 12/31/1899 0:00 YSPS04 B 42 Specimen Set SPS 0 12/31/1899 0:00 YSPS05 B 41 Manual SPS 0 12/31/1899 0:00 YSPS06 B 31.5 QuikScore Form SPS 0 12/31/1899 0:00 YSPS07 B 112.5 QuikScore Form SPS 0 12/31/1899 0:00 YSPS08 B 29.5 QuikScore Form SPS 0 12/31/1899 0:00 YSPS09 B 108 QuikScore Form SPS 0 12/31/1899 0:00 YSPSI1A B 11 Manual SPS 0 1/1/1998 0:00 NSPSI2B B 10.5 Answer/Data Sheets SPS 0 1/1/1998 0:00 NSPSI3C B 8.5 Answer/Data Sheets SPS 0 1/1/1998 0:00 NSQP10B C 40 Manual CSQ 0 1/1/1998 0:00 NSQP20C C 30 Test Booklet CSQ 0 1/1/1998 0:00 0SQP30D C 25 Answer/Data Sheets CSQ 0 1/1/1998 0:00 NSQPK00 C 75 Kit CSQ 0 12/31/1899 0:00 NSQPS00 C 45 Specimen Set CSQ 1 12/31/1899 0:00 NSRCVR 0 Misc 0 12/31/1899 0:00
SS1F3A A 175 SW DOS SSI 0 1/1/1988 0:00 NSS1MAA A 225 SW - Macintosh SSI 0 1/1/1988 0:00 NSS1W3A A 225 SW 16Bit SSI 0 1/1/1996 0:00 NSS2F3A A 425 SW DOS SSI 0 1/1/1988 0:00 NSS2MAA A 425 SW - Macintosh SSI 0 1/1/1988 0:00 NSS2W3A A 425 SW 16Bit SSI 0 1/1/1996 0:00 NSS2W3F B 225 SW 16Bit SSI 0 9/1/2000 0:00 YSS3D3A B 45 SW DOS SSP 0 1/1/1992 0:00 NSS3O3E B 0 SW DOS SSP 0 1/1/1992 0:00 NSSA010 A 16.5 Book wha 0 10/1/1999 0:00 YSSR1RA A 40.95 Book SST 0 1/1/1998 0:00 YST103B B 0 SW DOS STA 0 1/1/1988 0:00 NST1A00 A 25 Audio SLP 0 12/31/1899 0:00 yST1F3A B 100 SW DOS STA 0 1/1/1989 0:00 NST1P0E B 70 Kit STA 0 1/1/1997 0:00 yST2P0C B 35 Answer/Data Sheets STA 0 1/1/1997 0:00 yST3P0D B 15 Scoring Key/Material STA 0 1/1/1988 0:00 NST4P0H B 35 Bibliography STA 0 1/1/1997 0:00 yST5P0G B 0 Manual STA 0 1/1/1997 0:00 NSTAIB0 B 0 SW 16Bit STC 0 12/31/1899 0:00 NSTAID0 B 45 SW 16Bit STC 0 12/31/1899 0:00 YSTAIE0 B 25 Answer/Data Sheets STC 0 7/30/1999 0:00 YSTAIM0 B 0 Manual STC 0 12/31/1899 0:00 NSTAIT0 B 45 SW 16Bit STC 0 12/31/1899 0:00 NSTAIW0 B 1.5 SW Refresher STC 0 12/31/1899 0:00 YSTAXI10 B 0 Answer/Data Sheets NON 0 12/31/1899 0:00 0STP01 B 0 Profiles 0 12/31/1899 0:00 0STP02 B 0 Scoring Key/Material 0 12/31/1899 0:00 0STP03 B 0 Manual 0 12/31/1899 0:00 0STP04 B 0 Profiles 0 12/31/1899 0:00 0STP05 B 0 Profiles 0 12/31/1899 0:00 0STP06 B 0 SW 16Bit 0 12/31/1899 0:00 0SVTM1R A 32.95 Book STM 0 12/20/2001 0:00 YSW4S0A A 43 Stopwatch STO 0 1/1/1988 0:00 YSW4STA A 149.5 Stopwatch STO 0 1/1/1988 0:00 NSWPAN1 B 100 Kit PAN 0 12/31/1899 0:00 NTAT10A C 63 Kit TAT 0 1/1/1988 0:00 YTC100A A 165 Book TCA 0 1/1/1988 0:00 NTC1R0A A 21.95 Book TIC 0 1/1/1988 0:00 NTCA1RA A 18.95 Book TDA 0 1/1/1988 0:00 YTCD1R0 A 38.5 Book TCD 0 12/28/2000 0:00 NTCS1RA A 97 Book TAB 0 1/1/1988 0:00 YTCSAVA A 105 Video TCS 0 12/31/1899 0:00 YTD1F3A A 225 SW DOS TDS 0 1/1/1988 0:00 NTD1MAA A 225 SW - Macintosh TDS 0 1/1/1988 0:00 NTD1P0C B 40 Manual TDM 0 1/1/1992 0:00 yTD1W3A A 225 SW 16Bit TDS 0 1/1/1996 0:00 NTD2P0A B 99.75 Kit TDM 0 1/1/1992 0:00 yTD2W3F B 225 SW 16Bit TDS 0 9/1/2000 0:00 YTD3P0B B 42 Specimen Set TDM 0 1/1/1994 0:00 yTD4P0D B 21 QuikScore Form TDM 0 1/1/1992 0:00 YTD4PSD B 0 QuikScore Form TDM 0 1/1/1992 0:00 NTD5P0E B 21 QuikScore Form TDM 0 1/1/1992 0:00 yTD5PSE B 0 QuikScore Form TDM 0 1/1/1992 0:00 N
TD6P0F B 31.5 Admin. Material TDM 0 1/1/1992 0:00 yTD6PSF B 0 Admin. Material TDM 0 1/1/1992 0:00 NTEB1R0 A 32.95 Book TEB 0 12/20/2001 0:00 YTECDEV 0 Consulting NON 0 11/8/2002 0:00TECFEE A 0 None TEC 0 6/27/2002 0:00 0TFB1R0 A 32.95 Book TFB 0 12/28/2000 0:00 YTFB2R 29.95 0 12/31/1899 0:00TFB2R0 A 32.95 Book TFB 0 12/28/2000 0:00 YTFDG1A B 35 Admin. Material TFD 0 1/1/1996 0:00 NTG1R0A A 33 Book THE 0 1/1/1988 0:00 NTI1A0A A 25 Audio TIP 0 1/1/1996 0:00 yTI1P0Q B 25.25 Admin. Material CRO 0 1/1/1990 0:00 yTIC1 B 71.5 Reorder Kit 0 12/31/1899 0:00 0TIC2 B 22 Manual 0 12/31/1899 0:00 0TIC3 B 55 Report Paper 0 12/31/1899 0:00 0TLI4PA B 197 Kit TLD 0 1/1/1988 0:00 YTLI5PA B 82.5 Manual TLD 0 1/1/1988 0:00 YTLI6PA B 44 Admin. Material TLD 0 1/1/1988 0:00 YTLI7PA B 72.5 Admin. Material TLD 0 1/1/1988 0:00 YTLIMAA B 108 SW - Macintosh TLD 0 1/1/1988 0:00 YTLIW0A B 108 SW 16Bit TLD 0 1/1/1988 0:00 YTLP1PA B 270 Kit TLP 0 1/1/1988 0:00 YTLP2PA B 89 Manual TLP 0 1/1/1988 0:00 YTLP3PA B 61 Admin. Material TLP 0 1/1/1988 0:00 YTLP4PA B 108 Admin. Material TLP 0 1/1/1988 0:00 NTLPMAA B 108 SW - Macintosh TLP 0 1/1/1988 0:00 YTLPW0A B 108 SW 16Bit TLP 0 1/1/1988 0:00 YTLRP1 B 236.25 Kit TOL 0 12/31/1899 0:00 YTLRP2 B 60.5 Manual TOL 0 12/31/1899 0:00 YTLRP2CVR B 0 Manual TOL 0 12/31/1899 0:00 NTLRP3 B 31.5 QuikScore Form TOL 0 12/31/1899 0:00 YTLRP4 B 31.5 QuikScore Form TOL 0 12/31/1899 0:00 YTLRP50 B 57.75 Admin. Material TOL 0 1/1/1998 0:00 0TLRPA C 204.75 Kit TOL 0 7/16/2001 0:00 YTLRPC C 204.75 Kit TOL 0 7/16/2001 0:00 YTLRV1A B 205 Kit TOL 0 1/1/1998 0:00 NTLRV2B B 45 Manual TOL 0 1/1/1998 0:00 NTLRV3C B 25 Answer/Data Sheets TOL 0 1/1/1998 0:00 NTLRV4C B 25 Answer/Data Sheets TOL 0 1/1/1998 0:00 NTLRV5D B 110 Admin. Material TOL 0 1/1/1998 0:00 NTN6P0A B 281 Kit TON 0 1/1/1997 0:00 YTN78PA B 105 Admin. Material TON 0 1/1/1988 0:00 NTN7P0A B 74 Manual TON 0 1/1/1988 0:00 YTN8P0A B 44 Answer/Data Sheets TON 0 1/1/1988 0:00 YTN9P0A B 44 Answer/Data Sheets TON 0 1/1/1988 0:00 YTO1P0A C 242 Kit TML 0 1/1/1988 0:00 YTO2P0A C 48.5 Manual TML 0 1/1/1988 0:00 NTO3P0A C 65 Admin. Material TML 0 1/1/1988 0:00 NTO4P0A C 49.5 Admin. Material TML 0 1/1/1988 0:00 YTO5P0A C 0 Admin. Material TML 0 1/1/1988 0:00 NTOM10A C 105 Kit TOM 0 1/1/1996 0:00 yTOM20B C 41 Manual TOM 0 1/1/1996 0:00 yTOM30C C 56 Admin. Material TOM 0 1/1/1996 0:00 yTOM40D C 22 Answer/Data Sheets TOM 0 1/1/1996 0:00 y
TOMF1C C 0 Admin. Material TOM 0 1/1/1996 0:00 NTOMF2C C 0 Admin. Material TOM 0 1/1/1996 0:00 NTOMF3C C 0 Admin. Material TOM 0 1/1/1996 0:00 NTOMMSWCVR 0 Misc 0 12/31/1899 0:00TP1R0A A 0 Book TAC 0 1/1/1988 0:00 NTP1V1C A 0 Video TPV 0 1/1/1996 0:00 NTP1V2D A 0 Video TPV 0 1/1/1996 0:00 NTP1V3B A 100 Workbook/Worksheet TPV 0 1/1/1996 0:00 YTP1V9E A 100 Manual TPV 0 1/1/1996 0:00 NTP1VVA A 495 Video TPV 0 1/1/1996 0:00 YTP2S0A A 22.95 Book TPS 0 1/1/1988 0:00 NTR1R0A A 121 Book RSH 0 1/1/1988 0:00 YTR2R0A A 121 Book RSH 0 1/1/1988 0:00 YTR3R0A A 121 Book RSH 0 1/1/1988 0:00 YTR4R0A A 325 Book RSH 0 1/1/1988 0:00 YTR5R0A A 104.5 Book RSH 0 11/1/2003 0:00 0TRANS0 A 0 Translation TRN 0 12/31/1899 0:00 NTS1R0A A 18.95 Book TNK 0 1/1/1988 0:00 NTS2R0A A 75 Book TSA 0 1/1/1988 0:00 NTS3R0A A 66 Book TRS 0 1/1/1988 0:00 NTSCC10 B 0 Kit NON 0 12/31/1899 0:00TT1A0A A 25 Audio SCT 0 1/1/1996 0:00 yTT1AAB A 0 Audio SCT 0 1/1/1996 0:00 NTT1AMC A 0 Audio SCT 0 1/1/1996 0:00 NTVP10A B 180 Kit TVP 0 1/1/1988 0:00 YTVP20A B 34 Manual TVP 0 1/1/1988 0:00 YTVP30A B 127 Admin. Material TVP 0 1/1/1988 0:00 YTVP40A B 19.5 Answer/Data