Upload
dotruc
View
214
Download
0
Embed Size (px)
Citation preview
UNIVERSITY OF HAWAI'I LIBRARY
CHARACTERIZATION OF SENESCENCE REGULATEDGENE EXPRESSSION IN ANTHURIUM
A DISSERTATION SUBMITTED TO THE GRADUATE DIVISION OF THEUNIVERSITY OF HAWAI'I IN PARTIAL FULFILLMENT OF THE
REQUIREMENTS FOR THE DEGREE OF
DOCTOR OF PHILOSOPHY
IN
MOLECULAR BIOSCIENCES AND BIOENGINEERING
MAY 2003
By
Daniel Maida Hayden
Dissertation Committee:
David Christopher, ChairpersonDulal Borthakur
John HuMonto Kumagai
Wei-Wen Winston SuRichard Manshardt
©Daniel Maida Hayden 2003
ALL RIGHTS RESERVED
iii
Dedicated to an thosewho listen to myaspirations,
those who have helpedme reach for them,and those in the future
who will assist me in completing them
!V
ABSTRACT
Leaf senescence is a genetically regulated and orderly series of events signifying
the final stage of leaf development prior to organ death. During senescence, the loss of
photosynthesis is associated with the breakdown of chlorophyll and the disassembly of the
photosynthetic apparatus. Cell structure changes, organelles are disassembled and proteins,
lipids, nucleic acids and carbohydrates are hydrolyzed while the nutrients released by
hydrolysis are transported and recycled to growing tissues or are stored in reserve for latter
use. The factors regulating leaf senescence are complex and involve both external and
internal stimuli, such as darkness, pathogens, developmental signals and hormones. These
factors initiate signal transduction pathways that repress photosynthesis and activate the
expression of genes involved in cellular disassembly, recycling and integral defense-related
processes. The genes for mRNAs that increase markedly in abundance during senescence
have been designated as "senescence-associated genes" or SAGs.
This work characterizes senescence inAnthurium andraeanum through expression
analysis of theArabidopsis senescence-upreguiated promoter SAG12, isolation of a new
senescence-associated gene (anthl7), and expression profiling under dark induced and age
dependent senescence. Analysis of Pr-SAG1zrevealed a 20 fold increase in expression
when transiently bombarded into senescent leaves vs. healthy leaves. This shows the
senescence-dependent activation of the Arabidopsis Pr-SAG1Z in Anthurium implying the
existence of an orthologous senescence-regulated system with associated genes, signal
v
transduction pathways, and transcription factors in this plant. Two cysteine protease
cDNAs from Anthurium, anth16 and anth17, were sequenced and found to be expressed
differently throughout development and differ structurally in comparison with known
cysteine protease genes. These cDNAs are the first to be cloned and characterized from
this plant. Anth16 is expressed in immature leaves and is structurally similar to a thiol
protease sequenced from Matricaria chamomilla, possibly defining an alternate role in
development for these proteases. Anth17 is characterized as a senescence-associated gene
based on Northern blot analysis of developmental leaf stages in comparison with psbA, and
cab genes as indicators of photosynthetic gene expression. Furthermore, cytokinin
treatments decreased significantly anth17 mRNA levels during dark-induced senescence of
dark detached whole leaves, and leaf discs.
V1
TABLE OF CONTENTS
ABSTRACT v
LIST OF TABLES x
LIST OF FIGURES xi
LIST OF ABBREVIATIONS xiii
CHAPTER I. INTRODUCTION 1
Current Research Involving Senescence Gene Expression 2
Classification of senescence associated genes 2
Typical senescence up-regulated genes 4
Genes involved with protein degradation 8
Hormones Involved in the Regulation of Senescence 11
Honnones that accelerate senescence 11
Honnones that decrease or delay senescence 14
Specific roles of cytokinins in plant development 15
Anthurium Molecular Physiology 17
Anthutium senescence biochemistry 18
Anthutium flower senescence control 20
Autoregulatory Senescence-Inhibition System 21
CHAPTER II. SIGNIFIGANCE OF RESEARCH. 26
The Senescence-Activated Signaling Pathway That Activates the DieotPromoter, SAG12, May Be Evolutionarily Conserved In Anthurium 28
Expression and Proper Post-Translational Modification of GFP inAnthurium, Can Provide A Necessary Reporter Gene Tool ForAnthurium Molecular Studies 30
v11
A Senescence-Regulated Cysteine Protease Gene, Orthologous to sagl2,Exists In Anthurium 31
The Effect of Cytokinin and Sucrose on SAG Expression DuringSenescence 33
CHAPTER III. REGULATION OF THE SAG12 PROMOTER INANTHURIUM USING TRANSIENT BIOLISTIC
PARTICLE BOMBARDMENT 36
Introduction 36
Materials and Methods 38
Construction of Pr-SAGl2 reporter vectors 39
Particle bombardment of Anthurium leaves 41
GUS detennination 41
Visualization and detection of GFP 42
Results 43
Pr-SAG12 transient bombardment assays for expression of GFP 43
Discussion 46
CHAPTER IV. ISOLATION AND CHARACTERIZATION OF TWOCYSTEINE PROTEASE GENES FROMANTHURIUM AND EXPRESSION PROFILINGDURING DEVELOPMENT AND IN RESPONSE TOHORMONE TREATMENTS 54
Introduction 54
Materials and Methods 57
Plant material and growth conditions 57
RNA isolation 57
Hormone treatments and chlorophyll detennination 58
viii
RT-PCR, RACE, cDNA library construction, screening and cDNAcharacterization 58
Nortbem blot analysis, probe construction, and band quantification 60
Results 61
Isolation and characterization of two cDNAs encoding cysteineproteases from Anthuriwn 61
Synthetic cytokinin, BA, represses the expression of anth 17 68
Discussion 71
RNA isolation and manipulation 71
Analysis of Anth16 and Anth17 protein structure 76
Expression analysis of cysteine proteases during development 82
Expression analysis of anth 17 mRNA under dark induced senescenceand hormone treatment 84
CHAPTER V. CONCLUSION AND PROSPECTIVE 90
Establishing Molecular Techniques to Deal withRecalcitrant Tropical Species 90
Contribution to the Fields of Post-Harvest Physiology and MolecularBiology of Leaf Senescence 92
Cysteine Proteases and Their Role in Commercial and IndustrialApplications 93
CHAPTER VI. LITERATURE CITED 96
IX
LIST OF TABLES
TABLE PAGE
1.1 Cysteine protease genes that are characterized asbeing senescence up-regulated 24
3.1 Quantitation of PSAGldJP4 and p35S-gjp4expression in senescent and healthy tissues ..46
4.1 Percent identity and similarity (in parenthesis)between the deduced amino acid sequences ofcysteine proteases from 8 plant species and withanth16 and anth/7 fromAnthutium andraeanum 65
x
LIST OF FIGURES
FIGURE PAGE
3.1 P,,,,12-GFP4 in pBLUESCRIPT II KS ..40
3.2 P,,,,12-IPT in a binary vectot.. ..40
3.3 P"glZ-IPT in pUC18 termed pSGS16 40
3.4 pBIN 3SS-mGFP4 40
3.5 GFP in senescing leaf tissues expressed with Pr"g12 .44
3.6 GFP in senescing leaf tissues expressed with Pr35S 44
3.7 GFP in senescing leaf tissues expressed with Pr3SS(lower magnification) 44
3.8 Transient expression of GFP4 and GFPS asregulated by Pr-SAG12 and Pr-3SS in tissue cultureleaf samples ofvarious developmental stages .45
3.9 Comparison of the FITC and wtGFP filter cubeswith wound response to Pr-SAG12 in healthy tissues ..46
4.1 Nucleotide and deduced amino acid sequence ofanthl6 62
4.2 Nucleotide and deduced amino acid sequence ofanthI7 63
4.3 Alignment of amino acid sequences derived fromanth16 and anth17 with those from 8 differentplant proteases 64
4.4 Expression of anthl7, anthl6, cab, psbA, and ubimRNA in leaves at different developmental stages 67
4.5 Expression of anth17 in comparison withphotosynthetic transcript psbA under cytokinintreatments using dark detached whole leaves 69
Xl
4.6 Expression of anth/7 in comparison withphotosynthetic transcript psbA under cytokinintreatments using dark detatched leaf discs 70
4.7 10 I-'ll of Total RNA from developmental leavesloaded on a 1.5% Formaldehyde MOPS gel andvisualized with EtBr 75
4.8 5 f'l of Total RNA from leaf disc treatments loadedon a 1.5% Formaldehyde MOPS gel and visualizedwith EtBr 76
4.9 Hydropathy profile of the deduced amino acidsequences of Anth16 and Anth17 predicted usingthe Kyle and Doolitde method 78
Xll
ABA
ACC
ADP
Ala
anth/6
anth/7
Asn
Asp
ATP
BA
bp
cab
cDNA
ChI
COOH
Cys
DLU
DMF
DNA
ECM
ER
EtBr
EXT
FITC
GAL
GCG
LIST OF ABBREVIATIONS
Absorbance at 260 run
Absorbance at 280 nm
Abscisic Acid
aminocyclopropane carboxylate
adenosine di-phosphate
alanine
Anthurium cysteine protease gene
Anthunum SAG cysteine protease gene
asparagme
aspartic acid
adenosine tri-phosphate
benzyladenine
base pair
Chlorophyll AlB binding protein gene
complementary DNA
chlorophyll
carboxyl terminus
cysteine
digital light unit
dimethyl formamide
deoxyribonucleic acid
extracellular matrix
endoplasmic reticulum
ethidium bromide
endoxyloglucan transferases
fluorescein isothiocyanate
~-galactosidase
genetics computer group
XI11
GENBANK
GFP
Gly
GPI
GST
GUS
His
HPPD
IPT
JAKB
Luc
Lue
Met
MG
MOPS
mRNA
NH
nos
PCD
PCR
PDS
PEP
Pr-3SS
Pr-ANTH17
Pro
Pr-SAG12
psbA
PVP
PVPP
RACE
NIH genetic sequence database
green fluorescent prorein
glycine
glycosylphosphatidylinositol
glutathione S-transferase
~-glucuronidase
histidine
4-hydroxyphenylpyruvate dioxygenase
isopentyl transferase
jasmonic acid
kilobase
Iuciferase
luecine
methionine
mature green leaf
3-(N-Morpholino)-propanesulfonic acid
messenger RNA
amino terminus
nopaline synthase
programmed cell death
polymerase chain reaction
particle delivery system
phosphoenOlpyruvate
cauliflower mosaic 3SS viral promoter
anth/7 promoter
proline
sag!2 promoter
Dl protein of PSI!
Polyvinylpyrrolidone
Polyvinylpolypyrrolidone
Rapid amplification of cDNA endsXlv
REDOX
RNA
rpPCR
RT-PCR
RUBISCO
S1
S2
S3
SAG
SARI<.
SDS
Ser
T-SrAR
Tyr
~E
ubi
USDA
UV
Val
wrGFP
X-glue
YG
oxidation reduction
ribonucleic acid
reverse primer PCR
reverse transcription PCR
ribulose bisphosphate carboxylase/oxygenase
senescence stage one
senescence stage two
senescence stage three
senescence-associated gene
senescence associated receptor-like protein kinase
sodium dodecyl sulfate
senne
Tropical & Subtropical Agricultural Research
Tyrosine
micro Einstein
ubiquitin gene
United States Department ofAgriculture
Ultra Violet
Valine
wild type GFP
S-bromo-4-chloro-3-indoyl glucuronide
young green (immature)
xv
CHAPTER I
INTRODUCTION
Senescence is a complex, highly controlled developmental phase in the final stage
of the leaf life cycle that results in the coordinated degradation of macromolecules and
the subsequent mobilization of components to other parts of the plant. Cells remain
viable during the process and new gene expression is required. Physiological studies
show that the cell structure changes, chloroplasts break down, but mitochondria remain
intact until late senescence. Biochemical studies show an increase in pH, metabolic
enzyme activities, the degradation of chlorophylls and the synthesis of anthocyanins and
phenolics. Molecular studies show an increase in the expression of genes encoding
enzymes for protein degradation (proteases), nitrogen remobilization, lipid and
carbohydrate metabolism, and nucleic acid degradation (nucleases). While these genes
are enhanced during senescence, the expression of photosynthesis genes that encode light
harvesting components and Calvin cycle enzymes, are decreased. Analysis of gene
expression during distinct developmental stages shows a concise pattern of gene
regulation enabling us to predict the function of the proteins produced and their
importance to the life cycle of the plant.
1
Current Research Involving Senescence Gene Expression
Classification ofsenescence associated genes
Senescence in plants can be stimulated by a variety of environmental and genetic
controls, such as development, wounding, heat stress, light stress, salt stress, and
pathogen attack. It is also coordinated on a molecular level by natural ripening responses
(ethylene), or nutrient relocation involved in seed production, nutrient storage, flower
production, changes in source-sink relationships, and the removal of leaves that no longer
receive sufficient light. Natural senescence includes genes that influence protein
degradation, nucleic acid breakdown, lipid remobilization, chlorophyll breakdown, and
nitrogen remobilization. Several reviews of leaf senescence, (Sancher 1973; Beevers
1976; Thimann 1980; Thompson and Platt-Aloia 1980; Biswal and Biswal 1984; Sexton
and Woolhouse 1984; Kelly and Davies 1988; Matile 1992; Lohman et al. 1994; Smart
1994; Buchanan-Wollaston and Ainsworth 1997; Nooden et at. 1997; Lee et at. 2001)
describe the leaf senescence of cereal, tobacco, some legumes, and a few flower model
systems. Leaf senescence has been extensively studied, but its mechanisms are complex
and consist of multiple pathways. By analyzing gene expression under natural and
induced conditions, we can gain a better understanding of the role of each gene in leaf
development.
Gene expression in leaf senescence is defined by a number of classes labeled
senescence activated genes (SAGs) (Smart 1994). There are 6 separate classes of genes
characterized by their pattern of expression and by the function of the proteins produced
during plant leaf senescence. Four additional gene classes have been added as a result of
SAG expression analysis during senescence in Brassica napus (Buchanan-Wollaston
2
1994). Class 1 contains "housekeeping" genes that control essential metabolic activities
of the cell and are expressed at a constant level throughout the life of the leaf. Classes 2
and 3 are genes expressed in green leaves, but their effect is seen at a later stage. Class 2
involves proteins encoded during leaf growth which are activated during senescence long
after their gene is turned off. Class 3 genes are also turned off and their inactivation
causes the initiation of senescence. These genes encode growth and carbon assimilation
components. Class 6 genes encode proteins that remobilize storage products. These
genes are also expressed during other developmental stages.
Further research on Brassica napus gene expression has identified 4 more classes
of genes with SAG functions (Buchanan-Wollaston and Ainsworth 1997). Class 7 genes
include genes that show a gradual increase in mRNA levels, from low expression in
young leaves, to a high level of expression increasing throughout senescence. Class 8
genes are similar to class 7, but differ in the respect that mRNA levels are low in early
stages of development, but increase dramatically at a particular stage of senescence.
Class 9 genes are expressed at a specific stage in senescence, but unlike class 5 genes,
their expression does not continue throughout late senescence. Class 10, the final class,
is a set of genes that show strong expression in early leaf development and again during
senescence
Classes 4 and 5 genes have some involvement in senescence and their expression
can be identified during a senescence inducing, or repressing event. Class 4 type genes
include regulatory genes expressed for a short period of time at the initiation of
senescence and control its timing and rate of progress. Class 5 genes are involved with
mobilization processes specifically expressed during senescence. SAG genes include
3
genes involved in defense, sugar remobilization, amino acid metabolism, fatty acid
metabolism, oxidation protection, sequesterization and transport of molecules and
macromolecules, cell wall disassembly, and phytohormone production. It is beyond the
scope of this report to list every gene involved with the coordinated process of recycling
cell components for export to healthy tissues, however some genes that have been
characterized through transcript analysis as being senescence-associated will be
discussed.
Typical senescence up-regulated genes
Chitinases are important for the degradation of chitin, the most abundant organic
nitrogen-bearing compound in nature. Chitin is most common in insects and in fungal cell
walls, but is also found in many other organisms. An ethylene-induced chitin-binding
protein has been purified from rose leaves (Yang and Gong 2002). It is possible that a
senescent tissue synthesizes proteins to defend against pathogenic attack while in a
weakened senescent state, but may also synthesis chitinases to degrade cell walls or be
involved in signal transduction by acting on endogenous substrates (Hanfrey et al. 1996).
Chitinases commonly induced during pathogenic attack have been found to be inducible
during natural and artificial leaf senescence further implicating pathogen-related proteins
role in the senescence process (Lers et al. 1998).
Pyruvate a-phosphate dikinase catalyzes the reversible conversion of ATP to
AMP, pyrophosphate and phosphoenolpyruvate (PEP). Its potential role in senescence
may involve converting the pyruvate produced from amino acid breakdown into PEP
(Smart et aI. 1995). PEP is also an intermediate in gluconeogenesis, active cycle in a
4
senescing leaf, turning lipids and photosynthetic products into sucrose for use in
respiration or export from the senescing leaf. Many genes implicated in lipid metabolism
have been characterized as SAGs, including an in-chain fatty acid hydroxylase bound to
cytochrome P450 (panavas et al. 1999). Interestingly enough, this hydroxylase is also
up-regulated in the presence of certain herbicides and MnCh (Cabello-Hurtado et al.
1998). Cytochorome P450 includes a class of key enzymes involved in the synthesis of a
large variety of secondary plant metabolites including flavonoids, phytoalexins and lignin
(Butt and Lamb 1981). The role of these enzymes in plant senescence is not understood.
Metallothioneins are small proteins that bind heavy metals such as zinc, copper,
and magnesium, through clusters of thiolate bonds. During senescence it may be
required to bind metal ions as either a detoxification role or a sequestering role for
storage or mobilization. The metallothioneins may also protect DNA from damaging
oxidative effects caused by chlorophyll and membrane breakdown and subsequent free
radical production (Chubatsu and Meneghini 1993). A metallothionein gene is shown to
be upreguiated during senescence (Buchanan-Wollaston 1994) and also shows some
sensivity to pathogenic attack (Butt et al. 1998).
Many genes SAGs are involved in the modification and mobilization of amino
acids. Genes that encode enzymes aminotransferase, branched-chain a-keto
dehydrogenase, and ~-methylcrotonyl-CoA carboxylase for amino acid metabolism and
4-hydroxyphenylpyruvate dioxygenase (HPPD) for aromatic amino acid degradation are
upregulated at some point during senescence (Lee et aI. 2001). The function of
glutathione S-transferase (GST) is the conjugation of reduced glutathione to a wide
number of exogenous and endogenous hydrophobic electrophiles. GST could also have a
5
role in sulfur storage and mobilization released during macromolecule degradation
(Smart et al. 1995). GST also retains a detoxification role with herbicides and its
senescence-related expression may be related to stress. Glutamine synthase has many
functions and isoforms located in the cytosolic and chloroplastic regions of the cell. A
glutamine synthase like protein has been shown to be senescence upregulated in Brassica
napus (Buchanan-Wollaston and Ainsworth 1997). This coincides with the need to
transport nitrogen in the form of glutamine from senescing cells (Feller and Fischer
1994). Many genes that involve the recycling amino acids are upregulated during
senescence to provide easy transport to sinks located in other parts of the plant.
Endoxyloglucan transferases (EXTs) have two distinct activities, the endo-type
splitting of xyloglucans and transglycosylation. These processes are suggested to modify
a major hemicellulose of the cell wall (Okazawa et al. 1993; Xu et al. 1996). Due to their
expression during senescence, it is considered that the EXTs carry out hydrolysis of
xyloglucan rather than transglycosylation, and is involved in cell wall degradation (Park
et al. 1998).
ACC oxidase is involved with the biosynthetic pathway of a common senescence
inducing hormone, ethylene. Ethylene up-regulates its own production during senescence
but also is implicating in up-regulating genes such as a calmodulin-binding protein,
(Yang and Poovaiah 2000) a lipolytic acyl hydrolase, (Hong et al. 2000) and a
glutathione S-transferase (Meyer et al. 1991). Most genes that are ethylene-induced
during senescence were isolated from flowers such as rose, carnation, and daylily.
Another phytohormone related gene induced during senescence is involved with signal
transduction. A senescence associated receptor-like protein kinase (SARK) cloned from
6
Phaseolous vulgaris shows up-regulation slightly before senescence begins and is present
throughout (Hajouj et al. 2000). This may suggest that SARK expression may regulate
some pathways of the senescence program.
Genes that exhibit SAG characteristics are identified through Northern Blot
analysis using cDNA clones to detect increased mRNA transcription levels in senescing
leaf tissue. In order to identify the precise time during leaf senescence at which the
expression of a specific gene is induced, it is essential to characterize the biochemical and
physiological changes that map each stage during leaf development and senescence
(Buchanan-Wollaston and Ainsworth 1997). Some SAGs are expressed in pre-senescent
tissue and their expression simply increases during senescence, while other SAGs are
more specific to senescence and are expressed only during senescence. This indicates the
presence of multiple pathways in the regulation of senescence (Gan and Amasino 1995;
Weaver et al. 2001). Based on this analysis, senescence includes pathways that are
exclusively activated by developmental, environmental, or hormonal stimuli (Noh and
Amasino 1999a). In order to gain a complete understanding of a particular gene and its
senescence associated expression, we must expose the tissue to several experimental
treatments. Through this method we are able to establish a consistent measure of SAG
expression throughout the life of the plant, under hormonal control, and in response to
stress conditions such as desiccation, abscission, and darkness. This enables the proper
characterization of gene function and contributes to the identification of a variety of
senescence-related promoters.
7
Genes involved with protein degradation
Senescence activated protein degradation is the most significant breakdown
process that occurs in an aging leaf. The degradation of proteins to amino acids allows
them to be recycled for use in other tissues. This remobilization of amino acids from
senescing tissues is essential in the formation of new organs in other areas of the plant.
Identification of key enzymes involved in senescence is difficult due to the high
concentration already present in the vacuole of the developing leaf. Therefore, the
identification of genes involved in senescence-enhanced protein degradation is
particularly important and gives insight into the biochemical and physiological changes
in the plant on a molecular level. Many genes encoding proteases, whose expression is
enhanced in senescence, have been isolated and characterized including aspartic
proteases and cysteine proteases.
The LSC760 aspartic protease gene of B. napus is expressed in young leaves and
mature green leaves, but expression increased markedly during senescence (Buchanan
Wollaston and Ainsworth 1997). Cysteine proteases have been isolated from a variety of
species and their genes vary in expression during senescence. Oryzain y protease from
rice is a seed-specific protease that is expressed in germinating seeds. It functions in the
remobilization of storage proteins to supply developing seedlings (Watanabe and Imasek
1982). This gene may perform a similar function in senescing leaves. The levels of other
cysteine proteases are enhanced in senescing leaves. The sag12 gene, from Arabidopsis,
encodes a similar protein sequence to papain-like proteases and is specifically expressed
during the onset of senescence in leaves (Lohman et al. 1994; Gan and Amasino 1995).
A third type of cysteine protease from B. napus is expressed at high levels in young green
8
leaves, decreases in mature leaves, and increases significantly in senescing tissues
(Buchanan-WOllaston and Ainsworth 1997). This gene is expressed in all developmental
stages in all plant organs and has a high homology to a drought-induced cysteine protease
in Arabidopsis (Koizumi et al. 1993).