Sheets TVP 0 1/1/1988 0:00 YTVU10A B 137.5 Kit TVP 0 1/1/1997 0:00 YTVU20A B 32 Manual TVP 0 1/1/1997 0:00 YTVU30A B 88 Admin. Material TVP 0 1/1/1997 0:00 YTVU40A B 17.5 Answer/Data Sheets TVP 0 1/1/1997 0:00 YTWEIFD 0 Workshop EQW 0 12/31/1899 0:00 0TWEIOF 0 Workshop EQW 0 12/31/1899 0:00 0TWMD20 A 27.5 Book TRO 0 1/23/2002 0:00 YTWMDRA A 49.5 Book TRO 0 12/31/1899 0:00 YUAR1R A 49.5 Book FDO 0 12/31/1899 0:00 NUC1P0A B 193 Kit UCC 0 1/1/1996 0:00 NUC2P0A B 38.5 Manual UCC 0 1/1/1996 0:00 NUC3P0A B 33 Answer/Data Sheets UCC 0 1/1/1996 0:00 NUC4P0A B 33 Admin. Material UCC 0 1/1/1996 0:00 NUC5P0A B 33 Admin. Material UCC 0 1/1/1996 0:00 NUC6P0A B 133 Reorder Kit UCC 0 1/1/1996 0:00 NUKCAT0 A 0 Info Pak INF 0 12/31/1899 0:00 0UMCC0A A 143 Book UCB 0 1/1/1988 0:00 YUPMMPI C 399 Upgrade MMP 0 12/31/1899 0:00UPRIAP C 79 Upgrade RIA 0 12/31/1899 0:00 0UPTT0A A 120 Book UPT 0 1/1/1988 0:00 YUPWCST C 165 Upgrade WCS 0 12/31/1899 0:00UPWCV3 C 273 Upgrade WCS 0 12/31/1899 0:00 0USCAT A 0 Info Pak INF 0 1/1/1995 0:00 0USCATA A 0 Info Pak INF 0 1/1/1995 0:00 NUSCATI B 0 Info Pak INF 0 12/4/2001 0:00 0UV2R0A A 28.95 Book UNV 0 1/1/1997 0:00 N
VA2R0A A 55 Book VAT 0 1/1/1988 0:00 YVC200A A 130 Video DCV 0 1/1/1988 0:00 NVC300A A 130 Video DCV 0 1/1/1988 0:00 NVC400A A 197.95 Video DCV 0 1/1/1988 0:00 NVCMDO A 60 Book VCM 0 12/20/2001 0:00 YVDJKT3 A 0 Video INF 0 1/1/1996 0:00 NVR10VA A 0 Video AVS 0 1/1/1996 0:00 NVR11VA A 0 Video AKD 0 1/1/1996 0:00 NVR1V0A A 60 Video VRF 0 1/1/1996 0:00 NVR2V0A A 65 Video GLM 0 1/1/1996 0:00 NVR3V0A A 60 Video LLC 0 1/1/1996 0:00 NVR4V0A A 55 Video LBT 0 1/1/1996 0:00 NVR5V0A A 39.5 Video RMW 0 1/1/1996 0:00 NVR6V0A A 0 Video SCC 0 1/1/1996 0:00 NVR7V0A A 57.5 Video AVM 0 1/1/1996 0:00 NVR8V0A A 60 Video YDD 0 1/1/1996 0:00 NVR9V0A A 60 Video VRC 0 1/1/1996 0:00 NVRTA1R A 32.95 Book VRT 0 12/20/2001 0:00 YW1F00A C 449 SW DOS WII 0 1/1/1998 0:00 NW2P00B C 30 Answer/Data Sheets WII 0 1/1/1998 0:00 NW3P00B C 30 Answer/Data Sheets WII 0 1/1/1998 0:00 NW4P00B C 30 Answer/Data Sheets WII 0 1/1/1998 0:00 NWA1F3A C 200 SW DOS WAI 0 1/1/1988 0:00 NWA1FMA C 250 SW - Macintosh WAI 0 1/1/1988 0:00 NWA1MAA C 250 SW - Macintosh WAI 0 1/1/1997 0:00 NWA1W3A C 250 SW 16Bit WAI 0 1/1/1996 0:00 NWC1P0A C 335 Kit WCS 0 1/1/1988 0:00 YWC2P0A C 46.2 Answer/Data Sheets WCS 0 1/1/1988 0:00 YWC2R0A A 16.95 Book WCN 0 1/1/1988 0:00 YWC2W00 C 595 SW 16Bit WCS 0 8/16/1999 0:00 YWC3P0A C 167 Admin. Material WCS 0 1/1/1988 0:00 YWC3W00 C 679 SW 16Bit WCS 0 8/16/1999 0:00 YWC4B0A C 949 SW DOS WCS 0 1/1/1988 0:00 NWC4P0A C 106.7 Manual WCS 0 1/1/1988 0:00 YWC4W00 C 679 SW 16Bit WCS 0 12/31/1899 0:00 0WC5BW0 C 639 SW 16Bit WCS 0 2/8/2000 0:00 YWC5P0A C 17.6 SW DOS WCS 0 1/1/1988 0:00 NWC642 C 520 SW 16Bit CPW 0 1/1/2001 0:00 0WC64RF C 36 Interview Guide/Bklt WCS 0 12/31/1899 0:00 YWC6BW0 C 389 SW 16Bit WCS 0 2/8/2000 0:00 YWC6P0A C 17.5 Answer/Data Sheets WCS 0 1/1/1996 0:00 NWC6V2S C 279 SW 16Bit CPW 0 12/31/1899 0:00 0WCCV4 C 620 SW 16Bit CPW 0 1/1/2001 0:00 0WCS10A C 253 Kit WCS 0 1/1/2001 0:00 YWCS20A C 106.7 Manual WCS 0 1/1/2001 0:00 YWCS30A C 40.7 Interview Guide/Bklt WCS 0 1/1/2001 0:00 YWCS40A C 73.7 Interview Guide/Bklt WCS 0 1/1/2001 0:00 YWCS50A C 90.2 Misc. WCS 0 1/1/2001 0:00 YWCS6V2 C 495 SW 16Bit WCS 0 11/3/2003 0:00 0WCS6W0 C 520 SW 16Bit WCS 0 1/1/2001 0:00 NWCS7W0 C 290 SW 16Bit WCS 0 1/1/2001 0:00 YWCSP2 C 290 SW 16Bit CPW 0 1/1/2001 0:00 0WCSP4 C 405 SW 16Bit CPW 0 1/1/2001 0:00 0WCSPU C 55 SW 16Bit WCS 0 1/1/2001 0:00 0
WCUP C 55 SW 16Bit WCS 0 1/1/2001 0:00 0WCV4SK C 639 Reorder Kit CPW 0 12/31/1899 0:00 0WCVS4K C 679 SW 16Bit CPW 0 12/31/1899 0:00 0WI2FMA C 300 SW - Macintosh WIS 0 1/1/1988 0:00 NWI2W3A C 300 SW 16Bit WIS 0 1/1/1996 0:00 NWI2W3F B 300 SW 16Bit WIS 0 9/1/2000 0:00 YWIF10A A 57 Book WIF 0 12/31/1899 0:00 YWKEQ01 B 1500 Kit EQI 0 3/4/2002 0:00 0WKEQ02 B 1400 Kit EQI 0 3/7/2002 0:00 NWLS1V A 229 Video EQV 0 2/25/2002 0:00 NWLS2V0 A 69.95 Video EQV 0 12/31/1899 0:00 YWLS3V0 A 849 Kit EQV 0 12/31/1899 0:00 YWMBW10 A 25 Book WMB 0 12/31/1899 0:00 NWR220A B 38.5 Misc. WRA 0 1/1/1988 0:00 YWR910A B 49.5 Manual WRA 0 1/1/1988 0:00 YWR92BA B 38.5 Answer/Data Sheets WRA 0 1/1/1988 0:00 YWR92TA B 38.5 Answer/Data Sheets WRA 0 1/1/1988 0:00 YWR930A B 27.5 Profiles WRA 0 1/1/1988 0:00 YWR950A B 16.5 Admin. Material WRA 0 1/1/1988 0:00 YWR980A B 38.5 Answer/Data Sheets WRA 0 1/1/1988 0:00 NWR9P0A B 165 Kit WRA 0 1/1/1988 0:00 YWR9W0A B 129 SW 16Bit WRA 0 1/1/1998 0:00 YWRAMLA B 358 Kit WRV 0 1/1/1988 0:00 NWRAV1A B 320 Kit WRV 0 1/1/1997 0:00 YWRAV2A B 49.5 Manual WRV 0 1/1/1997 0:00 YWRAV3A B 49.5 Admin. Material WRV 0 1/1/1997 0:00 YWRAV4A B 55 Answer/Data Sheets WRV 0 1/1/1997 0:00 YWRAV5A B 55 Answer/Data Sheets WRV 0 1/1/1997 0:00 YWRAV6A B 55 Admin. Material WRV 0 1/1/1997 0:00 NWRAV7A B 42 Admin. Material WRV 0 1/1/1997 0:00 NWRAV8A B 42 Misc. WRV 0 1/1/1997 0:00 NWRE10A B 215 Kit WRA 0 12/21/2001 0:00 YWRE20A B 105 Kit WRA 0 12/21/2001 0:00 YWRE30A B 105 Kit WRA 0 12/21/2001 0:00 YWRE40A B 105 Kit WRA 0 12/21/2001 0:00 YWRE50A B 105 Kit WRA 0 12/21/2001 0:00 YWRE60A B 105 Kit WRA 0 12/21/2001 0:00 YWRE70A B 215 Kit WRA 0 12/21/2001 0:00 YWS3AUG 329 Workshop E3W 0 12/31/1899 0:00 1WS3FEB A 329 Workshop E3W 0 12/31/1899 0:00 1WS3JUL 329 Workshop E3W 0 12/31/1899 0:00 1WS3NOV 329 Workshop E3W 0 12/31/1899 0:00 1WS3OCT 329 Workshop E3W 0 12/31/1899 0:00 1WS3SEP 329 Workshop E3W 0 12/31/1899 0:00 1WSACAU 0 Workshop EQW 0 12/31/1899 0:00 0WSACJU 0 Workshop eqw 0 12/31/1899 0:00 0WSACND 0 Workshop eqw 0 12/31/1899 0:00 0WSACNV 0 Workshop eqw 0 12/31/1899 0:00 0WSACOC 0 Workshop EQW 0 12/31/1899 0:00 0WSACSP 0 Workshop eqw 0 12/31/1899 0:00 0WSCL36 75 Workshop E3W 0 12/31/1899 0:00 0WSCLEQ 75 Workshop EQW 0 12/31/1899 0:00 0WSCLMS 75 Workshop MSW 0 12/31/1899 0:00 0WSCLYV 75 Workshop EYW 0 12/31/1899 0:00 0
WSCOMA B 350 Kit EQW 0 12/31/1899 0:00 0WSCOMB B 350 Kit EQW 0 12/31/1899 0:00 0WSCOMC B 0 Kit EQW 0 12/31/1899 0:00 0WSCOMD B 450 Kit EQW 0 12/31/1899 0:00 0WSCOME B 150 Kit EQW 0 12/31/1899 0:00 0WSE360 329 Kit E3W 0 1/1/1997 0:00 0WSEQAU 1650 Workshop EQW 0 12/31/1899 0:00 1WSEQFB A 1650 Workshop EQW 0 12/31/1899 0:00 1WSEQJU 1650 Workshop eqw 0 12/31/1899 0:00 1WSEQNV 1650 Workshop eqw 0 12/31/1899 0:00 1WSEQOC 1650 Workshop eqw 0 12/31/1899 0:00 1WSEQSP 1650 Workshop eqw 0 12/31/1899 0:00 1WSKWKIN 0 Workshop MSW 0 12/31/1899 0:00 0WSMSAU 1650 Workshop MSW 0 12/31/1899 0:00 1WSMSCA B 0 Kit MSW 0 12/31/1899 0:00 0WSMSCB B 150 Kit MSW 0 12/31/1899 0:00 0WSMSJU 1650 Workshop msw 0 12/31/1899 0:00 1WSMSSP 1650 Workshop MSW 0 12/31/1899 0:00 1WSTR36 50 Workshop E3W 0 12/31/1899 0:00 0WSTREQ 75 Workshop EQW 0 12/31/1899 0:00 0WSTRMS 50 Workshop MSW 0 12/31/1899 0:00 0WSTRR1 1650 Workshop EQW 0 12/31/1899 0:00 0WSTRYV 75 Workshop EYW 0 12/31/1899 0:00 0WSWBK1 B 25 Kit EQW 0 12/31/1899 0:00 0WSWBK2 B 0 Admin. Material EQW 0 12/31/1899 0:00 0WT100B A 0 Workshop EQW 0 1/1/1997 0:00 NWT200B A 5000 Workshop SKP 0 1/1/1997 0:00 NWT200C A 6000 Workshop SKP 0 8/14/2002 0:00 0WT200D A 7000 Workshop SKP 0 8/14/2002 0:00WT200E A 200 Workshop SKP 0 8/14/2002 0:00WT250 0 None SKP 0 12/31/1899 0:00WV100A A 262.5 Kit WVS 0 1/1/1995 0:00 YWV100J A 262.5 Admin. Material WVS 0 1/1/1997 0:00 YWV200A A 47.5 Manual WVS 0 1/1/1995 0:00 YWV300A A 28.5 QuikScore Form WVS 0 1/1/1995 0:00 YWV400A A 28.5 QuikScore Form WVS 0 1/1/1995 0:00 YWV500A A 28.5 QuikScore Form WVS 0 1/1/1995 0:00 YWV600A A 28.5 QuikScore Form WVS 0 1/1/1995 0:00 YWV700A A 102 QuikScore Form WVS 0 1/1/1995 0:00 YWV900I A 36 QuikScore Form WVS 0 1/1/1995 0:00 YXCA1B0 B 475 SW 16Bit CSI 1 12/31/1899 0:00 NXCACD0 B 45 SW 16Bit CSC 0 12/31/1899 0:00 NXCARMN B 35 Manual CAW 0 12/31/1899 0:00 NXCAS20 B 200 SW 16Bit CSI 0 12/31/1899 0:00 YXCASIN B 450 SW Unlock CSI 0 12/31/1899 0:00 YXCASPV B 45 SW 16Bit CSI 1 12/31/1899 0:00 NXCASWA B 450 SW 16Bit CSI 0 1/1/1997 0:00 NXCASWC B 0 SW 16Bit CSI 0 12/31/1899 0:00 NXCASWD B 0 SW 16Bit CSI 0 1/1/1997 0:00 NXCASWE B 150 Upgrade CSI 0 1/1/1997 0:00 NXCASWF B 100 Upgrade CSI 0 1/1/1997 0:00 NXCASWM B 35 Manual CSI 0 1/1/1997 0:00 NXCATD0 B 45 SW 16Bit CSC 0 12/31/1899 0:00 YXCDIBP B 0 SW 16Bit CDI 0 1/1/1997 0:00 N
XCDID0 B 45 SW 16Bit CDI 0 1/1/1997 0:00 YXCDIDO B 0 SW 16Bit CDI 0 1/1/1997 0:00 NXCDIDP B 0 SW 16Bit CDI 1 1/1/1997 0:00 NXCDIMN B 35 Manual CDI 0 1/1/1997 0:00 NXCDIOO B 1.5 SW Refresher CDI 0 1/1/1997 0:00 YXCDIT0 B 45 SW 16Bit CDI 0 12/31/1899 0:00 NXCPT10 B 200 SW 16Bit KPT 0 12/31/1899 0:00 NXCRDIO B 0 SW 16Bit CSW 0 1/1/1997 0:00 0XCRDPO B 0 SW 16Bit CRS 0 1/1/1997 0:00 0XCRI00 B 300 sw 16bit CSW 300 12/31/1899 0:00 NXCRI10 B 30 sw 16bit CSW 0 12/31/1899 0:00 NXCRI25 B 75 sw 16bit CSW 75 12/31/1899 0:00 NXCRI50 B 150 SW 16Bit CSW 150 12/31/1899 0:00 NXCRIAN B 175 SW 16Bit CSW 0 1/1/1997 0:00 NXCRIBN B 300 SW 16Bit CSW 0 1/1/1997 0:00 NXCRIN5 B 300 SW 16Bit CSW 0 12/31/1899 0:00 NXCRIRN B 400 SW 16Bit CSW 0 1/1/1998 0:00 NXCRISN B 475 SW 16Bit CSW 0 1/1/1998 0:00 NXCRMIX B 3 Mail-In CSW 0 1/1/1997 0:00 NXCRMPX B 1.5 Mail-In CSW 0 1/1/1997 0:00 NXCRP00 B 150 sw 16bit CSW 150 12/31/1899 0:00 NXCRP10 B 15 SW 16bit CSW 0 12/31/1899 0:00 NXCRP25 B 37.5 sw 16bit CSW 0 12/31/1899 0:00 NXCRP50 B 75 sw 16bit CSW 75 12/31/1899 0:00 NXCRPAN B 100 SW 16Bit CSW 0 1/1/1997 0:00 NXCRPBN B 175 SW 16Bit CSW 0 1/1/1997 0:00 NXCRPR5 B 175 SW 16Bit CSW 0 12/31/1899 0:00 NXCRSBP B 0 SW 16Bit CSW 0 1/1/1997 0:00 NXCRSDD B 45 SW 16Bit CSW 0 1/1/1997 0:00 YXCRSDO B 0 SW 16Bit CSW 0 1/1/1997 0:00 NXCRSI0 B 3 SW Refresher CSW 0 12/31/1899 0:00 YXCRSP0 B 1.5 SW Refresher CSW 0 1/1/1997 0:00 YXCVDDD B 0 SW 16Bit CSC 0 1/1/1998 0:00 NXCVRDA B 0 SW 16Bit CAR 0 1/1/1998 0:00 NXCVRMB B 0 Manual CAR 0 1/1/1998 0:00 0XCVRPC B 0 SW 16Bit CAR 0 1/1/1998 0:00 NXCVRT0 B 45 SW 16Bit CAR 0 12/31/1899 0:00 NXCVRU0 B 0 SW Refresher CAR 0 1/1/1998 0:00 NXCVRWA B 0 SW 16Bit CAR 0 1/1/1997 0:00 0XCVSDD B 0 SW 16Bit CSC 0 1/1/1998 0:00 NXCVSMC B 35 Manual CSC 0 1/1/1998 0:00 NXCVSPB B 45 SW 16Bit CSC 0 1/1/1998 0:00 NXCVSWA B 0 SW 16Bit CSC 0 1/1/1997 0:00 NXCVUS0 B 3 SW Refresher CSC 0 1/1/1998 0:00 YXDAB0D B 0 SW 16Bit DAS 0 12/31/1899 0:00 NXDAD0E B 0 SW 16Bit DAS 0 12/31/1899 0:00 NXDADOG B 0 SW 16Bit DAS 0 12/31/1899 0:00 NXDADTE B 45 SW 16Bit DAS 0 12/31/1899 0:00 YXDAI0C B 0 SW Refresher DAS 0 12/31/1899 0:00 NXDAK0F B 70 SW 16Bit DAS 0 12/31/1899 0:00 NXDAKTF B 70 SW 16Bit DAS 0 12/31/1899 0:00 YXDAP00 B 1.5 SW Refresher DAS 0 1/1/1999 0:00 YXDASMA B 0 Manual DAS 0 12/31/1899 0:00 NXDCLWA B 0 SW 16Bit DRE 0 1/1/1998 0:00 0
XDI1DI B 45 SW 16Bit DCR 0 1/1/1997 0:00 NXDI1DO B 0 SW 16Bit DCR 0 1/1/1997 0:00 NXDI1DP B 0 SW 16Bit DCR 0 1/1/1998 0:00 NXDI1PH B 495 SW 16Bit DCR 0 1/1/1997 0:00 YXDI1UR B 195 Upgrade DCR 0 1/1/1997 0:00 NXDI2CH B 495 SW 16Bit DCR 0 1/1/1997 0:00 YXDI2DI B 45 SW 16Bit DCR 0 1/1/1997 0:00 NXDI2DO B 0 SW 16Bit DCR 0 1/1/1998 0:00 NXDI3BL B 795 SW 16Bit DCR 0 1/1/1997 0:00 NXDI3DP B 0 SW 16Bit DCR 0 1/1/1997 0:00 NXDI3GF B 350 Upgrade DCR 0 1/1/1997 0:00 NXDI3MM B 35 Manual DCR 0 1/1/1997 0:00 NXDI3MMCVR B 0 Manual DCR 0 1/1/1997 0:00 0XDI3UR B 195 Upgrade DCR 0 1/1/1997 0:00 NXDI4T0 B 45 SW 16Bit DCR 0 12/31/1899 0:00 NXDI5T0 B 45 SW 16Bit DCR 0 12/31/1899 0:00 NXDI6T0 B 45 sw 16bit DCR 0 11/8/1999 0:00 YXDIBUE B 795 SW Unlock DCR 0 1/1/1998 0:00 YXDICPR B 45 SW Refresher DCR 0 12/31/1899 0:00 NXDICU0 B 495 SW Unlock DCR 0 1/1/1998 0:00 NXDIPPR B 45 SW Refresher DCR 0 12/31/1899 0:00 NXDIPU0 B 495 SW Unlock DCR 0 1/1/1998 0:00 NXDT1GE B 150 Upgrade DTR 0 1/1/1997 0:00 NXDT1WA B 295 SW 16Bit DTR 0 1/1/1997 0:00 NXDT2GD B 100 Upgrade DTR 0 1/1/1997 0:00 NXDTCAD B 795 SW 16Bit DTR 0 1/1/1997 0:00 NXDTDKO B 0 SW 16Bit DTR 0 1/1/1997 0:00 NXDTINS B 295 SW Unlock DTR 0 12/31/1899 0:00 YXDTMNN B 45 Manual DTR 0 1/1/1997 0:00 NXEQBT0 B 45 SW 16Bit EQI 0 12/31/1899 0:00 NXEQCBJ B 0 SW 16Bit EQI 0 1/1/1998 0:00 NXEQCKK B 80 SW 16Bit EQI 0 1/1/1998 0:00 NXEQCMM B 0 Manual EQI 0 1/1/1998 0:00 NXEQCOJ B 0 SW 16Bit EQI 0 1/1/1998 0:00 NXEQCT B 116 Kit EQI 0 1/14/2002 0:00 YXEQD00 B 2050 SW 16bit EQI 2250 12/31/1899 0:00 NXEQD10 B 225 SW 16bit EQI 225 12/31/1899 0:00 NXEQD25 B 562.5 SW 16bit EQI 562.5 12/31/1899 0:00 NXEQD50 B 1075 SW 16Bit EQi 1125 12/31/1899 0:00 NXEQDR0 B 22.5 SW Refresher EQI 0 1/1/1998 0:00 YXEQGS B 16.5 Report Paper EQI 0 12/31/1899 0:00 NXEQI00 B 950 SW 16bit EQI 1150 12/31/1899 0:00 NXEQI10 B 115 SW 16BIT EQI 115 12/31/1899 0:00 NXEQI25 B 287.5 SW 16Bit EQI 287.5 12/31/1899 0:00 NXEQI50 B 525 SW 16Bit EQI 575 12/31/1899 0:00 NXEQPRV B 45 SW 16Bit EQI 0 12/31/1899 0:00 NXEQR25 B 562.5 SW 16Bit EQi 0 12/31/1899 0:00 0XEQRBJ B 0 SW 16Bit EQI 0 1/1/1998 0:00 NXEQRKK B 130 SW 16Bit EQI 0 1/1/1998 0:00 NXEQRMM B 0 Manual EQI 0 1/1/1998 0:00 NXEQROJ B 0 SW 16Bit EQI 0 1/1/1998 0:00 NXEQRR0 B 22.5 SW Refresher EQI 0 1/1/1998 0:00 YXEQRS B 65 Report Paper EQI 0 12/31/1899 0:00 NXEQRSO B 65 Report Paper EQI 0 1/1/1998 0:00 N