Many cysteine proteases, active in both developmental and senescence stages of
plant organs, have been isolated and characterized in a variety of different species.
Protein degradation and remobilization during senescence involves a complex set of
proteases that differ in organelle location and level of expression. This regulation may be
so complex that it includes protease inhibitors that act to repress proteases until the
precise stage. Chloroplast proteases are extremely important in the remobilization of
stored nitrogen to other parts of the plant. The chloroplast is considered to be an
important storage organelle, as 70%-80% of the nitrogen in mature leaves is located here.
Roughly 90% of the nitrogen exported from senescing leaves comes from the
chloroplasts (Morita 1980). Nuclear expressed genes encoding chloroplast-targeted
proteases have been isolated (Mitsuhashi and Feller 1992) but senescence-specific
protease activity involved with the dismantling and transport of the photosynthetic
apparatus has yet to be characterized. A senescence-enhanced gene isolated from maize
appears to encode a protein similar to a vacuolar enzyme present in castor bean seeds,
which functions in the conversion of vacuolar proteins to their mature forms (Smart et al.
1995). This enzyme is up-regulated during senescence and may indicate that some
enzymes involved in senescence are expressed during leaf development and stored in the
vacuole where they await processing into a functional enzyme during the onset of
senescence.
9
The ubiquitin pathway for targeted protein degradation is important in the
elimination of abnormal cytosolic proteins and also the rapid turnover of short-lived
proteins (Buchanan-Wollaston and Ainsworth 1997). Proteins destined for degradation
are 'tagged' by ubiquitination in a series of ordered events and require ubiquitin
activating enzymes. These multi-ubiquitinated complexes are then recognized by ATP
dependent proteases which degrade the target proteins (Rechsteiner 1991). Although it
appears that most of the proteases in the ubiquitin pathway are not influenced by
senescence, an ubiquitin carrier protein gene has been identified showing enhanced
expression in senescing leaves of the potato (Garbarino et al. 1995). The SEN3 gene of
arabidopsis, a poly-ubiquitin encoding gene, is also upregulated in senescing leaves
induced by age-dependent, dark detachment, light detachment, and phytohormone
treatment methods (Park et al. 1998). This may indicate that the ubiquitin-dependent
degradation of proteins does occur during senescence, but probably directed toward
specific cytosolic proteins (Buchanan-Wollaston and Ainsworth 1997). It has also been
shown that proteins that promote leaf longevity are targeted for degradation during
senescence by ORE9, an pobox protein, which may form a complex with its substrate for
subsequent ubiquitin tagging (yVoo et al. 2001).
Although numerous research studies have been performed on isolating,
sequencing, and characterizing protease genes with increased expression during
senescence, little is known about the exact locations of the synthesis of protease proteins.
RNA levels measured during developmental stages in plant organs are crucial in
characterizing senescence-activated genes. This is seen with a Northern Blot of mRNA
transcripts throughout the plants life cycle and through later stages of necrosis. However,
10
the exact location of where protein degradation takes place and how the encoded proteins
function remain to be demonstrated.
Hormones Involved in the Regulation of Senescence
Many hormones are involved in growth, development, nutrient translocation and
eventual!y senescence. Al though senescence is a complex molecular and biochemical
process, it appears to be initiated by changes in localized hormone concentrations.
Numerous environmental switches have been observed to induce organ senescence
including, temperature, light, wounding, pathogen attack, drought, and inadequate
nutrients. Most of these factors occur with less frequency when compared with hormone
controlled age-dependent senescence. Information about the exact biochemical and
molecular effects of hormones is incomplete, but current research demonstrates that
hormones delay or interrupt senescence, accelerate senescence, or trigger it by a decline
in concentration, or location.
Hormones that accelerate senescence
Ethylene, abscisic acid (ABA), and jasmonic acid can induce senescence.
Ethylene is shown to increase senescence dramatically and coincides with the rapid phase
of chlorophyll degradation and increased respiration in dicots (Aharoni and Richmond
1978). Ethylene also plays a key role in the progression of senescence in some species.
Transgenic tomato containing an anti-sense gene leading to a reduction of
polygalacturonase mRNA, showed a delayed senescence period by one week through
11
inhibition of ethylene biosynthesis (Picton et al. 1993). An ethylene-insensitive mutant
of arabidopsis, compared with wild type, had a higher level of gene expression of
photosynthetic-associated genes, while the expression of senescence-activated genes was
delayed (Grbic and Bleecker 1995). The current proposal is that ethylene hastens the
progress of senescence by activating senescence-associated genes while repressing
photosynthesis-associated genes (Smart et al. 1995) thereby promoting membrane
breakdown, loss of chlorophyll, and positive feedback responses. These responses create
more ethylene that leads to a more rapid effect.
Ethylene induces the expression of genes, such as those encoding a lipase (Hong
et al. 2000) and a calmodulin-binding protein, (Yang and Poovaiah 2000) which are
identified as triggers of senescence. It has been demonstrated that protein
phosphorylation via protein kinase up-regulates ethylene production, ethylene
biosynthetic gene expression, and senescence acceleration in orchid flowers, while
serine/threonine protein phosphates reverse the processes (Wang et al. 2001). The
production of ethylene is primarily associated with cut flowers, fruits, and vegetables.
Flowers that exhibit ethylene induced expression show increased transcription of
aminocyclopropane carboxylate (ACe) and ACC oxidase genes, which encode enzymes
involved in ethylene biosynthesis. Most flowers that exhibit ethylene inducible gene
expression are dicots such as carnations, (Roberts et al. 1983) geranium, (Clark et al.
1997) and roses. Monocot flowers, such as anthuriums, iris, lily, and orchids, display
little sensitivity to ethylene. Anthurium flowers are sensitive to lowered levels of
cytokinins and daylily petals experience a rapid increase in abscisic acid content,
contributing to the initiation of senescence.
12
Abscisic Acid (ABA) accelerates senescence in a wide variety of species but is
less effective when applied to attached leaves, except at relatively high levels (50-100mg)
(El-Antably and Wareing 1967). The endogenous level of ABA increases in early stages
of senescence of detached tobacco leaves and declines rapidly later into the process
(Even-Chen and Atsmon 1978). The ethylene-insensitive daylily flower is very sensitive
to endogenous ABA application. ABA accelerates petal death and prematurely induces
many of the same biochemical changes that occur during natural senescence, such as loss
of differential membrane permeability, increase in lipid peroxidation, and increase in
activity of proteases and nucleases (Panavas et al. 1999). Much of ABAs role in
senescence is unknown. ABA in leaves increases when plants are exposed to stresses
such as drought, low temperature, and high salt concentrations.
The senescence-accelerating hormone jasmonic acid (JA), has been shown to
promote senescence when applied to excised oat leaves (Veda and Kato 1981). It
promotes senescence by decreasing the expression of nuclear and chloroplast genes
involved in photosynthesis (Creelman and Mullet 1997). Jasmonates appear to be
derived from fatty acid biosynthesis, (Vick 1983) primarily lipoxygenase generation. The
proteins stimulated by jasmonates degrade and transport vegetative storage proteins
(Anderson and Spilatro 1989) and lipids. Jasmonates increase in concentration during
wounding (Farmer and Ryan 1990), fungal, and bacterial pathogenic attacks (Anderson
and Spilatro 1989). Although these reports suggest jasmonic acid is only involved with
senescence, JA is also found in high levels in zones of cell division, young leaves, and
reproductive structures (Creelman and Mullet 1997). One hypothesis is that JA works by
decreasing or inhibiting the expression of photosynthetic genes. This is important in
13
vascular areas of the plant where the photosynthetic apparatus is not needed, and during
senescence where photosynthetic nuclear and chloroplast genes are down-regulated. JA
may also be induced by the energy quenching mechanisms of the chloroplasts to down
regulate chlorophyll genes. In effect, the down-regulation of chlorophyll decreases the
excess energy absorbed and prevents further photochemical damage (Creelman and
Mullet 1997).
Genes involved with JA biosynthesis include the plastid-derived lipoxygenase:
LOX2, LOX3, LOX4, and !be cytoplasmic LOX]. LOX2 plays a role in wounding and
defense related senescence (Creelman and Mullet 1997) but is unlikely to be related to JA
biosynthesis during senescence because its expression is turned off at the onset of leaf
senescence (He et at. 2002). In contrast, LOX] is strongly activated during leaf
senescence and is likely responsible for the increased JA production in senescing leaves
(He et at. 2002). There appears to be a strong evidence to support a role for JA in
senescence. An exogenous application of JA induces leaf senescence and causes an
increase in endogenous JA levels of senescing tissues to nearly 500% of those found in a
non-senescing counterpart. It is also important to note that the JA biosynthetic pathway
in senescing leaves is mediated by genes other than !bose involved in the wounding and
defense-related JA biosynthetic pathways involving chloroplast-targeted enzymes.
Hormones that decrease or delay senescence
Cytokinins, and to some extent gibberellins and auxins are able to retard
senescence. This section will detail the role of these hormones in senescence. Little is
14
known about the role of gibberellins in the plant life cycle. Gibberellins are involved in a
wide range of functions that vary among species. In one case, the application of
gibberellins to leaves strongly inhibited senescence where cytokinins had little effect
(Fletcher and Osbourn 1966). In other species both seem to work effectively and show
that senescence is coupled with a decrease in gibberellin concentration at the site.
Gibberellins cause an increased of gene expression in stem elongation (Chory and Voytas
1987) and remobilization of nutrients during seed germination (Baulcombe and BlIffard
1983). However, the effect of gibberellins on senescence-related gene expression has yet
to be determined.
Auxins are another class of hormones that have various functions in diverse
species. Although some reports indicate that they may delay senescence, there are
numerous cases in which high concentrations of auxins are needed to retard senescence.
Studies suggest auxins are not very powerful in suppressing senescence and high
concentrations have to be used in comparison with cytokinins (Smart 1994). One
complication is that auxins stimulate the production of ethylene when the concentration is
only slightly above the physiological level (Thimann 1980). The production of ethylene
accelerates senescence producing the opposite reaction desired. Auxin research shows a
wide range of results in various species; therefore, it is extremely difficult to form
universal generalizations about the role of auxins in the inhibition of senescence.
Specific roles ofcytokinins in plant development
Cytokinins are very important in the healthy development and growth of young
and mature plant organs. Cytokinins have been shown to prevent the natural senescence
15
of leaves or in some cases promote the re-greening of leaves (Van Staden 1988). During
the senescence of a leaf, the tissue has no ability to generate cytokinins whereas young
leaves have the ability to synthesize and accumulate cytokinins. Without the source of
cytokinins, a leaf will begin to go through its natural senescence program and recycle its
nutrients to supplement the generation of healthy and developing plant organs.
Therefore, it has been concluded that if the proper level of cytokinins are made available
to a senescing leaf, its senescence program will be interrupted indefinitely or delayed
through a number of molecular and metabolic processes (Gan and Amasino 1995).
Current research has shown that exogenous cytokinin application to senescing leaves
delays chlorophyll breakdown, stimulates protein and mRNA synthesis, and stimulates
chlorophyll synthesis. Cytokinins prevent the transient increase in respiratory rate seen in
senescence (Tetley and Thimann 1974).
Cytokinins seem to operate at both the transcriptional and post-translational level.
The presence of cytokinins inhibit the expression of senescence-related genes (Teramoto
et al. 1995; Buchanan-Wollaston and Ainsworth 1997) and contribute to the activation of
developmental genes (Flores and Tobin 1988; Chen et al. 1993). Cytokinin modulates
genes and proteins by a variety of unknown signaling mechanisms. One postulated
cytokinin signal transduction mechanism could be mediated by a histidine kinase
analogous to two of the component regulators (Kakimoto 1996). It can also be elucidated
that cytokinin regulates protein kinases/phosphatases which contribute to altering
transcription factors, nucleic acid binding proteins, and mature proteins.
The tissue and organ-specific overproduction of cytokinins produced a number of
morphological and physiological changes, including stunting, loss of apical dominance,
16
and reduction in root initiation and growth. Abnormal cytokinin concentrations can
accelerate or prolong senescence in leaves depending on the growth conditions, initiate
adventitious shoot formation from unwounded leaf veins and petioles, alter nutrient
distribution and abnormal tissue development in stems (Li et al. 1992). While some of
these morphological changes result directly from the localized overproduction of
cytokinins, other changes probably result from the mobilization of plant nutrients to
tissues rich in cytokinins. Therefore a system that reduces senescence using cytokinin
concentrations must be engineered to regulate an effective concentration of cytokinin to a
specific location. This method of regulation is crucial in the development of a senescence
inhibition system.
Anthurium Molecular Physiology
Anthurium andraeanum, is one of the Hawaiian islands' principal ornamental
exports to the U.S. mainland, Canada, Japan, Italy, Germany and many other countries.
The anthurium belongs to the family Araceae, a family chiefly of tropical plants, and is a
perennial herbaceous plant usually cultivated for its attractive, long-lasting flowers
(Higaki et al. 1979). The anthurium plant consists of many different species which all
produce a flower that is a complex of a modified leaf (spathe) and hundreds of tiny
flowers on the pencil-like protrusion (spadix) rising from the base of the spathe. The
anthurium plant produces flowers that emerge from each new leaf axil, and follow a
sequence of leaf-flower-Ieaf year-round throughout the entire life of the plant. Intervals
between leaf emergences are shortened or lengthened depending on environmental
conditions and usually grow more vigorously in the summer months (Higaki et al. 1979).17
The anthurium flower is usually harvested when three-quarters mature and the cut flower
will last from 7-10 days.
Anthurium senescence biochemistry
To establish a connection between physiological changes during senescence of
anthurium flowers and a molecular explanation, data concerning physiological attributes
of anthurium flowers (paull et al. 1985) was analyzed and correlated with known
molecular data on senescence. The first indication of senescence in anthurium flowers is
marked by a 250% increase in respiration 8-12 days after harvest preceded by the first
noticeable bluing of the spathe (Paull et al. 1985). A respiration increase during
senescence is a molecular flag that identifies the transition from photosynthetic energy
production, to sugar respiration involving the mitochondria that is functional until late
senescence. Enzymes produced in early senescence include two key enzymes, isocitrate
lyase and malate synthase, involved in the glyoxylic acid cycle. These enzymes drive
sugar respiration to enable several processes of senescence, including nutrient
remobilization (Gut and Matile 1988). This respiration increase is paralleled with a
decrease in photosynthetic enzyme production including ribulose bisphosphate
carboxylase (RUBISCO) and components of the light harvesting complex (Grover 1993).
Basic preparations involved in chloroplast breakdown. A gradual decrease in total sugars
and starch is observed during the period when respiration in the senescing anthurium
flower plateaus confirming the use of anabolic substrates in the respiration process (Paull
et al. 1985).
18
A dramatic increase of ammonium ions in senescing flowers is observed which is
paralleled with spathe bluing (Paull et al. 1985). This is because the ammonium ion is a
key ion in the isoenzyme of glutamate dehydrogenase, involved in packaging nitrogen for
transport (Lauriere and Daussant 1983). The senescing flower also shows a small
increase in alpha amino acids and proteins (Paull et al. 1985). This increase is consistent
with increased levels of amides glutamine and asparagine, which are products of protein
degradation and major organic forms of nitrogen able to be translocated in plants
(Simpson and Dalling 1981).
All physiological and biochemical changes described in senescing anthurium
flowers are consistent with known changes in the molecular physiology of senescing
plants. The ammonium ion increase is believed to react by copigmentation with
anthocyanins in senescing anthurium flowers, resulting in an increase in phenols and a
visible bluing of the spathe (Paull et aI. 1985). The blue color can also be attributed to an
increase in pH caused by the activation of proteases involved in the remobilization of
nutrients during senescence. These changes occur first in the spadix and are seen by the
early browning. Finally, flower bluing can be related to peak respiration, ammonium ion
concentration, pH elevation, and nitrogen remobilization marking the senescence of the
anthurium flower, which occurs prior to the final increase in respiration as the flower
begins to senesce rapidly (Paull et al. 1985).
Another important aspect involving anthurium flower production is the
mechanism by which the flowers are produced. Anthurium flowers and leaves are born
at a 1:1 ratio. The newly emerged immature leaf develops a negative net photosynthetic
19
rate, depriving the young flower bud nutrients for its cell division and growth phase.
Removal of the new immature leaf 7 days after emergence results in delayed senescence
of mature leaves, increased flower production, a larger flower, and an advanced rate of
flower emergence (Dai and Paull 1990). It is predicted that if this practice could be
followed in collaboration with the engineered auto-regulatory senescence inhibition
system, that the anthurium plant could be a more hearty producer of flowers. This
created by the longer lasting photosynthetically productive mature leaves supporting the
plant with energy without the immediate need for fresh leaves. This allows them to be
excised to allow for faster flower production increasing the economic value of each
individual plant. Whether or not this remains a viable option remains to be seen.
Anthurium flower senescence control
Many attempts have been made to preserve the cut anthurium flowers life beyond
the natural senescence period. These methods include temperature and fertilizer
variations during a yearly growing season (Akamine and Goo 1975). Post-harvest
treatments include pulsing stems with silver nitrate (Paull and Goo 1982), benzyl
adenine (BA-cytokinin) drip treatments (Paull and Chantrachit 2001), commercial
floral preservatives, sodium benzoate, glucose, sodium hypochlorite, and carbonated
water (Akamine and Goo 1975). After many trials, the best method for floral
preservation of cut anthurium, involves a benzyladenine drip treatment after cutting,
and a silver nitrate pulsing after shipping of the flowers. In most cases, BA drip
treatments increase flower life significantly (42%-142%) although, in one cultivar
senescence is increased (Paull and Chantrachit 2001). It is concluded that an
20
application of exogenous cytokinin (BA dip treatment), delays the onset of molecular
senescence in cut flowers, and silver nitrate pulsing, increases flower life by inhibiting
bacterial growth that leads to blocking of the stem.
Through the analysis of anthurium flower senescence, it is reasonable to deduce
that the flower functions much like other species during senescence and may have an
advantage over other ornamentals because of having a flower comprised of a modified
leaf. This includes a non-ethylene controlled flower and molecular senescent responses
similar to that of a leaf. Engineering a molecular system into anthuriums that delays
senescence by synthesizing endogenous cytokinin makes sense. Data showing delayed
senescence due to exposure with cytokinins suggest that the main method of flower
preservation is to interrupt the senescence cycle with a steady flow of regulated cytokinin
production. This type of system may decrease the time between each new flower,
maintain flower color, luster, and spadix life, or interrupt senescence of cut flowers
indefinitely, but has to be examined for its impact on all developmental phases.
Autoregulatory Senescence-Inhibition System
The discovery and identification of senescence enhanced genes and promoters
enable us to chart the progression of senescence and manipulate its interruption using
cytokinins. The construct of this auto-regulatory system consists of the senescence-
regulated SAG12 cysteine protease promoter, which is upregulated during age-dependent
senescence, transcribing the ipt gene to creating the IPT enzyme. This enzyme is the rate-
limiting factor of the cytokinin biosynthesis pathway and when available results in an21
increase of cytokinins to the senescing tissue. This construct is crucial in providing
precise amounts of cytokinin to senescing tissues to keep them healthy without exceeding
normal cytokinin levels that result in altered morphology as seen in overproduction
reports. This system is defined as autoregulatory because as the cytokinin levels in the
leaf decline, genes are switched on to initiate senescence. The PSAG12-ipt construct is now
a member of the senescence regulated genes, and is also transcribed providing the leaf
with the slow production of cytokinin that will interrupt the senescence program once it
reaches a threshold level. Cytokinin production will never reach abnormal levels since as
the threshold level is reached, senescence related genes are switched off including the
PSAG12-ipt construct. This construct will cycle in this fashion to interrupt senescence
indefinitely and the leaves will exhibit a prolonged, photosynthetically active life-span.
The system has been tested in only a few plant species. To date, the effect of ipt
expression in transgenic plants has been assessed mainly in a limited number of
solanaceous species (Gan and Amasino 1995; Jordi et al. 2000). However, there are brief
reports of the introduction of PSAG12-ipt into rice, (Fu et al. 1998) cauliflower, (Nguyen et
al. 1998) and lettuce (McCabe et al. 1998). Its introduction into tobacco resulted in more
green leaves, no sign of senescence, a two fold increase in flower and seed production
and an increase in biomass for PSAG12-ipt plants versus wild type (Gan and Amasino
1995). When introduced into lettuce, it seemed to be regulated by a positive instead of
negative feedback loop in the panicles during bolting (McCabe et al. 2001). An
interaction between high concentrations of hexoses and cytokinins in these tissues may
have repressed photosynthesis and stimulated senescence. Although this displays a
negative impact of the system on specialized tissues, the leaves of the lettuce stayed
22
green for an increased period of time post-harvest, and also allowed growers to reduce
nitrogen fertilization applied to the plant prior to harvest.
When studying the impact of delayed leaf senescence on the functioning of plants
growing under conditions of nitrogen remobilization, potential consequences of modified
sink-source relations may affect plant productivity and the efficiency of light and mineral
utilization. Expression of ipt in older leaves causes maintenance of chlorophyll content
and PPFD absorption but is less effective in delaying other aspects of senescence such as
loss of soluble protein, and still less effective in maintaining RUBISCO and net
photosynthetic energy levels (Jordi et al. 2000). Younger developing leaves in the IPT
system showed lower contents of chlorophyll, Rubisco, and protein than those leaves in
corresponding wild type plants. This is caused by the inhibition of remobilization of
nutrients from older leaves to younger leaves and may seriously limit potential increases
in biomass of these plants under limited Nitrogen nutrition (Jordi et al. 2000). It is
apparent, that at some capacity, nutrients are exported from older to younger leaves prior
to Pr-SAG12 initiation, or that remobilization is not completely inhibited by the auto
regulatory senescence inhibition system.
Many genes are classified as senescence-associated depending only on the
increase in abundance of transcript levels during the onset and throughout senescence. A
few SAGs are characterized thorough expression analysis as being senescence
upregulated. The expression of such genes is absent during germination, early
development and maturity but show a distinct increase at during some point during the
senescence phase. SAG12 is a cysteine protease with an expression pattern that comes
the closest to having the specificity for natural senescence. It is undetectable in younger
23
leaves and is not induced by any senescence-inducing treatment that does not cause
visible yellowing to the leaves (Weaver et al. 1998). This makes SAG12 the best
molecular marker of senescence to date and suggests a specific role for senescence-
specific cysteine proteases. The successful implementation of the SAG12 promoter in
Table 1: Cysteine protease genes that are characterized as being senescence up-regulated.