XEQRT B 116 Kit EQI 0 1/14/2002 0:00 YXEQSR0 B 11.5 SW Refresher EQI 0 1/1/1998 0:00 YXFADK0 B 0 SW 16Bit FAM 0 2/4/1999 0:00 NXFAMB0 B 0 SW 16Bit FAM 0 2/4/1999 0:00 NXFAMI0 B 0 SW Refresher FAM 0 12/31/1899 0:00 NXFAMMN B 35 Manual FAM 0 2/4/1999 0:00 NXFAMT1 B 45 SW Refresher FAM 0 2/4/1999 0:00 YXFAMW B 6 Refreshers FAM 0 2/4/1999 0:00 YXFAMWP B 6 Refreshers FAM 0 2/4/1999 0:00 NXFBUSP B 4 Refreshers FAM 0 2/4/1999 0:00 YXGADOC B 4 SW 16Bit GAF 0 1/1/1996 0:00 NXGAFIN B 95 SW Unlock GAF 0 12/31/1899 0:00 YXGAFWA B 95 SW 16Bit GAF 0 1/1/1996 0:00 NXHA010 B 45 sw 16bit HEL 0 12/31/1899 0:00 YXHA020 B 45 sw 16bit hel 0 12/31/1899 0:00 NXHA030 B 295 sw 16bit hel 0 12/31/1899 0:00 YXHA040 B 495 sw 16bit HEL 0 12/31/1899 0:00 NXHA050 B 595 sw 16bit HEL 0 12/31/1899 0:00 NXHA060 B 295 sw 16bit hel 0 12/31/1899 0:00 NXHA070 B 495 sw 16bit HEL 0 12/31/1899 0:00 NXHA080 B 595 sw 16bit HEL 0 12/31/1899 0:00 NXHA090 B 45 SW 16BIT HEL 0 12/31/1899 0:00 NXHA100 B 45 sw 16bit HEL 0 12/31/1899 0:00 NXHAB10 B 0 sw 16bit HEL 0 12/31/1899 0:00 NXHAB20 B 0 sw 16bit HEL 0 12/31/1899 0:00 NXHAB30 B 0 sw 16bit HEL 0 12/31/1899 0:00 NXHAB40 B 0 sw 16bit HEL 0 12/31/1899 0:00 NXHAB50 B 0 sw 16bit HEL 0 12/31/1899 0:00 NXHAB60 B 0 sw 16bit HEL 0 12/31/1899 0:00 NXHAB70 B 0 sw 16bit HEL 0 12/31/1899 0:00 NXHAB80 B 0 sw 16bit HEL 0 12/31/1899 0:00 NXHABA0 B 0 SW 16Bit HEL 0 12/31/1899 0:00 NXHABY0 B 0 SW 16Bit HEL 0 12/31/1899 0:00 NXHAMN0 B 0 SW 16Bit HEL 0 12/31/1899 0:00 NXHEA10 B 45 SW 16Bit HRE 0 12/31/1899 0:00 YXHEA20 B 45 sw 16bit HRE 0 12/31/1899 0:00 YXHEB10 B 45 SW 16Bit HRE 0 12/31/1899 0:00 NXHEB20 B 295 SW 16Bit HRE 0 12/31/1899 0:00 NXHEB30 B 595 SW 16Bit HRE 0 12/31/1899 0:00 NXHEB40 B 595 SW 16Bit HRE 0 12/31/1899 0:00 NXHEDSK B 0 SW 16Bit HRE 0 12/31/1899 0:00 NXHEMNL B 0 Manual HRE 0 12/31/1899 0:00 NXHEPRV B 45 SW Refresher HRE 0 12/31/1899 0:00 NXHET50 B 45 sw 16bit HRE 0 12/31/1899 0:00 NXHET60 B 295 sw 16bit HRE 0 12/31/1899 0:00 NXHET70 B 495 sw 16bit HRE 0 12/31/1899 0:00 NXHET80 B 595 sw 16bit HRE 0 12/31/1899 0:00 NXHEUS2 B 495 SW Refresher HRE 0 12/31/1899 0:00 NXHEUS3 B 595 SW Refresher HRE 0 12/31/1899 0:00 NXHEUSR B 295 SW Refresher HRE 0 12/31/1899 0:00 YXHPDT0 B 45 SW 16Bit HPS 0 12/31/1899 0:00 yXHPSBF B 0 SW 16Bit HPS 0 1/1/1998 0:00 NXHPSDG B 45 SW 16Bit HPS 0 1/1/1997 0:00 NXHPSIH B 60 SW 16Bit HPS 0 1/1/1998 0:00 N
XHPSKF B 0 SW 16Bit HPS 0 1/1/1998 0:00 NXHPSMI B 35 Manual HPS 0 1/1/1998 0:00 NXHPST0 B 45 SW 16Bit HPS 0 12/31/1899 0:00 NXHPSW0 B 1.5 SW Refresher HPS 0 1/1/1998 0:00 YXHSB10 B 45 SW 16Bit HST 0 12/31/1899 0:00 NXHSB20 B 295 SW 16Bit HST 0 12/31/1899 0:00 NXHSB30 B 495 SW 16Bit HST 0 12/31/1899 0:00 NXHSB40 B 595 SW 16Bit HST 0 12/31/1899 0:00 NXHSDSK B 0 SW 16Bit HST 0 12/31/1899 0:00 NXHSMNL B 0 Manual HST 0 12/31/1899 0:00 NXHSP10 B 45 SW 16Bit HST 0 12/31/1899 0:00 NXHSP20 B 45 SW 16Bit HST 0 12/31/1899 0:00 NXHSPRV B 45 SW Refresher HST 0 12/31/1899 0:00 NXHST60 B 295 SW 16Bit HST 0 12/31/1899 0:00 YXHST70 B 495 sw 16bit HST 0 12/31/1899 0:00 NXHST80 B 595 sw 16bit HST 0 12/31/1899 0:00 NXHSUS2 B 295 SW Refresher HST 0 12/31/1899 0:00 NXHSUS3 B 495 SW Refresher HST 0 12/31/1899 0:00 NXHSUS4 B 595 SW Refresher HST 0 12/31/1899 0:00 NXHSUSR B 295 SW Refresher HST 0 12/31/1899 0:00 YXHSYPR B 0 SW Refresher HST 0 12/31/1899 0:00 NXHTASU A 12 SW 16Bit HED 0 12/31/1899 0:00 NXHTB10 B 45 SW 16Bit HTH 0 12/31/1899 0:00 NXHTB20 B 295 SW 16Bit HTH 0 12/31/1899 0:00 NXHTB30 B 495 SW 16Bit HTH 0 12/31/1899 0:00 NXHTB40 B 595 SW 16Bit HTH 0 12/31/1899 0:00 NXHTDSK B 0 SW 16Bit HTH 0 12/31/1899 0:00 NXHTMNL B 0 Manual HTH 0 12/31/1899 0:00 NXHTPRV B 45 SW Refresher HEL 0 12/31/1899 0:00 YXHTUS2 B 495 SW 16Bit HTH 0 12/31/1899 0:00 NXHTUS3 B 595 SW Refresher HTH 0 12/31/1899 0:00 NXHTUSR B 295 SW Refresher HTH 0 12/31/1899 0:00 YXHTY10 B 45 SW Refresher HTH 0 12/31/1899 0:00 YXHTY20 B 295 SW Refresher HTH 0 12/31/1899 0:00 YXHTY30 B 495 SW Refresher HTH 0 12/31/1899 0:00 NXHTY40 B 595 SW 16Bit HTH 0 12/31/1899 0:00 NXHTYSK B 0 SW 16Bit HTH 0 12/31/1899 0:00 NXHTYU0 B 0 SW Refresher HTH 0 12/31/1899 0:00 NXHTYU1 B 0 SW Refresher HTH 0 12/31/1899 0:00 NXHTYU2 B 0 SW Refresher HTH 0 12/31/1899 0:00 NXHTYU3 B 0 SW Refresher HTH 0 12/31/1899 0:00 NXHYT40 B 595 SW Refresher HEL 0 12/31/1899 0:00 NXHYTU1 B 0 SW Refresher HTH 0 12/31/1899 0:00 0XHYTU2 B 0 SW Refresher HTH 0 12/31/1899 0:00 0XHYTU3 B 0 SW Refresher HTH 0 12/31/1899 0:00 0XHYUS2 B 495 SW Refresher HRE 0 12/31/1899 0:00 NXJBCDJ B 45 SW 16Bit JES 0 1/1/1997 0:00 NXJBCI0 B 4 SW Refresher JES 0 1/1/1998 0:00 YXJBCMO B 4 Mail-In JES 0 1/1/1998 0:00 yXJBDT0 B 45 SW 16Bit JES 0 12/31/1899 0:00 yXJBUPX B 45 Upgrade JES 0 1/1/1997 0:00 NXJBWKY B 0 SW 16Bit JES 0 1/1/1997 0:00 NXJBWMD B 45 Manual JES 0 1/1/1997 0:00 NXJBWO3 B 0 SW 16Bit JES 0 1/1/1997 0:00 N
XJBWOP B 0 SW 16Bit JES 0 1/1/1997 0:00 NXJI100 B 8 SW Refresher JES 0 1/1/1998 0:00 YXJI1T0 B 45 SW 16Bit JES 0 12/31/1899 0:00 yXJIIMO B 8 Mail-In JES 0 1/1/1997 0:00 NXJIP10 B 4 SW Refresher JES 0 1/1/1998 0:00 YXJIPMO B 4 Mail-In JES 0 1/1/1997 0:00 NXJIUPV B 47.25 Upgrade JES 0 1/1/1997 0:00 NXJIW2D B 0 SW 16Bit JES 0 12/31/1899 0:00 NXJIWDJ B 45 SW 16Bit JES 0 1/1/1997 0:00 NXJIWKU B 0 SW 16Bit JES 0 1/1/1997 0:00 NXJIWMG B 35 Manual JES 0 1/1/1997 0:00 NXJIWOT B 0 SW 16Bit JES 0 1/1/1997 0:00 NXJIWPT B 0 SW 16Bit JES 0 1/1/1998 0:00 NXLA1DG C 45 SW 16Bit LAM 0 4/2/2002 0:00 NXLA1T0 C 295 SW 16Bit LAM 0 4/2/2002 0:00 yXLAMN0 C 0 Manual LAM 0 4/2/2002 0:00 NXLATD0 C 45 SW 16Bit LAM 0 4/2/2002 0:00 yXLSIBM A 0 SW 16Bit LSI 0 1/1/1998 0:00 NXLSIDN A 45 SW 16Bit LSI 0 1/1/1998 0:00 NXLSIMO A 45 Manual LSI 0 1/1/1998 0:00 NXLSIOM A 0 SW 16Bit LSI 0 1/1/1998 0:00 NXLSITD A 45 SW 16Bit LSI 0 12/31/1899 0:00 YXLSIW0 B 6 SW Refresher LSI 0 1/1/1998 0:00 YXMSC04 B 25 Refreshers MSC 0 4/3/2002 0:00 NXPC10E A 195 SW 16Bit PCW 0 1/1/1997 0:00 NXPCBET A 0 Beta PCW 0 12/31/1899 0:00 NXPCDOD A 0 SW 16Bit PCW 0 1/1/1998 0:00 NXPCINS A 195 SW Unlock PCW 0 12/31/1899 0:00 NXPCINS1 A 195 SW Unlock PCW 0 12/31/1899 0:00 NXPCMNC A 0 Manual PCW 0 1/1/1998 0:00 NXPCPRV B 45 SW Refresher PCW 0 12/31/1899 0:00 NXPCPVF A 45 SW 16Bit PCW 0 1/1/1998 0:00 NXPCYI0 C 0 SW Refresher PCL 0 12/31/1899 0:00 NXPCYP0 C 0 SW Refresher PCL 0 12/31/1899 0:00 NXPDDT0 B 45 SW 16Bit PDX 0 12/31/1899 0:00 YXPDSB0 B 0 SW 16Bit PDX 0 12/31/1899 0:00 NXPDSD0 B 45 SW 16Bit PDX 0 12/31/1899 0:00 NXPDSK0 B 70 SW 16Bit PDX 0 12/31/1899 0:00 NXPDSMN B 35 Manual PDX 0 12/31/1899 0:00 NXPDSOD B 0 SW 16Bit PDX 0 12/31/1899 0:00 NXPDSW0 B 1.5 Refreshers PDX 0 12/31/1899 0:00 yXPM1BL A 0 Beta PMF 0 1/1/1997 0:00 NXPM1NB A 0 SW 16Bit PMF 0 1/1/1998 0:00 NXPM1U0 B 95 SW Refresher PMF 0 1/1/1996 0:00 YXPM1UD A 95 SW Unlock PMF 0 1/1/1996 0:00 yXPM2NB A 0 SW 16Bit PMF 0 1/1/1998 0:00 NXPM3NB A 0 SW 16Bit PMF 0 1/1/1998 0:00 NXPM4NB A 0 SW 16Bit PMF 0 1/1/1998 0:00 NXPMCD0 B 0 SW 16Bit SHR 0 4/28/1999 0:00 YXPMDOD B 0 SW 16Bit SHR 0 12/31/1899 0:00 YXPML0F A 0 SW 16Bit SHR 0 1/1/1996 0:00 YXPMLAJ A 0 SW 16Bit SHR 0 1/1/1997 0:00 YXPPRMA A 0 Manual PPO 0 4/28/1999 0:00 NXPS1GB A 100 Upgrade PSH 0 1/1/1997 0:00 N
XPSDKO A 0 SW 16Bit PSH 0 12/31/1899 0:00 NXPSDKP A 0 SW 16Bit PSH 0 1/1/1997 0:00 NXPSINS B 295 SW Unlock PSH 0 5/1/1999 0:00 YXPSMNL A 35 Manual PSH 0 12/31/1899 0:00 NXPSPRV B 45 SW Refresher PSH 0 5/1/1999 0:00 YXPSSWA A 395 SW 16Bit PSH 0 1/1/1997 0:00 NXPSWPA A 45 SW 16Bit PSH 0 1/1/1997 0:00 NXS11FF A 890 SW 16Bit SHR 0 1/1/1997 0:00 YXS11LF A 795 SW 16Bit SHR 0 1/1/1997 0:00 YXS1DFF A 0 SW 16Bit SHR 0 1/1/1997 0:00 YXS1DLF A 45 SW 16Bit SHR 0 1/1/1997 0:00 YXS1FT0 A 890 SW 16Bit SHR 0 12/31/1899 0:00 yXS1NGF A 350 SW 16Bit SHR 0 1/1/1997 0:00 YXS1UFF A 745 SW 16Bit SHR 0 1/1/1997 0:00 YXS1UL0 A 760 SW Unlock SHR 0 12/31/1899 0:00 YXS1ULF A 0 SW 16Bit SHR 0 1/1/1997 0:00 YXS1WGF A 0 Upgrade SHR 0 1/1/1997 0:00 YXSAB0D B 0 SW 16Bit SA4 0 1/1/1998 0:00 NXSAD0E B 45 SW 16Bit SA4 0 1/1/1998 0:00 NXSADOF B 0 SW 16Bit SA4 0 1/1/1998 0:00 NXSADT0 B 45 SW 16Bit SA4 0 12/31/1899 0:00 yXSAK0H B 65 SW 16Bit SA4 0 1/1/1998 0:00 NXSAM0G B 35 Manual SA4 0 1/1/1998 0:00 NXSAS0I B 25 Answer/Data Sheets SA4 0 1/1/1998 0:00 yXSAW01 B 3 SW Refresher SA4 0 12/31/1899 0:00 YXSD3F6 A 595 Upgrade SHR 0 1/1/1997 0:00 YXSD3L6 A 495 Upgrade SHR 0 1/1/1997 0:00 YXSD4F6 A 595 Upgrade SHR 0 1/1/1988 0:00 YXSD5F6 A 495 Upgrade SHR 0 1/1/1997 0:00 YXSD5L6 A 395 Upgrade SHR 0 1/1/1997 0:00 YXSD6F6 A 495 Upgrade SHR 0 1/1/1997 0:00 YXSD6L6 A 395 Upgrade SHR 0 1/1/1997 0:00 YXSDDWF A 0 SW 16Bit SHR 0 1/1/1998 0:00 YXSDKWF A 0 SW 16Bit SHR 0 1/1/1997 0:00 YXSDLT0 A 35 SW 16Bit SHR 0 12/31/1899 0:00 yXSDNWF A 0 SW 16Bit SHR 0 1/1/1998 0:00 YXSECA0 B 895 SW 16Bit SCS 0 12/31/1899 0:00 NXSEDB0 B 750 SW 16Bit DTR 0 12/31/1899 0:00 NXSEDC0 B 1095 SW 16Bit SCS 0 12/31/1899 0:00 NXSF4F6 A 570 Upgrade SHR 0 1/1/1997 0:00 YXSF4L6 A 445 Upgrade SHR 0 1/1/1997 0:00 YXSF5F6 A 245 Upgrade SHR 0 1/1/1997 0:00 YXSF5L6 A 195 Upgrade SHR 0 1/1/1997 0:00 YXSF6F6 A 245 Upgrade SHR 0 1/1/1997 0:00 YXSH25M A 0 Manual SHR 0 12/4/1999 0:00 YXSH25U A 0 Upgrade SHR 0 12/4/1999 0:00 YXSHA10 A 260 Upgrade SHR 0 12/4/1999 0:00 YXSHA20 A 350 Upgrade SHR 0 12/4/1999 0:00 YXSHA30 A 0 Upgrade SHR 0 12/4/1999 0:00 YXSHA40 A 0 Upgrade SHR 0 12/4/1999 0:00 YXSHEDG A 0 EMC SHR 0 1/1/1998 0:00 YXSHEMG A 0 Manual SHR 0 1/1/1998 0:00 YXSHEPG A 125 EMC SHR 0 1/1/1998 0:00 YXSHEWG A 175 EMC SHR 0 1/1/1998 0:00 Y
XSHMFE A 150 Maintenance SHR 0 2/14/2000 0:00 YXSHN1F A 550 Upgrade SHR 0 1/1/1997 0:00 YXSHN2F A 925 SW 16Bit SHR 0 1/1/1997 0:00 YXSHN3F A 250 SW 16Bit SHR 0 1/1/1997 0:00 YXSHN4F A 250 Upgrade SHR 0 1/1/1997 0:00 YXSHN5F A 250 Upgrade SHR 0 1/1/1997 0:00 YXSHN6F A 395 Upgrade SHR 0 1/1/1997 0:00 YXSHN7F A 325 Upgrade SHR 0 1/1/1997 0:00 YXSHNCZ A 0 Manual SHR 0 1/1/1998 0:00 YXSHNFF A 1340 SW 16Bit SHR 0 1/1/1998 0:00 YXSHNLF A 1245 SW 16Bit SHR 0 1/1/1998 0:00 YXSHPRV B 35 SW Refresher SHR 0 12/31/1899 0:00 YXSHUCD A 0 Upgrade SHR 0 5/13/1999 0:00 YXSIIB0 B 295 SW 16Bit CSP 0 12/31/1899 0:00 YXSIIDO B 0 SW 16Bit CSP 0 12/31/1899 0:00 NXSIINS B 295 SW Unlock SSP 0 5/1/1999 0:00 YXSILT0 A 795 SW 16Bit SHR 0 12/31/1899 0:00 yXSMNWF A 0 Manual SHR 0 1/1/1997 0:00 YXSMRPT A 25 Manual SHR 0 4/26/1999 0:00 YXSN1T0 A 495 SW 16Bit SHR 0 12/31/1899 0:00 yXSN2T0 A 925 SW 16Bit SHR 0 12/31/1899 0:00 yXSN3T0 A 250 SW 16Bit SHR 0 4/27/1999 0:00 yXSN4T0 A 260 SW 16Bit SHR 0 12/31/1899 0:00 yXSNFT0 A 1395 SW 16Bit SHR 0 12/31/1899 0:00 yXSNLT0 A 1295 SW 16Bit SHR 0 12/31/1899 0:00 yXSP1BL A 0 Beta SHR 0 1/1/1997 0:00 YXSP2BL A 0 Beta SHR 0 12/31/1899 0:00 YXSP3F6 A 395 Upgrade SHR 0 1/1/1997 0:00 YXSP4F6 A 395 Upgrade SHR 0 1/1/1997 0:00 YXSPOMS A 0 Manual SHR 0 4/26/1999 0:00 0XSS1DB B 45 SW 16Bit SSP 0 1/1/1996 0:00 NXSS1GE B 150 Upgrade SSP 0 1/1/1996 0:00 NXSS1WA B 395 SW 16Bit SSP 0 1/1/1996 0:00 NXSS2GE B 100 Upgrade SSP 0 1/1/1996 0:00 NXSS2T0 B 45 SW 16Bit SSP 0 12/31/1899 0:00 YXSS4T0 B 45 SW 16Bit SSP 0 12/31/1899 0:00 YXSSCAF B 795 SW 16Bit SSP 0 1/1/1997 0:00 NXSSDB0 B 650 SW 16Bit SSP 0 12/31/1899 0:00 NXSSDCG B 1095 SW 16Bit SSP 0 1/1/1997 0:00 NXSSDOF B 0 SW 16Bit SSP 0 1/1/1996 0:00 NXSSDTA B 750 SW 16Bit SSP 0 1/1/1997 0:00 NXSSE1A B 495 SW 16Bit SSE 0 1/1/1997 0:00 YXSSEDB B 45 SW 16Bit SSE 0 1/1/1997 0:00 NXSSEIN B 495 SW Unlock SSP 0 12/31/1899 0:00 YXSSEPR B 45 SW Refresher SSP 0 12/31/1899 0:00 NXSSEXP B 495 SW 16Bit SSE 0 12/31/1899 0:00 NXSSPK1 B 395 SW 16Bit SSP 0 12/31/1899 0:00 NXSSPRV B 45 SW 16Bit SSP 0 1/1/1996 0:00 NXSSUGD B 0 Manual SSP 0 1/1/1996 0:00 NXSSUGDCVR B 0 Manual SSP 0 1/1/1996 0:00 0XSSUNA B 395 SW Unlock SSP 0 1/1/1996 0:00 NXSSUNC B 395 SW Unlock SSP 0 1/1/1996 0:00 NXSTAP0 B 45 SW 16Bit STA 0 12/31/1899 0:00 YXSTD10 B 25 Answer/Data Sheets STA 0 12/31/1899 0:00 Y
XSTMAN B 0 SW 16Bit STA 0 12/31/1899 0:00 NXSTPRO B 1.5 SW Refresher STA 0 12/31/1899 0:00 YXSTTD0 B 0 SW 16Bit STA 0 12/31/1899 0:00 NXTOMBE C 0 SW 16Bit TOM 0 1/1/1998 0:00 NXTOMDF C 45 SW 16Bit TOM 0 1/1/1997 0:00 NXTOMKH C 63 SW 16Bit TOM 0 1/1/1998 0:00 NXTOMMG C 36.75 Manual TOM 0 1/1/1998 0:00 NXTOMOE C 0 SW 16Bit TOM 0 1/1/1998 0:00 NXTOMP0 C 45 SW 16Bit TOM 0 12/31/1899 0:00 YXTOMT0 C 63 SW 16Bit TOM 0 12/31/1899 0:00 YXTOMW0 B 5 SW Refresher TOM 0 1/1/1997 0:00 YYC2R0A A 19.75 Book YCC 0 1/1/1988 0:00 NYCC1R0 A 19.95 Book YCA 0 12/28/2000 0:00 YYLS01 A 145 Kit YLS 0 12/31/1899 0:00 YYLS011 B 7 SW Refresher YLS 0 12/31/1899 0:00 0YLS02 A 55 Specimen Set YLS 0 12/31/1899 0:00 YYLS03 A 45 Manual YLS 0 12/31/1899 0:00 YYLS04 A 35 QuikScore Form YLS 0 12/31/1899 0:00 YYLS05 A 130 QuikScore Form YLS 0 12/31/1899 0:00 YYLS06 A 20 QuikScore Form YLS 0 12/31/1899 0:00 YYLS07 A 75 QuikScore Form YLS 0 12/31/1899 0:00 YYLS08 A 60 Interview Guide/Bklt YLS 0 12/31/1899 0:00 YYLS09 A 225 Interview Guide/Bklt YLS 0 12/31/1899 0:00 YYLS10 B 20 Answer/Data Sheets YLS 0 12/31/1899 0:00YLS11 B 7 SW Refresher YLS 0 12/31/1899 0:00 0YLS12 B 45 SW 16Bit YLS 0 12/31/1899 0:00 0YLS13 B 25 Answer/Data Sheets YLS 0 12/31/1899 0:00 0YLS14 B 0 Manual YLS 0 12/31/1899 0:00 0YLSSDK B 0 Maintenance YLS 0 12/31/1899 0:00 0Z05652 B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 NZ05654 B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 NZ24017 C 0 Test Booklet MR2 0 1/1/1988 0:00 NZ24024 C 0 Test Booklet MR2 0 1/1/1988 0:00 NZ24073 C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 NZ24076 C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 NZ25015 C 0 Test Booklet ML2 0 1/1/1988 0:00 NZ26328 B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 NZ26382 B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 NZ26480 B 0 Answer/Data Sheets CM2 0 1/1/1988 0:00 NZ33020 C 0 Test Booklet MM2 0 12/31/1899 0:00 NZ35020 A 0 Test Booklet IDE 0 1/1/1988 0:00 NZ46105 B 0 Answer/Data Sheets BBH 0 12/31/1899 0:00 NZ46128 B 0 Answer/Data Sheets BHH 0 12/31/1899 0:00 NZ48010 B 0 Test Booklet AU2 0 1/1/1988 0:00 NZ50604 C 0 Answer/Data Sheets CQ2 0 1/1/1988 0:00 NZ50640 C 0 Answer/Data Sheets MI2 0 1/1/1988 0:00 NZ51407 C 0 Answer/Data Sheets MC2 0 1/1/1988 0:00 NZ51408 C 0 Answer/Data Sheets MP2 0 1/1/1988 0:00 NZ51409 C 0 Answer/Data Sheets MH2 0 1/1/1988 0:00 NZ51410 C 0 Answer/Data Sheets MC2 0 1/1/1988 0:00 NZ51411 C 0 Answer/Data Sheets MH2 0 1/1/1988 0:00 NZ51412 C 0 Answer/Data Sheets MP2 0 1/1/1988 0:00 NZ51413 B 0 Answer/Data Sheets PFC 0 1/1/1996 0:00 NZ51414 C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 N