Gene nameGenbank
PlantCommon
ReferenceAccession name
SAG12 U37336Arabidopsis
Arabidopsis Lohman el. al., 1994Ihaliana
SAG12-1 AF089848 Brassica napus Rape Noh and Amasino, 1999
See1 X99936 Zeas mays Corn Griffiths el. al.,1997
See1 AJ249847Lolium
Ryegrass Li el.al., 2000mulliflorum
NTH1 U44947 Pisum sativum Garden PeaKardailsky and Brewin,1996
Tpp X66061 Pisum sativum Garden Pea Granell el. 01. 1992
NTCP-23 AB032168Nicotiana
Tobacco Ueda el.al., 2000tabacum
SENU3 Z48736Lycopersicon
Tomato Drake el.al.,1996esculentum
SmCP AF082181Solanum Eggplant
Xu and Chye, 1999melongena (Brinjal)
SPG31 AF242185 Ipomoea balalas Sweet Potato Chen et.al., 2002
SEN102 X74406 Hermocallis sp. Daylily Valpuesta et.al., 1995
BoCPS AF4S4960Brassica
Broccoli Coupe et.al. (unpublished)oleracea
ALSCYP1 AAK6312SAistroemeria
N/AWagstaff et.al.,
hybrid (Samora) (unpublished)
PRT5 AF133839Sandersonia Chinese-
Eason, (unpublished)aurantiaca lantern Iil y
the autoregulatory senescence inhibition system has lead to the pursuit of orthologous
SAG12 type cysteine proteases from a number of other species. Table 1 shows cysteine
proteases from a variety of plants that have been characterized as senescence-upregulated
through a combination of molecular techniques. Regulating cytokinin biosynthesis under
24
the control of a native promoter dedicated to expression under natural senescence is the
most preferable from an engineering standpoint. This type of promoter is less likely to be
induced by stresses, environmental pressures, and the intricacies of development thereby
establishing a system that will work as desired without adverse affects.
There is promise for this system to work in the anthurium species because the
flower is actually a modified leaf and should react as a leaf would respond when involved
with the auto-regulatory system. It must be considered that the plant is reliant on the
production of new flowers and leaves to be commercially productive and that this system
may limit the production of quality flowers, especially under nutrient deprived
conditions. However, with the proper nutrients and pruning techniques, the system may
perform better than the results seen in tobacco.
25
CHAPTER II
SIGNIFIGANCE OF RESEARCH
Senescence is relatively slow and ordered, maximizes reallocation of nutrients
and metabolites, and always has the potential to be reversible until the later stages.
Programmed Cell Death (PCD), commonly termed apoptosis or hypersensitive response,
is relatively rapid and usually reserved for responses to pathogen attack or developmental
disposal of unwanted cells. These two terms are not interchangeable, however may share
common pathways and gene expression. PCD is essential for normal reproductive and
vegetative development, such as floral development, seed maturation, tracheary element
formation, trichrome development, and root development. PCD also involves responses
to pathogenic attack, protecting the plant against systemic infection by minimizing the
pathogens opportunity to gain a foothold. Senescence on the other hand is an extremely
coordinated process that progresses in metabolically active cells.
Senescence is initiated by an environmental or developmental initiator, which
induces a hormonal response and/or signal transduction events. This coordinates gene
activation or inactivation that occurs on the transcriptional, translational, and post
translational level. Signal transduction also includes protein modification, mobilization,
activation or inactivation. These events create a positive feedback loop, increasing the
efficiency of the senescence process, by expressing genes encoding proteins involved
with DNA and RNA binding, receptors, kinases, phosphatases, growth regulator
synthesis, and metabolite/nutrient mobilization.
26
Subsequent physiological events after the onset of senescence-associated gene
expression include a chlorophyll degradation pathway, accompanied by the unmasking or
accumulation of carotenoids and other pigments. This process can be quantified to
observe the progression of senescence through chlorophyll concentration of leaf tissue.
Proteins are broken down, and the mobilized organic nitrogen and organic sulfur are
exported from senescing leaves. Catabolism of nucleic acids releases inorganic
phosphate. Magnesium ions are captured, chelated, and mobilized as well leaving
chlorophyll inactive. Photosynthesis declines, and peroxisomes are re-differentiated into
g1yoxysomes, which convert lipids to sugars. Metabolic regulation during senescence
involves responses to cellular REDOX conditions, compartmentalization, and enzyme
specificity involving degradation. Where the great energy producing and preserving
Calvin cycle of photosynthesis once predominated, gluconeogenesis spurred into action
by senescence, now converts intermediates into sucrose through glycolysis.
Senescence involves plant molecular, physiological, and developmental aspects
that can be examined through modern techniques. This process gives us one of the best
tools to examine the complex structure of the plant cell, through its organized degradation
and remobilization. Biochemistry, enzymology, proteomics, genomics, signal
transduction, photosynthesis, gene expression, REDOX regulation, vacuolar
compartmentalization and differentiation, and growth regulators can all be successfully
studied during the slow moving senescence program. The results of this research will
expand our knowledge of cellular biology paving the way for impacting successful
changes to harness the power of the plant cell. Every piece of evidence we gather when
studying senescence, especially in unique species, is an important contribution, not only
27
to our scientific understanding of plant systems, but also in increasing the quality of
genetic manipulations resulting in better agricultural performance.
The Senescence-Activated Signaling Pathway That Activates the Dicot
Promoter, SAG12, May Be Evolutionarily Conserved In Anthurium
Senescence involves a highly regulated, co-coordinated series of events
accompanied by repression and up-regulation of gene expression. Senescence-enhanced
genes encode degradative enzymes that include proteases, ribonucleases, lipases and
nucleases. Senescence-repressed genes include those that encode the photosynthetic
apparatus. Senescence can also be characterized by phenotypic changes in plant organs
including chlorophyll loss and changes in pigmentation eventually leading to necrosis.
Protein activation, modification, degradation, and mobilization are all actively changing
events during senescence. A receptor-like protein kinase induced during senescence
may have a regulatory function of some senescence pathways (Hajouj et al. 2000).
Proteins that promote leaf longevity are targeted for degradation during senescence by
ORE9, an F-box protein, which may form a complex with its substrate for subsequent
ubiquitin tagging (Woo et al. 2001). Both external and internal stimuli can trigger
changes in plant hormone concentrations thereby initiating signaling mechanisms that
modify gene expression at transcriptional and translational levels, as well as post
translationally by modifying proteins.
Modification of gene expression involves promoters that serve as switches,
turning genes on and off in response to signals. Senescence-associated promoters are
28
comprised of conserved cis-acting elements and enhancer regions (Noh and Amasino
1999a) necessary for senescence-specific expression. DNA gel-shift mobility assays
show these regions form different mobility complexes with DNA-binding proteins in
young versus senescent leaves. The research suggests that a transcriptional repressor or
inactive form of a transcriptional activator is present in the healthy state, while during
senescence a new transcriptional activator is produced or the repressor/inactive
transcriptional factor is modified to an active form (Noh and Amasino 1999a).
Research involving senescence mechanisms in arabidopsis has shown a complex
series of events involving gene and protein modification in an effort to recycle nutrients
for mobilization to healthy portions of the plant. This process is thought to be conserved
throughout all higher plant species, but a question still remains: Are the molecular
signaling pathways, transcriptions factors, and promoters interchangeable in evolutionary
divergent species? The successful senescence induced expression of the arabidopsis
senescence-activated promoter in anthurium suggests that cis-acting and enhancer regions
of Pr-sag12 interact with transcriptional factors present in anthurium making an expression
system using a senescence-enhanced promoter from arabidopsis a viable option in
anthurium. This also suggests that anthurium has senescence-activated promoters and
associated transcription factors that are homologous to arabidopsis and identification and
characterization would prove to be highly useful for biotechnology.
29
Expression and Proper Post-Translational Modification of GFP in
Anthurium, Can Provide A Necessary Reporter Gene Tool For
Anthurium Molecular Studies.
Reporter genes are an important tool in evaluating promoter expreSSIOn,
successful transformations, and mutation analysis. They can be used in both stable
transformation and transient expression analyses. In order to determine that Pr-SAG12 is
regulated in anthurium, there must be a reliable reporter system. Important criteria of a
reporter system includes !be successful production of the protein in the host, quantifiable
expression, and non-invasive analysis. The protein must not be confused with
background proteins native to the host. Several reporter genes are available and
examples include uidA (encoding ~-glucuronidase 'GUS'), luc (encoding Luciferase), gal
(encoding ~-galactosidase), and gfp (encoding green florescent protein). Most reporter
genes encode an enzyme that is foreign to the host that can catalyze a reaction when in
the presence of the correct substrate. However, for quantification analysis, the plant tissue
must be destroyed by homogenation and/or exposure with an infiltration buffer. One
unique protein, gfp, encodes a functional protein that can be visualized through excitation
with a non-invasive wavelength of light. The gfp protein emits a different wavelength of
light that is easily quantifiable in living cells (Schenk et aJ. 1998).
In order to conduct molecular studies in anthurium, it is necessary to identify a
reporter system that is effective, and provides for non-invasive analysis. Anthurium
tissues contain heavy amounts of phenolic and polysaccharide compounds !bat inhibit
pure extraction and analysis of cellular proteins. Previous research shows that the uidA
30
or "gus" gene is effectively expressed in stably transformed anthurium tissues, but has
improper post-translational modification and folding, making the reporter enzyme non
functional on the GUS substrate (Kuehnle and Chen 1994). Our research also shows that
the GUS system is not an effective reporter system for transient bombardment expression
analysis in anthurium (Hayden and Christopher, unpublished).
Chapter 3 will focus on determining the transient expression of Pr-SAG12 during different
stages of development using GFP as a reporter gene. This work will identify the gfp4 and
gfp5-ER genes as useful reporter systems for further research on promoter assays, tissue
regulated expression and protein targeting studies in anthurium.
A Senescence-Regulated Cysteine Protease Gene, Orthologous to sag12,
Exists In Anthurium
Chapter 4 will focus on the identification and characterization of cysteine protease
genes in anthurium. Two cysteine proteases anth16 and anth17 will be studied in detail
ultimately determining the role of each gene as it applies to development. Understanding
gene regulation during senescence begins with isolating and characterizing senescence
associated genes. These genes give us insight into the complex molecular process
involved during senescence. The factors regulating leaf senescence are complex and
involve both external and internal stimuli, such as darkness, pathogens, developmental
signals and hormones. These factors initiate signal transduction pathways that repress
photosynthesis gene expression and activate the expression of genes involved in cellular
disassembly, recycling and integral defense-related processes (Quirino et al. 2000). The
genes for mRNAs that increase markedly in abundance during senescence have been
31
designated as "senescence-associated genes" or SAGs (Lohman et a!., 1994) and encode
chitinases, cysteine proteases, lipases, aspartic proteases, and metalloproteases from
plants such as rape seed (Hanfrey et a!., 1996), rice (Lee et a!., 2001), cucumber
(Delorme et a!., 2000); carnation (Hong et a!., 2000), tomato (Davies and Grierson, 1989;
John et aI., 1997), parsley (Lers et aI., 1998), arabidopsis (Gan and Amasino, 1995;
Lohman et aI., 1994; Yoshida et al., 2001), daylily (Valpuesta et a!., 1995), ryegrass (Li
et aI., 2000), sweet potato Huang et al. 2001), and eggplant (Xu and Chye, 1999) and
enzymes involved in phosphonate biosynthesis in carnation (Wang et aI., 1993).
Cysteine protease genes expressed during senescence are of particular interest since they
fall under class 5 SAG expression. This stage indicates expression at the extreme
initiation of senescence that is sustained throughout the later stages. There also exists
many isoforms of cysteine proteases with different expression patterns suggesting unique
and specific roles in the developmental cycle.
One benefit that aids in the identification of these genes is the extent of homology
contained in specific regions representing enzymatic functionality. This enables the
creation of degenerate primer sequences that can produce the successful cloning of small
portions of DNA from cysteine protease cDNAs synthesized from unique developmental
mRNA populations. Once a native anthurium fragment is isolated, it can serve as a
useful tool to identify full-length cDNAs from libraries or mRNA populations. After the
full-length cDNA sequence is verified, many tools are available for full identification.
The deduced amino acid sequence allows the comparison of the anthurium cysteine
proteases to other homologous proteases, whose sequences are available in online
databases. Careful analysis of differences in deduced amino acid composition can help
32
predict unique features of the proteins. These include: secondary and tertiary structure
prediction, signaling peptides to determine cellular location, peptide cleavage sites to
predict mature protein length, and common features that characterize enzymes such as
active domains and critical bonding locations.