Z51415 C 0 Answer/Data Sheets MR2 0 1/1/1988 0:00 NZ51417 B 0 Answer/Data Sheets SCL 0 1/1/1988 0:00 NZ51419 C 0 Answer/Data Sheets ML2 0 1/1/1988 0:00 NZ51420 C 0 Answer/Data Sheets ML2 0 1/1/1988 0:00 NZ51421 B 0 Answer/Data Sheets BS2 0 1/1/1988 0:00 NZ51424 B 0 Answer/Data Sheets PFC 0 1/1/1988 0:00 NZ51427 B 0 Answer/Data Sheets AU2 0 1/1/1988 0:00 NZ51428 C 0 Answer/Data Sheets MA2 0 1/1/1988 0:00 NZ51429 C 0 Answer/Data Sheets MA2 0 1/1/1988 0:00 NZ51462 B 0 Answer/Data Sheets CA2 0 1/1/1988 0:00 NZ51465 B 0 Answer/Data Sheets CA2 0 12/31/1899 0:00 NZ51471 B 0 Answer/Data Sheets QSH 0 1/1/1988 0:00 NZ51472 B 0 Answer/Data Sheets QSH 0 1/1/1988 0:00 NZ51477 C 0 Answer/Data Sheets MR2 0 1/1/1997 0:00 NZ51478 C 0 Answer/Data Sheets MR2 0 1/1/1996 0:00 NZ51491 B 0 Answer/Data Sheets HSQ 0 1/1/1988 0:00 NZ51494 C 0 Answer/Data Sheets ISQ 0 1/1/1988 0:00 NZ51498 B 0 Answer/Data Sheets QSH 0 1/1/1988 0:00 NZ514FA B 0 Test Booklet PFF 0 1/1/1998 0:00 NZ51504 B 0 Answer/Data Sheets TJT 0 1/1/1995 0:00 NZ51505 B 0 Answer/Data Sheets TJT 0 1/1/1995 0:00 NZ51511 C 0 Answer/Data Sheets MM2 0 1/1/1988 0:00 NZ51512 C 0 Answer/Data Sheets MM2 0 1/1/1988 0:00 NZ51520 B 0 Answer/Data Sheets QOL 0 1/1/1988 0:00 NZ51526 B 0 Answer/Data Sheets PP3 0 1/1/1996 0:00 NZ51529 B 0 Answer/Data Sheets BH2 0 1/1/1996 0:00 NZ51536 C 0 Answer/Data Sheets MR8 0 1/1/1998 0:00 NZ51537 C 0 Answer/Data Sheets MR8 0 1/1/1998 0:00 NZ51737 B 0 Answer/Data Sheets POS 0 1/1/1988 0:00 NZ51750 C 0 Answer/Data Sheets GAM 0 12/31/1899 0:00 NZ51770 C 0 Answer/Data Sheets VIP 0 1/1/1998 0:00 NZ51929 C 0 Answer/Data Sheets MBM 0 12/31/1899 0:00 NZ51931 C 0 Test Booklet MBM 0 12/31/1899 0:00 NZ53200 B 0 Answer/Data Sheets 16S 0 1/30/2002 0:00 NZ70300 B 0 Test Booklet APQ 0 1/30/2002 0:00 NZ70400 B 0 Answer/Data Sheets APQ 0 1/30/2002 0:00 NZA5P0E 0 0 12/31/1899 0:00ZAAATA A 0 Audio AHD 0 1/1/1996 0:00 NZAAATB A 0 Audio AHD 0 1/1/1996 0:00 NZAAATS A 0 Audio AHD 0 1/1/1996 0:00 NZAC1PA B 0 Answer/Data Sheets ACQ 0 1/1/1989 0:00 NZADS05 B 0 QuikScore Form 0 12/31/1899 0:00 0ZADS07 B 0 QuikScore Form 0 12/31/1899 0:00 0ZAPS04 B 0 QuikScore Form APS 0 11/5/2001 0:00 NZAPS06 B 0 QuikScore Form APS 0 11/5/2001 0:00 NZAPS08 B 0 QuikScore Form APS 0 11/5/2001 0:00 NZAS2D3 B 0 SW DOS CSI 0 1/1/1995 0:00 NZAS2F3 B 0 SW DOS CSI 0 1/1/1995 0:00 NZBC1PB A 0 Video BCL 0 1/1/1995 0:00 NZBC1VA A 0 Video BCL 0 1/1/1995 0:00 NZCA11D B 0 QuikScore Form CAA 0 1/1/1998 0:00 NZCA13D B 0 QuikScore Form CAA 0 1/1/1998 0:00 NZCAAD2 B 0 Interview Guide/Bklt CAI 0 8/23/2001 0:00 NZCAAD3 B 0 Interview Guide/Bklt CAI 0 8/23/2001 0:00 N
ZCADD2 B 0 Interview Guide/Bklt CRX 0 1/1/1997 0:00 NZCAL1B A 0 Admin. Material CLM 0 1/1/1998 0:00 NZCAL2B A 0 Admin. Material CLM 0 1/1/1998 0:00 NZCAL3B A 0 Admin. Material CLM 0 1/1/1998 0:00 NZCAL3C A 0 Workbook/Worksheet CLM 0 1/1/1998 0:00 NZCAL4B A 0 Admin. Material CLM 0 1/1/1998 0:00 NZCAL5B A 0 Admin. Material CLM 0 1/1/1998 0:00 NZCAL6B A 0 Admin. Material CLM 0 1/1/1998 0:00 NZCAR3D B 0 QuikScore Form CAA 0 1/1/1998 0:00 NZCAR5D B 0 QuikScore Form CAA 0 1/1/1998 0:00 NZCAR7D B 0 QuikScore Form CAA 0 1/1/1998 0:00 NZCAR9D B 0 QuikScore Form CAA 0 1/1/1998 0:00 NZCDFS0 B 0 QuikScore Form CDI 0 10/13/1999 0:00 NZCDI10 B 0 QuikScore Form CDI 0 12/31/1899 0:00 0ZCDI20 B 1 QuikScore Form CDI 0 12/31/1899 0:00 0ZCDIF0 B 0 QuikScore Form CDI 0 12/31/1899 0:00 NZCDIS3 B 0 QuikScore Form CDI 0 8/10/1999 0:00 NZCDS10 B 0 QuikScore Form CDI 0 8/10/1999 0:00 NZCDS3C B 0 QuikScore Form CDS 0 1/1/1998 0:00 NZCDS6C B 0 QuikScore Form CDS 0 1/1/1998 0:00 NZCG1A1 A 0 Audio CGD 0 1/1/1996 0:00 NZCG1A2 A 0 Audio CGD 0 1/1/1996 0:00 NZCG1MA A 0 Audio CGD 0 1/1/1996 0:00 NZCHI20 A 0 Pamphlet HEJ 0 12/31/1899 0:00 0ZCHI30 A 0 Pamphlet HEJ 0 12/31/1899 0:00 0ZCHI40 A 0 Pamphlet HEJ 0 12/31/1899 0:00 0ZCHI50 A 0 Pamphlet HEJ 0 12/31/1899 0:00 0ZCHI60 A 0 Pamphlet HEJ 0 12/31/1899 0:00 0ZCHI70 A 0 Pamphlet HEJ 0 12/31/1899 0:00 0ZCHIP6 B 0 QuikScore Form CHI 0 12/31/1899 0:00 NZCI20P B 0 QuikScore Form CIS 0 4/21/1999 0:00 NZCIF10 B 0 QuikScore Form CIS 0 9/30/1999 0:00 NZCIF30 B 0 QuikScore Form CIS 0 9/30/1999 0:00 NZCLESA B 0 QuikScore Form CLE 0 12/31/1899 0:00 NZCLESC B 0 QuikScore Form CLE 0 12/31/1899 0:00 NZCLESP B 0 QuikScore Form CLE 0 12/31/1899 0:00 NZCLMR2 A 0 Manual CAL 0 12/31/1899 0:00 NZCLMR3 A 0 Workbook/Worksheet CAL 0 12/31/1899 0:00 NZCLPB3 C 0 Misc. INF 0 1/1/1998 0:00 NZCMCD1 B 0 SW 16Bit CMP 0 4/28/1999 0:00 NZCMCD2 B 0 SW 16Bit CMP 0 4/28/1999 0:00 NZCMCD3 B 0 SW 16Bit cmp 0 4/28/1999 0:00 NZCMCD4 B 0 SW 16Bit cmp 0 4/28/1999 0:00 NZCMDQ3 B 0 Answer/Data Sheets CMR 0 4/18/2002 0:00 NZCMDS2 B 0 SW 16Bit CMP 0 4/28/1999 0:00 NZCPT10 B 0 SW 16Bit CPT 0 12/31/1899 0:00 NZCRF1G B 0 QuikScore Form CRS 0 12/31/1899 0:00 NZCRF2H B 0 QuikScore Form CRS 0 12/31/1899 0:00 NZCRF34 B 0 QuikScore Form CRS 0 12/31/1899 0:00 NZCRF35 B 0 QuikScore Form CRS 0 12/31/1899 0:00 NZCRF36 B 0 QuikScore Form CRS 0 12/31/1899 0:00 NZCRF38 B 0 QuikScore Form CRS 0 7/4/2001 0:00 NZCRF3E B 0 QuikScore Form CRS 0 12/31/1899 0:00 NZCRF40 B 0 QuikScore Form CRS 0 7/4/2001 0:00 N