Characterization of two full-length anthurium cysteine protease clones by
Northern Blot analysis of developmental RNA populations indicates differential
expression patterns confirming senescence-associated gene expression. Developmental
populations include: YG (immature); MG (Mature Green); and Sl, S2, S3 (Senescent
leaves, progression characterized by chlorophyll content). Once the anthurium SAG is
identified it can be used in correlation with the non-senescence associated anthurium
cysteine protease gene, photosynthetic genes (cab and psbA), and a constitutively
expressed recycling gene (ubi), to determine expression under senescence controlling
conditions.
The Effect of Cytokinin and Sucrose on SAG Expression During
Senescence
A comparison of expression patterns in response to stress and hormone
treatments using Northern blot analysis, is an excellent indicator for characterizing
senescence-associated genes (Weaver et al. 2001). Certain stresses and hormones are
able to hasten or repress senescence as seen visually by leaf yellowing and detected on
the molecular level by responses in gene expression. Cytokinin is a well-known
senescence-delaying phytohormone (Gan and Amasino 1997; Nooden et al. 1997).
33
Exogenous treatments of the synthetic cytokinin benzyladenine (SA) show a repression
of senescence characteristics when applied on anthurium leaves and flowers (paull and
Chantrachit 2001). Cytokinins can be used to repress many SAG transcripts, and
occassionally reverse the senescence of a leaf in the later stages. Considering sugars are
the main product of photosynthesis, certain sugars can serve as signaling molecules,
changing sugar levels during photosynthetic decline may act as a senescing-inducing
signal (Jang et al. 1997). Sucrose can effectively repress the accumulation of certain SAG
transcripts when applied to detached leaves (Weaver et al. 1998).
Although these treatments are somewhat effective in reversing the effects of
senescence and SAG transcripts, inducing senescence in leaves can result in a different
pattern of SAG transcripts from the observed expression during developmentally-induced
senescence. The most common techniques of inducing senescence include detachment
and incubation of leaves in water under dark and light conditions, desiccation, and
hormone treatments with ABA and ethylene. Certain SAG transcripts may not respond to
this type of induced senescence even though the visual indicator (chlorophyll loss) of
senescence progresses rapidly (Noh and Amasino 1999a).
Senescence is a complex process in which SAG genes encode unique transcripts
having specific functions. Each of the techniques listed above can give insightful clues in
characterizing a SAG gene in relationship to the many already isolated and characterized.
It is necessary to include the proper controls to identify the SAG expression pattern of
isolated clones, and understand that only the combination of mUltiple treatments in
comparison to developmental populations will give a firm conclusion. This will provide
valid data in the pursuit of identifying a native senescence-upregulated promoter, to
34
better the auto-regulatory senescence inhibition system, for future applications in
engineering the Anthurium species for increased production and improved post-harvest
floral vase life.
35
CHAPTER III
REGULATION OF THE SAG12 PROMOTER INANTHURIUM USING TRANSIENT BIOLISTIC
PARTICLE BOMBARDMENT
Introduction
Modification of gene expression involves promoters that serve as switches,
turning genes on and off in response to signals. Both external and internal stimuli can
trigger changes in plant hormone concentrations thereby initiating signaling mechanisms
that modify gene expression at transcriptional and translational levels, as well as post-
translationally by modifying proteins. Senescence-associated promoters are comprised of
conserved cis-acting elements and enhancer regions (Noh and Amasino 1999b) necessary
for senescence-specific expression. It is proposed that a transcriptional repressor or
inactive form of a transcriptional activator is present in the healthy state, while during
senescence a new transcriptional activator is produced or the repressor/inactive
transcriptional factor is modified to an active form. DNA gel-shift mobility assays show
that regions of the Pr-SAG12 form different mobility complexes with DNA-binding
proteins in young versus senescent leaves. Two orthologs of SAG12 isolated from
Brassica napus show sequence similarities to SAG12 and expression analysis consistent
with that of SAG genes. When the promoters of the three genes are compared, two
distinct regions show over 75% identity with one another. The regions from the Brassica
genes also bound to arabidopsis DNA-binding proteins as shown in a gel-shift assay
using extracts from senescent arabidopsis leaves (Noh and Amasino 1999b). This
36
suggests these two regions are necessary for the senescence-specific regulation of these
particular SAG genes. Another study compares the upstream region of a SAG gene from
sweet potato. It was concluded that the promoter did not include any regions similar to
those in sag12 however it did include putative ethylene-responsive elements.
Research involving senescence mechanisms in arabidopsis has shown a complex
series of events involving gene and protein modification in an effort to recycle nutrients
for mobilization to healthy portions of the plant. The successful senescence induced
expression of the arabidopsis senescence-activated promoter in anthurium would suggest
that cis-acting and enhancer regions of Pr-SAG12 interact with transcriptional factors
present in anthurium making a expression system using a senescence-enhanced promoter
from arabidopsis a viable option in anthurium. This would also suggest anthuriurn has
senescence-activated promoters and associated transcription factors that are homologous
to arabidopsis and identification and characterization would prove to be highly useful for
biotechnology.
Understanding the regulation of a foreign promoter in a host of interest is
necessary to confirming the efficacy of a gene manipulation system prior to stable
transformation. In this case, Pr-SAG12 is evaluated by regulating the expression of a
reporter gene, when introduced via particle bombardment in anthurium leaf tissues.
Reporter genes are an important tool in evaluating promoter expression, successful
transformations, and mutation analysis. They can be used in both stable transformation
and transient expression analyses. The important criteria of a reporter protein include
successful production in the host, quantifiable expression, and non-invasive analysis.
The protein must not be confused with background proteins native to the host. Several
37
reporter genes are available and examples include uidA (encoding ~-glucuronidase
'GUS'), luc (encoding Luciferase), gal (encoding ~-galactosidase), and gfp (encoding
green florescent protein). Most reporter genes encode an enzyme that is foreign to the
host that can catalyze a reaction when in the presence of the correct substrate. However,
for quantifiable analysis, the plant tissue must be destroyed by homogenation and/or
exposed to an infiltration buffer. The unique reporter, GFP, encodes a protein that can be
visualized through excitation with a non-invasive wavelength of light. The GFP protein
emits a different wavelength of light that is easily quantifiable in living cells (Schenk et
al. 1998).
In order to conduct molecular studies in anthurium it is necessary to identify a
reporter protein system that is successfully produced and also provides for non-invasive
analysis. Anthurium tissues contain heavy amounts of phenolic and polysaccharide
compounds that inhibit pure extraction and analysis of cellular proteins. This physiology
can also interfere with substrate/enzyme interaction that is necessary in most reporter
systems. This chapter will focus on the transient regulation of Pr-SAGl2 in anthurium and
also include data verifying the successful implementation of the GFP reporter system in
anthurium tissues.
Materials and Methods
To determine whether the senescence-associated promoter, Pr-SAG12 (from the
dicot Arabidopsis thaliana) is up-regulated by senescence in Anthurium tissues, a
transient expression assay was conducted using the reporter genes of either uidA or gfp
38
depending on the plasmid vector introduced to the plant tissue. The following controls
include: a) uncoated beads to determine the effects of particle bombardment wounding
for a negative control, b) reporter gene expression with a constitutive promoter for a
positive control, c) Pr-SAG12 expression in tissues of all developmental stages, d) reporter
gene without a promoter for a negative control.
Construction ofPr-SAG12 reporter vectors
The first plasmid used to test for senescence-upregulated promoter expression was
PSAG1Z-gUS, containing, a promoter isolated from a cysteine protease and a gus reporter
gene. The plasmid PSAG12-gUS (provided by Rick Amasino, University of Wisconsin),
was used to transform XU-blue Ecoli cells by the standard heat shock method (Sambrook
et al. 1989). After an overnight incubation at 37QC, the plasmid was isolated using a midi
prep plasmid isolation kit (Qiagen, Valencia, CA). The control plasmids, p35S-gfp4,
p35S-gfp5-ER (Jim Hasselhoff, University of Cambridge, UK) and pBI221 (Clontech,
Palo Alto, CA) were obtained through the UH College of Tropical Agriculture and
contain the constitutive 35S CAMV promoter that drives the expression of either the
green fluorescent protein (p35S-gfp) or the beta-glucuronidase enzyme (pBI426). A new
plasmid, PSAG1z-gfp4, was constructed from p35S-gfp4 (Fig. 3.4) and Pr-SAG12 from
pSG516 (Fig. 3.3) were excised and subcloned into pBLUESCRIPT KS II (Sambrook et
at 1989) to create PSAG1z-gfp4 (Fig. 3.1). Restriction enzyme cloning sites were available
in both original vectors so a unique subcloning scheme was established as follows: a)
gfp4-nos was excised from 35S-gfp4 and cloned into pBSII KS; b) Pr-SAG12 was excised
from PSAG12-GUS; c) sag12-nos was cloned into pBSIIKS-GFP4. This formed PSAG12-
39
gfp4 (Fig. 3.1). Scale-up and isolation of all plasmids were performed using identical
methods as previously described for PSAG12-guS. Plasmids were concentrated or diluted to
give a solution of I J.lg/J.lI for biolistic bombardment procedures. Plasmid PSAG12-ipt in a
binary vector (Fig. 3.2) was also provided by Richard Amasino for future experiments
with stable transformation
pSaa12-GFP46.2kb r"'"
11."",111.•0/1>,.,1$o,rlf'~IU
pSagl2-IPT(in binary vector)
17.60kb
Figure 3.1: psag12-GFP4 in pBLUESCRIPT II KS. Figure 3.2: PsagI2-IPT in a binary vector
pSaal2-IPTpSG5165.88 Kb
pBIN 3S8-mGFP4
E<GIf.I
'11/...,"Sp</01"_
_ HIJ:fMIE<GIf.I
Figure 3.3: psaglz-IPT in pUC18 termed pSG516 Figure 3.4: pBIN 35S-mGFP4.
40
Particle bombardment ofAnthurium leaves.
Tissue cultured leaves from anthurium varieties Marian Seefurth and Southern
Blush were excised halfway down the petiole and incubated immediately on sterile
deionized H20 for 5 minutes. The leaves were then placed on agar plates, with the
petiole submerged. A control was set up to bombard leaves of whole tissue culture
plantlets to determine if detachment induced expression of sag12 in healthy leaves.
Microprojectile bombardment of anthurium leaves was conducted with the Biolistic PDS
1000/He System (BioRad, La Jolla, CA) at 1,550 psi with 28 Hg vacuum in the chamber,
macrocarrier level 3, and leaf tissue level 4. 3)lg of plasmid DNA was combined with 1
mg of 1.6,ttm gold particles (BioRad). 50 ,ttl of 2.5 M CaCl2 and 20 ,ttl of 0.1 M
spermidine were added simultaneously and vortexed for 3 min. The plamsid DNA-coated
gold particles were washed with 70% ethanol and suspended in 60,tt1 of absolute ethanol.
Ten microliters of this mixture was loaded on carrier disk and used for bombardment of
detached anthurium leaves (Itaya et al. 1997). Gold particles without plasmid were
washed in 70% ethanol 2X, resuspended in absolute ethanol and loaded directly on the
macrocarriers.
GUS determination
After bombardment, leaves were incubated for 3-5 days at room temperature
under low light before visualization was detected. Staining protocols for GUS activity
were performed according to Jefferson (1987). X-glue buffer (50 mM phosphate buffer
(pH 7.2) containing 0.05% [beta]-mercaptoethanol and 0.0025% Triton X-IOO, 0.1 mM
41
potassium ferricyanide and 0.1 mM potassium ferrocyanide. 0.5 mg/ml 5-bromo-4
chloro-3-indoyl glucuronide (X-glue) was added fresh in a DMF solution prior to staining
leaf tissue. The bombarded leaf tissue was incubated at 24QC for 2-3 days, then incubated
in the X-glue solution (pH 7.0) for 4 hours (arabidopsis) to 24 hours (anthurium).
Visualization and detection ofGFF
Photo-documentation was obtained by using the Olympus BX60 uv
microscope with a "wild-type" filter set (Omega Optical cat # XF1076, #XF2040,
#XF3003) that effectively excites at ~'f.. 400nm and detects emissions at -'f.. 505-540 from
wtGFP (mGFP4). The second filter set is the FITC cube filter for visual detection of
GFP5 (Omega Optical cat # XFI063, #XF2054, #XF3067) excitation -'f.. 488nm,
emission -'f.. 505-530nm. Both filter sets can detect GFP4 and GFP5. Pictures were
documented with the SPOT 1.5.0 camera (Diagnostic Instruments Inc., Sterling Heights,
Michigan) and SPOT software v.3.0. PCR amplification of GFP cDNA was verified via
gel electrophoresis. The eDNA was constructed from mRNA fractions of pooled leaves 5
days post-bombardment. The mRNA was treated with RQl DNase (Promega) to avoid
contamination from plasmid constructs.
42
Results
Pr-SAG12 transient bombardment assays for expression ofGFP
This experiment sought to determine whether a senescence-activated promoter
(Pr-SAG12) from the dicot arabidopsis is regulated in a senescence-dependent manner in
the monocot anthurium. The second purpose of this experiment was to develop a suitable
reporter gene system for this plant because GUS was not expressed in anthurium under a
variety of conditions (Hayden and Christopher, data not shown). Therefore, we
conducted transient assays using biolistic bombardments of healthy and senescent leaves
with Pr-SAG12 and the constitutive 35S-Pr fused to both green fluorescent protein genes,
gfp4 and gfp5-ER. The FITC filter cube, which allows orange chlorophyll
autofluorescence, and the wild type GFP (wt-GFP) filter cube, which eliminates it, were
used. In Figures 3.6, 3.7, 3.8A, 3.8B and Table 3.1, the positive control, 35SPr-gfp4, is
robustly expressed in both healthy and senescing anthurium leaves, while Pr-SAG12-gfp4
(Fig. 3.5, 3.8C, 3.8D) was expressed 20-fold higher in senescing relative to healthy
tissue. The 35SPr-gfp4 was expressed lA-fold higher in healthy relative to senescing
tissues (Table 3.1). Both gfp4 and gfp5-ER were expressed markedly (Figs. 3.8E and
3.8F), which demonstrated the suitability of these reporters for gene expression studies in
anthurium. Figures 3.9A and 3.9B show the wound-induced expression of Pr-SAGI2-gfp4
in healthy tissues. This also serves as a comparison of the wtGFP (Fig. 3.9B) and the
F1TC (Fig. 3.9A) filter sets.
43
Figure 3.5: GFP in senescing leaftissues expressed with Prsagl2 Bar scale=l OO~m
Figure 3.6: GFP in senescing leaf tissues expressed with Pr35S Bar scale=lOO~m
Figure 3.7: GFP in senescing leaf tissues expressed with Pr35S (lower mag.) Bar scale=1 OOJ1m
44
Figure 3.8. Representative examples of GFP expression driven by the 35S promoter or Pr-SAGl2 asmeasured via transient assays after biolistic bombardment of healthy and senescing leaves (Table 3.1)(A,B) mgfp4 expression with the 35S promoter, properly folds and can be visualized in anthurium tissue.Visualization demonstrated with the FITC filter cube, excitation 370-420nm, emission 505-540nm. (C,D)Two focal view points of pSAG 12-mgfp4 plasmid expression in senescing tissue demonstrated with thewtGFP filter cube.(E,F) A comparison of mgfp4 and mgfp5-ER transient expression in similar tissues afterbombardment. (E) GFP4 localizes around nucleosomes and the cytoplasm which in epidermal leaf cells.(B) GFP5-ER seems to localize in cytoplamsic organelles including proplastids and the endoplasmicreticulum. All photographs taken with the SPOT camera system, and are at lOX magnification.
45
Figure 3.9: (A,B) pSAG 12-mgfp4 expression in healthy tissue, small localization of areas possibly causedby wounding taken with the FITC (A)and wt-GFP (B) filter cubes. Photographs taken with the SPOTcamera system, and are at lOX magnification.
Table 3.1: Quantitation OfpSAG12-gfjJ4 and p35S-gfjJ4 expression in senescent and healthy tissues.
Discussion
sag12-gfp4Healthy Leaf
6.8 (± 3)
sag12-gfp4Senescent Leaf135.2 (± 71.5)
35S-gfp4Healthy Leaf
267.6 (± 74.2)
35S-gfp4Senescent Leaf180.3 (±44.8)
Plasmids PsAGI2-gfp4, p35S-gfp4, p35S-gfp5-E~ pBlue-gfp4 were used to test
transient expression in developmental stages of leaf tissue in anthurium. Preliminary
experiments focused on transiently expressing the uitlA or ~-glucuronidase(GUS) gene in
both arabidopsis and anthurium Leaf tissue. These experiments show that the
bombardment and staining procedures were correct as evidence of the of arabidopsis leaf
tissue showing the enzymatic cleavage of -Bromo-4-chloro-3-indoxyl-beta-D-
glucuronide into its colorimetric product (data not shown). It was also confrrmed that the
PSAGI2-guS vector was regulated in a senescence-associated manner, when transiently
46
bombarded into arabidopsis tissues. The constitutive promoter 35S also successfully
expressed gus in arabidopsis leaves. Variations of incubation time and temperature,
staining concentrations, and infiltration techniques were attempted for anthurium GUS
assays with no success.
This is consistent with previous research determining that the gus gene is
effectively expressed in stably transformed anthurium tissues, but GUS protein was not
detected by Western blot analysis (Kuehnle and Chen 1994). According to Kuehnle and
Chen, modifications at the gene level contribute to the inactivation of GUS. This is not
entirely consistent with the data presented in the research because key experiments were
missing that would effectively deduce this postulation. The authors performed PCR on
genomic DNA extracted from transformed tissues and confirmed the presence of the
inserted gene sequences. The second experiment showed that a Western blot of proteins
extracted from the transgenic plants did not successfully respond to the anti- ~-
glucuronidase antibody. More research is needed to come to a firm conclusion on this
data. First!y a genomic restriction digest can be performed and run on an agarose gel, the
southern of this gel can confirm the presence of multiple copies of the transgene in the
genome. The presence of multiple transgene copies can lead to promoter methylation and
result in gene silencing (Hobbs et al. 1990). Direct or inverted repeats can cause hairpins
also noted as triggers of transgene silencing. A reverse primer PCR (rpPCR) experiment
is commonly used to determine if inverted or tandem repeats of T-DNA inserts occur in
the transgenic genome (Kumar and Fladung 2000). These techniques are in addition to
an RT-PCR that is used to identify a mRNA transcript of the gus gene consequently
determining the problem to be transcriptional or translational.
47
In our transient assays no study was conducted to determine if mRNA
transcripts of gus were present. However, it was determined that there was no interaction
of GUS with the substrate resulting in the colorimetric product. When both GFP and
GUS were used as reporter genes, we successfully visualized GFP in parallel with the
unsuccessful production of GUS. GFP mRNA transcripts were confirmed via RT-PCR,
after digestion with DNAse to eliminate any contaminating genomic or plasmid DNA.
This may indicate that unsuccessful GUS production occurs at the translational or post
translational level. Improper folding, post-translational modification, or interaction with
other cell components may be the primary cause. Anthurium tissues contain a unique
ratio of phenolic compounds which could irreversible bind to a foreign protein. Thionins
(small defense proteins) have also been suggested as inactivators of the GUS protein
(Diaz et al. 1992). It has been determined that the GUS reporter enzyme system is an
unreliable, if not unusable, system for expression analysis studies in anthurium. We
report here that GFP is an effective reporter gene system for anthurium. The benefits of
the GFP system include non-invasive and non-destructive analysis of transformed and
transiently expressing tissues, ease of documentation, and clear differentiation from
endogenous proteins. To understand GFP and how it interacts with anthurium physiology
we conducted several bombardments with 35S-gfp4 and 35S-gfp5-ER. GFP4 was chosen
for experiments involving the characterization of Pr-SAG12 due to ease of sub-cloning
procedures with available Pr-SAG12 vectors.
GFP analysis was performed multiple times with healthy and senescing tissues.
In this report we show that Pr-35S promotes GFP expression in anthurium leaf tissues,
and Pr-SAG12 promotes GFP in a senescence-upregulated manner. Observing GFP4 in
48
anthurium tissues was performed with two different confocal microscopes and two
different tissues. The materials and methods section lists the primary method, tissue, and
equipment. The first experiment focused on GFP4 visualization in senescing leaves,
driven by both Pr-SAG12 and Pr-35S, from mature plants cut into 10 cm2 sections. These
tissues were incubated post bombardment one month to maximize expression potential
and GFP accumulation. The senescing leaf squares had minimal amounts of chlorophyll
left providing a source free of background fluorescence, making it easy to visualize GFP
fluorescence. Figure 3.6 and 3.7 show good examples of GFP, establishing that Pr-SAG12
(Fig. 3.5.) is regulated in anthurium tissues but visually appears to be less active than the
GFP regulated by the constitutive Pr-35S (Fig. 3.6). At a reduced magnification (Fig.
3.7), it is easy to see a pattern of fluorescent vs. non-fluorescent sections of the anthurium
leaf square.
Further analysis was conducted on a late model confocal microscope (Olympus
BX60) fitted with a digital camera for documentation. This camera allows the use of
multiple filter cubes, to reduce background, and gain a different perspective on
fluorescent bodies within the cell. These experiments were conducted with whole
anthurium leaves (Marian Seefurth and Southern Blush cultivars) that were harvested
from tissue culture plantlets. The size of tissue culture leaves are significantly smaller
than whole leaves which results in a slightly smaller overall cell size. No significant
difference was observed between leaves that were excised from tissue culture plants and
placed on agar, and those leaves that were bombarded while still attached to the tissue
culture plantlet.
49
Figure 3.8A and 3.8B demonstrate GFP4 fluorescence visualization, with a FITC
cube, in anthurium leaves. The two pictures represent two different focal points and GFP
intensity in the epidermal layers of the leaf tissue. GFP4 was detected in the perimeter of
the cells and seemed to interact closely with the cell wall or plasma membrane creating a
distinct hexagonal shaped outline. This is consistent with previous reports involving the
visualization of hypocotyl epidermal cells in Arabidopsis showing cytoplasmic localized
GFP pressed in a thin layer between the cell wall and vacuole (Haseloff et al. 1997). The
visualization usually occurs in the nucleosome or cytoplasm with little or no association
with other organelles in the cell. Epidermal cells commonly referred to as "pavement
cells" commonly consist of large vacuoles, few organs, and no chloroplasts. These cells
have a polygonal shape and are simply required for turgor and water retention on the
surface of the leaf.
As depicted in Figures 3.8A, 3.8B, 3.8C and 3.8D the GFP4 fluorescence appears
in a polygonal shape and is associated with these cells easily visualized on the surface of
the leaf. The mesophyll layer is clearly present below this translucent cell layer. The
mesophyll cells are filled with many chloroplasts that appear as autofluorescing,
characterized by reddish/orange appearance. The FITC filter cube captured this distinct
difference between fluorescence and background for healthy tissue GFP analysis. GFP5
ER has an ER retention signal. The presence of this signal peptide tends to direct it to
accumulate in proplastids and other cytoplasmic organelles such as the endoplasmic
reticulum, but not in the cytoplasm or nucleosome. Figure 3.8E and 3.8F demonstrate the
difference between GFP4 (E) and GFP5-ER (F). These photos are consistent with the
two types of patterns we see with GFP4 and GFP5-ER in our transient assays. GFP5
50
seems to be associated with structural organelles at or below epidermal layers and
typically associated with the mesophyll cell, whereas GFP4 is easier to visualize in the
cytoplasmic contents of the epidermal cells, making it more readily detectable when
using the FITC filter cube, which also captures the auto-fluorescence from chlorophyll.