ZCRF4F B 0 QuikScore Form CRS 0 12/31/1899 0:00 NZCRF5Y B 0 QuikScore Form CAS 0 12/31/1899 0:00 NZCRF6Z B 0 QuikScore Form CAS 0 12/31/1899 0:00 NZCRF7K B 0 Feedback CRS 0 12/31/1899 0:00 NZCRF8K B 0 Feedback CRS 0 12/31/1899 0:00 NZCRF9I B 0 Feedback CRS 0 12/31/1899 0:00 NZCRFAI B 0 Feedback CRS 0 12/31/1899 0:00 NZCRFBI B 0 Feedback CAS 0 12/31/1899 0:00 NZCRFC2 B 0 Feedback CAS 0 12/31/1899 0:00 NZCRP1K B 0 Feedback CRS 0 12/31/1899 0:00 NZCRP2K B 0 Feedback CRS 0 12/31/1899 0:00 NZCRP3I B 0 Feedback CRS 0 12/31/1899 0:00 NZCRP4I B 0 Feedback CRS 0 12/31/1899 0:00 NZCRP51 B 0 Feedback CAS 0 12/31/1899 0:00 NZCRP62 B 0 Feedback CAS 0 12/31/1899 0:00 NZCRS11 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS13 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS15 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS17 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS19 B 0 QuikScore Form CAS 0 1/1/1997 0:00 NZCRS21 B 0 QuikScore Form CAS 0 1/1/1997 0:00 NZCRS23 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS25 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS27 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS29 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS31 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS33 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS35 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS37 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS39 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS41 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS43 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS45 B 0 Feedback CRS 0 1/1/1997 0:00 NZCRS47 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS48 B 0 QuikScore Form CRS 0 1/1/1997 0:00 NZCRS49 B 0 Profiles CRS 0 1/1/1997 0:00 NZCRS59 B 0 QuikScore Form CRS 0 12/31/1899 0:00 NZCRS60 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS62 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS64 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS66 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS68 B 0 QuikScore Form CAS 0 1/1/1998 0:00 NZCRS70 B 0 QuikScore Form CAS 0 1/1/1998 0:00 NZCRS80 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS82 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS84 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS86 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS87 B 0 QuikScore Form CRS 0 1/1/1998 0:00 NZCRS9S A 0 Kit CRS 0 1/1/1997 0:00 NZCRSXS B 0.3 Manual CRS 0 1/1/1998 0:00 NZCS1KE B 0 Scoring Key/Material STC 0 1/1/1997 0:00 NZCS1MA B 0 Manual STC 0 1/1/1997 0:00 NZCSQ10 B 0 Interview Guide/Bklt CSQ 0 6/6/2002 0:00 NZCTT1P C 0 Admin. Material CLO 0 1/1/1995 0:00 N
ZCTT2P C 0 Admin. Material CLO 0 1/1/1995 0:00 NZDTS1F B 2 QuikScore Form DTS 0 3/20/2000 0:00 NZDTS1P B 2.1 QuikScore Form DTS 0 3/20/2000 0:00 NZDTS1S B 0 QuikScore Form DTS 0 12/31/1899 0:00 NZDUTC1 B 3 QuikScore Form PAN 0 12/31/1899 0:00 NZDUTC2 B 10 Interview Guide/Bklt PAN 0 12/31/1899 0:00 NZEQ20 B 0 QuikScore Form EQI 0 12/31/1899 0:00 NZEQ360 B 28.35 Interview Guide/Bklt EQ3 0 12/31/1899 0:00 NZEQ361 B 0 Answer/Data Sheets EQ3 0 12/31/1899 0:00 NZEQ362 B 0 QuikScore Form EQ3 0 12/31/1899 0:00 NZEQ363 B 0 Admin. Material EQ3 0 12/31/1899 0:00 NZEQ364 B 0 Answer/Data Sheets EQ3 0 12/31/1899 0:00 0ZEQ6PF B 5 Test Booklet EQI 0 1/1/1997 0:00 NZEQDFX B 0 Answer/Data Sheets EQI 0 11/21/1999 0:00 NZEQF1F B 5 Test Booklet EQI 0 1/1/1998 0:00 NZEQI33 B 5.25 Test Booklet EQ5 0 4/18/2002 0:00 NZEQI36 B 0 Answer/Data Sheets EQ5 0 12/31/1899 0:00 NZEQI37 B 0 Answer/Data Sheets EQ5 0 12/31/1899 0:00 NZEQI38 B 0 Answer/Data Sheets EQ5 0 12/31/1899 0:00 NZEQI41 B 0 Answer/Data Sheets EQ5 0 12/31/1899 0:00 NZEQI61 B 0 Answer/Data Sheets EQV 0 12/31/1899 0:00 NZEQI62 B 0 Answer/Data Sheets EQV 0 12/31/1899 0:00 NZEQI63 B 0 Answer/Data Sheets EQV 0 12/31/1899 0:00 NZEQI64 B 0 Answer/Data Sheets EQV 0 12/31/1899 0:00 NZEQI71 B 0 QuikScore Form EQI 0 12/31/1899 0:00 NZEQI73 B 10.5 Test Booklet EQS 0 1/31/2002 0:00 NZEQIAF B 0 Answer/Data Sheets EQI 0 1/1/1997 0:00 NZEQIDR B 0 Answer/Data Sheets EQI 0 12/31/1899 0:00 NZEQIFX B 0 Answer/Data Sheets EQi 0 11/21/1999 0:00 NZEQIRR B 0 Answer/Data Sheets EQI 0 12/31/1899 0:00 NZEQIRS B 0 Answer/Data Sheets EQI 0 12/31/1899 0:00 NZEQIS10 B 2 QuikScore Form EQI 0 3/13/2002 0:00 NZEQISR B 0 Answer/Data Sheets EQI 0 1/1/1997 0:00 NZEQITR B 0 Answer/Data Sheets EQI 0 1/1/1998 0:00 NZEQRFX B 0 Answer/Data Sheets EQI 0 11/21/1999 0:00 NZEQS1F B 5.25 Test Booklet EQI 0 1/1/1998 0:00 NZEQYS1 B 0 QuikScore Form EQY 0 4/25/2002 0:00 NZEQYS3 B 0 QuikScore Form EQY 0 4/25/2002 0:00 NZEQYV0 B 2.1 QuikScore Form EQI 0 12/31/1899 0:00 NZEQYV9 B 2.1 QuikScore Form EQI 0 12/31/1899 0:00 NZEUIAB A 0 Audio EUG 0 1/1/1998 0:00 NZEUIPC A 0 Audio GAF 0 1/1/1998 0:00 NZFA1GP B 0 Profiles FAM 0 1/1/1996 0:00 NZFAF01 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFAF02 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFAF03 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFAF04 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFAF05 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFAF06 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFAM2P B 0 QuikScore Form FAM 0 1/1/1988 0:00 NZFAM3P B 0 QuikScore Form FAM 0 1/1/1988 0:00 NZFAM4P B 0 QuikScore Form FAM 0 1/1/1988 0:00 NZFAS01 B 0 QuikScore Form FAM 0 3/29/1999 0:00 NZFAS02 B 0 QuikScore Form FAM 0 3/29/1999 0:00 N
ZFAS03 B 0 QuikScore Form FAM 0 3/29/1999 0:00 NZFAS04 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFAS05 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFAS06 B 0 QuikScore Form FAM 0 5/24/2001 0:00 NZFREN1 B 3 QuikScore Form PAN 0 12/31/1899 0:00 NZFREN2 B 10 Interview Guide/Bklt PAN 0 12/31/1899 0:00 NZFTT00 B 0 Interview Guide/Bklt FIT 0 12/31/1899 0:00 0ZHDI02 B 0 Test Booklet HDI 0 12/31/1899 0:00 NZHDI03 B 0 Test Booklet HDI 0 12/31/1899 0:00 NZHDI04 B 0 Test Booklet HDI 0 12/31/1899 0:00 NZHDI05 B 0 Test Booklet HDI 0 12/31/1899 0:00 NZHDI06 B 0 QuikScore Form HDI 0 12/31/1899 0:00 NZHDI08 B 0 QuikScore Form HDI 0 12/31/1899 0:00 NZHP3FF B 0 QuikScore Form HPS 0 1/1/1998 0:00 NZHPS01 A 0 0 12/31/1899 0:00 0ZHPS02 A 0 0 12/31/1899 0:00 0ZHPS03 A 0 0 12/31/1899 0:00 0ZIC1PB A 0 Video IBC 0 1/1/1995 0:00 NZIC1VA A 0 Video IBC 0 1/1/1995 0:00 NZIC2VA A 0 Video IBC 0 1/1/1998 0:00 NZIC3VA A 0 Video IBC 0 1/1/1998 0:00 NZIEQ06 B 0 QuikScore Form IEQ 0 12/31/1899 0:00 NZIEQ08 B 0 QuikScore Form IEQ 0 12/31/1899 0:00 NZIEQ10 B 0 QuikScore Form IEQ 0 12/31/1899 0:00 NZIEQ12 B 0 QuikScore Form IEQ 0 12/31/1899 0:00 NZIEQ14 B 0 QuikScore Form IEQ 0 12/31/1899 0:00 NZISS20 B 0 QuikScore Form ISS 0 12/31/1899 0:00 NZISS30 B 0 Misc ISS 0 12/31/1899 0:00 NZJIR00 B 0 Test Booklet JIR 0 12/31/1899 0:00 0ZJIR01 B 0 QuikScore Form JIR 0 12/31/1899 0:00 0ZKD010 A 0 SW 16Bit NON 0 4/28/1999 0:00 NZLS12P b 0 Profiles LSI 0 1/1/1995 0:00 0ZLS3FP A 0 Interview Guide/Bklt LSI 0 2/21/2000 0:00 NZLS3SD A 0 Interview Guide/Bklt LSI 0 1/1/1998 0:00 NZLS5PF A 0 QuikScore Form LSI 0 1/1/1996 0:00 NZLS5SE A 0 QuikScore Form LSI 0 1/1/1998 0:00 NZLS7SF A 0 Profiles LSI 0 1/1/1998 0:00 NZLSCR1 B 0 Profiles LSI 0 12/31/1899 0:00 NZLSCR2 B 0 Interview Guide/Bklt LSI 0 12/31/1899 0:00 NZLSCR3 B 0 QuikScore Form LSI 0 12/31/1899 0:00 NZLSS1E A 0 Interview Guide/Bklt LSI 0 12/31/1899 0:00 NZLSS2D A 0 QuikScore Form LSI 0 12/31/1899 0:00 NZMAS7D B 0 QuikScore Form MAS 0 1/1/1997 0:00 NZMASCD B 0 QuikScore Form MAS 0 1/1/1997 0:00 NZMSC05 B 14 Test Booklet MSC 0 3/15/2002 0:00 NZMSC06 B 0 Answer/Data Sheets MSC 0 3/26/2002 0:00 NZMSCRS B 0 Answer/Data Sheets MSC 0 12/31/1899 0:00 NZMTOA3 C 0 Answer/Data Sheets MTO 0 12/31/1899 0:00 NZMTOA5 C 0 Answer/Data Sheets MTO 0 12/31/1899 0:00 NZMTOA7 C 5 Admin. Material MTO 0 12/31/1899 0:00 NZMTOA8 C 41 Admin. Material MTO 0 12/31/1899 0:00 NZNIM60 A 0 Answer/Data Sheets nim 0 12/31/1899 0:00 NZNIM70 A 0 Admin. Material nim 0 12/31/1899 0:00 NZOA3RG A 0 Admin. Material CAD 0 1/1/1998 0:00 N
ZOA4RG A 0 Admin. Material CAD 0 1/1/1998 0:00 NZOA5RE A 0 Admin. Material CAD 0 1/1/1998 0:00 NZOA6RG A 0 Admin. Material CAD 0 1/1/1998 0:00 NZPA1AE A 0 Audio PAD 0 1/1/1996 0:00 NZPA1HF A 0 Audio PAD 0 1/1/1996 0:00 NZPA2AE A 0 Audio PAD 0 1/1/1996 0:00 NZPA2HF A 0 Audio PAD 0 1/1/1996 0:00 NZPA3AE A 0 Audio PAD 0 1/1/1996 0:00 NZPA3HF A 0 Audio PAD 0 1/1/1996 0:00 NZPAFR1 B 1 QuikScore Form PAN 0 2/21/2000 0:00 NZPAFR2 B 10 Interview Guide/Bklt PAN 0 2/22/2000 0:00 NZPAGR1 B 1 QuikScore Form PAN 0 2/25/2000 0:00 NZPAGR2 B 10 QuikScore Form PAN 0 2/25/2000 0:00 NZPAGR3 B 2 QuikScore Form PAN 0 2/25/2000 0:00 NZPAIQ1 B 0 Interview Guide/Bklt PAN 0 11/5/1999 0:00 NZPAN10 B 0 Interview Guide/Bklt PAN 0 3/15/2000 0:00 NZPAN20 B 10 Interview Guide/Bklt PAN 0 3/15/2000 0:00 NZPASP1 B 2 Interview Guide/Bklt PAN 0 2/17/2000 0:00 NZPCLG1 C 0 QuikScore Form PCL 0 11/3/1999 0:00 NZPCLG2 C 0 Interview Guide/Bklt PCL 0 7/25/2000 0:00 NZPCLR0 C 0 QuikScore Form PC2 0 12/31/1899 0:00 0ZPCLR1 C 0 Interview Guide/Bklt PC2 0 12/31/1899 0:00 0ZPCLSL A 0 Audio PCL 0 1/1/1996 0:00 NZPCS1K C 0 Admin. Material PCL 0 1/1/1998 0:00 NZPCS2K C 0 Admin. Material PCL 0 1/1/1998 0:00 NZPCSN1 A 0 QuikScore Form PSC 0 12/31/1899 0:00 NZPCT3P A 0 Admin. Material PCP 0 1/1/1997 0:00 NZPCV1K C 0 Admin. Material PCL 0 1/1/1998 0:00 NZPCV2K C 0 Admin. Material PCL 0 1/1/1998 0:00 NZPCYV1 C 0 QuikScore Form pcy 0 1/1/1991 0:00 0ZPCYV2 C 0 Interview Guide/Bklt pcy 0 1/1/1991 0:00 0ZPDS30 B 0 QuikScore Form PDX 0 3/29/1999 0:00 NZPDSF1 B 0 QuikScore Form PDX 0 8/22/2000 0:00 NZPFE4E B 0 QuikScore Form PFC 0 12/31/1899 0:00 NZPMCD1 A 0 SW 16Bit SHR 0 4/28/1999 0:00 NZPMCD2 B 0 SW 16Bit SHR 0 4/28/1999 0:00 NZPMCD3 B 0 SW 16Bit shr 0 4/28/1999 0:00 NZPMCD4 A 0 sw 16bit SHR 0 4/28/1999 0:00 NZPMDOD B 0 SW 16Bit SHR 0 12/31/1899 0:00 NZPMF1C A 35 Manual SHR 0 1/1/1997 0:00 NZPMF2C A 0 SW 16Bit SHR 0 1/1/1997 0:00 NZPML1C A 0 SW 16Bit SHR 0 1/1/1996 0:00 NZPML2B A 0 Manual SHR 0 1/1/1996 0:00 NZPOM18 B 0 Scoring Key/Material P02 0 12/31/1899 0:00 0ZPOM20 B 0 Scoring Key/Material P02 0 12/31/1899 0:00 0ZPOM22 B 0 Scoring Key/Material P02 0 12/31/1899 0:00 0ZPPC00 B 0 QuikScore Form PPT 0 12/31/1899 0:00 0ZPRCD1 B 0 SW 16Bit PPO 0 4/28/1999 0:00 NZPRCD2 B 0 SW 16Bit PPO 0 4/28/1999 0:00 NZPRCD3 B 0 SW 16Bit PPO 0 4/28/1999 0:00 NZPRCD4 B 0 SW 16Bit ppo 0 4/28/1999 0:00 NZPRDS2 B 0 SW 16Bit PPO 0 4/28/1999 0:00 NZPS11F B 5.5 Test Booklet PSI 0 1/1/1996 0:00 NZPS12F B 5.5 Test Booklet PSI 0 1/1/1988 0:00 N
ZPSP2D B 0 Scoring Key/Material PSP 0 1/1/1994 0:00 NZPSP2E B 0 QuikScore Form PSP 0 1/1/1994 0:00 NZPSP3C B 0 Test Booklet PSP 0 1/1/1994 0:00 NZPTS10 0 SW 16Bit UNK 0 12/31/1899 0:00 NZPTS20 0 Misc UNK 0 12/31/1899 0:00 NZPTS30 0 Misc UNK 0 12/31/1899 0:00 NZPTS40 0 SW 16Bit UNK 0 12/31/1899 0:00 NZRCL3B B 0 QuikScore Form REH 0 12/31/1899 0:00 NZRSP04 B 0 QuikScore Form RSO 0 12/7/2001 0:00 NZSA3PC A 0 QuikScore Form SAR 0 12/31/1899 0:00 NZSA43C B 0 QuikScore Form SA4 0 1/1/1998 0:00 NZSA4P0 0 0 12/31/1899 0:00ZSA5P0 A 0 Admin. Material SAR 0 12/31/1899 0:00 NZSASC1 B 0 Interview Guide/Bklt SAS 0 8/18/2000 0:00 NZSASF1 B 0 QuikScore Form SAS 0 10/12/2000 0:00 NZSASF2 B 0 Interview Guide/Bklt SAS 0 10/12/2000 0:00 NZSASP2 B 0 Interview Guide/Bklt SAS 0 5/14/1999 0:00 NZSASP4 B 0 QuikScore Form SAS 0 5/14/1999 0:00 NZSASS1 B 0 QuikScore Form SAS 0 10/18/1999 0:00 NZSASS3 B 0 Interview Guide/Bklt SAS 0 10/18/1999 0:00 NZSCCZ1 B 0 Profiles PAN 0 12/31/1899 0:00 NZSCFN1 B 0 Profiles PAN 0 12/31/1899 0:00 NZSCHG1 B 0 Profiles PAN 0 12/31/1899 0:00 NZSCIPS B 0 Interview Guide/Bklt PAN 0 12/31/1899 0:00 NZSCM10 A 0 Scoring Charges FCN 0 12/31/1899 0:00 NZSCM20 A 10 Scoring Charges FCI 0 12/31/1899 0:00 NZSCM30 A 10 Scoring Charges FCM 0 12/31/1899 0:00 NZSCR1A A 0 Scoring Charges FCN 0 1/1/1988 0:00 NZSCR2B 0 Scoring Charges FCN 0 12/31/1899 0:00 NZSCR3A A 0 Scoring Charges FCI 0 1/1/1988 0:00 NZSCR4A A 20 Scoring Charges FCI 0 1/1/1988 0:00 NZSCR5A A 0 Scoring Charges FCM 0 1/1/1988 0:00 NZSCR6A A 20 Scoring Charges FCM 0 1/1/1988 0:00 NZSCR7A A 0 Scoring Charges EQF 0 1/1/1998 0:00 NZSCRS1 B 0 Profiles PAN 0 12/31/1899 0:00 NZSEC03 B 0 Admin. Material SEC 0 12/31/1899 0:00 0ZSEC10 B 0 Admin. Material SEC 0 12/31/1899 0:00 1ZSP8FR B 0 QuikScore Form SPA 0 11/5/1999 0:00 NZSPC3C B 0 QuikScore Form SPA 0 1/1/1997 0:00 NZSPC5F B 0 QuikScore Form SPA 0 11/5/1999 0:00 NZSPC6S B 0 QuikScore Form SPC 0 2/21/2000 0:00 NZSPCP1 B 0 QuikScore Form SPA 0 12/31/1899 0:00 NZSPPRT B 0 QuikScore Form SPA 0 2/19/1999 0:00 NZSPS06 B 0 QuikScore Form SPS 0 12/31/1899 0:00 NZSPS08 B 0 QuikScore Form SPS 0 12/31/1899 0:00 NZSQP2C C 0 Test Booklet CSQ 0 1/1/1998 0:00 NZSQP3D C 0 Answer/Data Sheets CSQ 0 1/1/1998 0:00 NZST1MA B 0 Manual STA 0 1/1/1997 0:00 NZSTAIC B 0 SW 16Bit STC 0 12/31/1899 0:00 NZTI1PQ B 0 Admin. Material CRO 0 1/1/1990 0:00 NZTLRP3 B 0 QuikScore Form TOL 0 12/31/1899 0:00 NZTLRP4 B 0 QuikScore Form TOL 0 12/31/1899 0:00 NZTLRVD B 0 Admin. Material TOL 0 1/1/1998 0:00 NZWV30C A 0 QuikScore Form WVS 0 1/1/1995 0:00 N
ZWV40D A 0 QuikScore Form WVS 0 1/1/1995 0:00 NZWV50E A 0 QuikScore Form WVS 0 1/1/1995 0:00 NZWV60F A 0 QuikScore Form WVS 0 1/1/1995 0:00 NZWV90I A 0 QuikScore Form WVS 0 1/1/1995 0:00 NZYLS04 A 0 QuikScore Form YLS 0 12/31/1899 0:00 NZYLS06 A 0 QuikScore Form YLS 0 12/31/1899 0:00 NZYLS08 A 0 Interview Guide/Bklt YLS 0 12/31/1899 0:00 N
User8###############################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
##################################################################################################################################################################
#####################