The GFP5 is slightly difficult to visualize with the FITC filter cube because of the
interfering fluorescence from chlorophyll. The Olympus microscope is limited to the
photo-documentation of an area no larger than the 120 cell area we obtained at lOX. The
actual image observed in the microscope optical at this magnification is nearly 5-8 times
this amount. Overall, it was easier to visualize GFP4 in anthurium tissues, both healthy
and senescent with the FITC filter cube. Senescent tissue had a slightly more
greenish/yellow auto-fluorescence making the wtGFP cube a better choice for
documentation because of it eliminated this backround. Healthy tissues having GFP4
present on the epidermal portion of leaf tissue showed extremely clear results.
The main purpose of developing a reporter gene system that functions in
anthurium is to evaluate the senescence-associated promoter, Pr-SAG12, from arabidopsis.
Such regulation suggests that anthurium has similar developmental mechanisms involved
with senescence. These include regulatory elements, transcription factors, enhancer
regions, and a myriad of proteins designed to initiate, delay, or prevent the development
in senescence. SAG12 is a cysteine protease isolated from arabidopsis that shows a
distinct expression pattern during development. This pattern shows no expression during
non-senescent conditions, but a steady increase throughout senescence, until it is one of
the most abundant proteins during late senescence (Lohman et aI. 1994). The SAG12
promoter was cloned from an arabidopsis genomic library and was further determined to
51
be regulated in a senescence-upregulated manner through reporter gene expression (Gan
and Amasino 1997).
More recent research on Pr-SAG12 has identified the specific region that confers
senescence specificity, and enhancer region, and a transcription factor binding site (Noh
and Amasino 1999a). When these regions were compared with two SAG12 homolog
promoters isolated from Brassica napus, two highly conserved regions were detected
(Noh and Amasino 1999b). Both these regions are necessary for senescence specificity
in both Brassica and Arabidopsis. Furthermore, transcription factors from arabidopsis
senescing leaf fractions bound to both Arabidopsis and Brassica promoters when radio
labeled probes of the essential -607 to -565 promoter region were incubated in whole cell
extract of arabidopsis senescent leaves. This, along with Pr-SAG12 successful regulation in
tobacco, establishes that transcription factors and promoter binding locations are
conserved in related species.
The research we present indicates that senescence-specific transcription factors
are also present in anthurium, and may be distinctly similar to those from arabidopsis.
Figures 3.6, 3.Se and 3.SD show GFP4 expression in anthurium regulated by Pr-SAG12.
These pictures clear!y show two unique focal points of GFP4 expression in senescing
tissues with the wt-GFP filter cube. Table 3.1 shows the average expression patterns of
multiple leaf bombardments using the vectors listed. Each leaf was observed post
bombardment and regions of contiguous cells were identified and individual cells that
make up that region were counted and recorded. Table 3.1 shows the average number of
cells within a contiguous region for each bombardment series. A distinct difference was
52
observed between healthy and senescing leaf tissue when bombarded with PSAG1z-gfp4.
Expression was broad in senescing tissues, however it was also identified in small regions
in healthy tissues. Figure 3.9A and 3.9B show the character of the localized region of
GFP expression in healthy tissues. This expression might be associated with cells
damaged when the biolistic particle penetrated the epidermal cells. GFP visualization
was never widespread and not present outside the area of damage. Figure 3.9 also
displays the difference between the FlTC filter cube (A) and the wt-GFP filter cube (B)
on an identical sample. Based on these results we feel confident that Pr-SAG1Z is regulated
in a senescence-associated manner in anthurium tissues, suggesting orthologous
mechanisms that regulate molecular mechanisms of senescence between anthurium and
Arabidopsis are present. It is also evident that the promoter may be regulated, to some
extent, in response to wounding caused by the biolistic bombardment consistent with a
cell autonomous view of senescence proposed by Weaver and Amasino (1998).
However, this regulation is localized and sag12 only shows a broad overall pattern of
expression in leaf senescent tissues.
53
CHAPTER IV
ISOLATION AND CHARACTERIZATION OF TWOCYSTEINE PROTEASE GENES FROM
ANTHURIUM AND THE EXPRESSION PATTERNOF EACH DURING DEVELOPMENT AND INRESPONSE TO HORMONE TREATMENTS
Introduction
Understanding gene regulation during senescence begins with isolating and
characterizing senescence-associated genes (SAG's). These genes give us insight into the
complex molecular process involved during senescence. Cysteine protease genes
expressed during senescence are of particular interest since they fall under class 5 SAG
expression. This stage indicates expression at the extreme initiation of senescence that is
sustained throughout the later stages. There also exists many isoforms of cysteine
proteases with different expression patterns suggesting unique and specific roles in the
developmental cycle.
One benefit that aids in the characterization of these genes is the extent of
homology contained in specific regions representing enzymatic functionality. This
enables the creation of degenerate primer sequences that can produce the successful
cloning of small portions of DNA from cysteine protease cDNAs synthesized from
unique developmental mRNA populations. Once a native fragment is isolated, it can
serve as a useful tool to identify full-length cDNAs. This can be accomplished by using
it as a probe to identify larger fragments within a cDNA library, or can simply be used to
develop primers and amplify cDNA ends within any given eDNA population. The eDNA
54
fragment may also be useful in developing an early expression pattern using Northern
Blot analysis. This analysis must be double checked for accuracy after the full-length
transcript is isolated.
Analysis of SAG gene expression by Northern Blot analysis of developmental
RNA populations indicates differential expression patterns confirming the senescence
associated gene expression. Once the SAG is identified it can be used in correlation with
the non-senescence associated cysteine protease, photosynthetic genes (Lhcb and psbA),
and a constitutively expressed gene (ubi), to determine expression under senescence
controlling conditions.
A comparison of expression patterns in response to stress and hormone treatments
is an excellent indicator in characterizing senescence-associated genes (Weaver et aI.
2001). Certain stresses and hormones are able to hasten or repress senescence as seen
visually by leaf yellowing and detected on the molecular level by responses in gene
expression. Cytokinin is a well-known senescence-delaying phytohormone (Gan and
Amasino 1997; Nooden et al. 1997). Endogenous treatments of the synthetic cytokinin
benzyladenine (BA) show a repression of senescence characteristics when applied on
anthurium leaves and flowers (Paull and Chantrachit 2001). Cytokinin can be used to
repress many SAG transcripts, and actually reverse the senescence of a leaf in the later
stages. Considering sugars are the main product of photosynthesis and certain sugars can
serve as signaling molecules, changing sugar levels during photosynthetic decline may
act as a senescing-inducing signal (Jang et aI. 1997). Sucrose can effectively repress the
accumulation of certain SAG transcripts when applied to detached leaves (Noh and
Amasino 1999a).
55
Although these treatments are somewhat effective in reversing the effects of
senescence and SAG transcripts, inducing senescence in leaves can result in a different
pattern of SAG transcripts from the observed expression during developmentally-induced
senescence. The most common techniques of inducing senescence include detachment
and incubation of leaves in water under dark and light conditions; desiccation; and
hormone treatments with ABA and ethylene. Certain SAG transcripts may not respond to
this type of induced senescence although the visual indicator (chlorophyll loss) of
senescence progresses rapidly (Noh and Amasino 1999a).
This chapter presents the details of two unique cysteine proteases isolated from
the anthurium species. The genes are characterized through comparison with like genes
from the GENBANK data base, the deduced amino acid sequence, and expression level
during development and hormone treatment.
56
Materials and Methods
Plant material and growth conditions
Tissue culture plantlets of Southern Blush (graciously provided by Agri-Starts
Micro, Mt. Dora, Florida.) and Marian Seefurth (University of Hawaii) were grown in
Magenta® GA-7 vessels (20-40,uE m-2s-\ 12 h light/12 h dark cycle) at 25°C and 35%
Humidity. Greenhouse-grown Marian Seefurth was grown under 78% shade (20-28QC,
80-95% humidity) year round at the University of Hawaii, Manoa campus (Honolulu,
Hawaii).
RNA isolation
Leaves from greenhouse grown anthurium plants (Marian Seefurth) were
collected and developmental stages were characterized by visual inspection and
chlorophyll determination. After collection or treatment of leaves, they were directly
frozen in liquid nitrogen and total cellular RNA was extracted using the protocol
developed by Champagne and Kuenhle (2000) with a few modifications. PVPP (sigma
P-6755) was substituted in place of PVP-40 and all extractions were performed at 13" C.
In addition, a low salt, low ethanol precipitation was included prior to the final ethanol
precipitation step to remove polysaccharide contamination from older tissue (Asif et al.
2000). A full protocol is located in the Appendix.
57
Hormone treatments and chlorophyll determination
Cut leaf sections (40 mm X 40 mm) from a mature healthy leaf, were submerged
in sterile H20 for 30 seconds, then floated on either 1 flM N6- Benzylaminopurine (BA,
Sigma B-3408) or 3% Sucrose (Sigma S·5390) solutions or sterile deionized water
(controls). All samples were incubated in darkness for the duration of the experiment.
Hormone treatments of whole leaves derived from greenhouse-grown plants were
conducted by submerging the petioles in either sterile H20 (controls), or 3% sucrose or 1
flM BA. For the BA treatments, a 1 mM BA solution was also sprayed on the leaves and
allowed to dry. Chlorophyll was determined as flg chi! g fresh weight of tissue for all
samples according to Lichtenthaler (1987).
RT-PCR, RACE, eDNA library construction, screening and eDNA characterization
Total cellular RNA isolated from greenhouse-grown leaves at various stages of
development was enriched for poly(Ar RNA using the PolyATract mRNA Isolation
System III (Promega Co., Madison, WI). A mixture of poly(A+) mRNA was prepared
from the different developmental stages at a ratio of 4:2:2, senescent, mature and
immature leaves, respectively. Reverse transcription was performed on this RNA with
100 units M-MLV Reverse Transcriptase (New England Biolabs, Beverly, MA). An
additional tracer reaction with [u32p]dCTP (lCN, Costa MESA, CA) was performed to
assess the purity, quality and size of eDNA products, via alkaline agarose gel
electrophoresis and autoradiography (Sambrook et al. 1989). The remaining RNA was
removed with 0.2M NaOH and the single-stranded eDNA products were used directly in
58
PCR. Degenerate primers with the sequences, forward 5'
TGYGGNAGYTGYTGGGCNTIY 3' and reverse 5'
TGGATHGTNAARAAKAGYTGGGGN 3' [Y(CT), N(ACGT), H(ACT), R(AG),
K(GT)] (lOT, Coralville, IA, USA) were constructed based on conserved regions in
known cysteine proteases from other plants. They were used in PCR to amplify two
different products of 500 bp that were cloned into the TOPO TA vector Invitrogen
(Carlsbad, CA). Sequence analysis (BMBITF, University of Hawaii at Manoa) confirmed
that two different PCR products, that shared high sequence identity with cysteine
proteases, were cloned. The inserts were used as probes to screen the eDNA library
according to Sambrook et at. (1989). The library was constructed from the mixture of
leaf poly(A)+ mRNA (ratio described above) using the ZAP-eDNA synthesis kit from
Stratagene (La Jolla, CA). Two different cysteine protease cDNAs were isolated,
sequenced, and designated, anth16 and anth17. Rapid amplification of 5' cDNA ends
(RACE, GeneRacer, Invitrogen, Inc.) was conducted to complete the full eDNA
sequences and verify the original eDNA clones. In addition, a cDNA encoding cab was
isolated via RACE.
All sequences were analyzed using the GCG package (Madison, WI), BLAST
(www.ncbi.nlm.nih.gov/BLAST), Prosite (www.expasy.ch/tools/scnpsitl.htmI), SignalP
(www.cbs.dtu.dk/services/SignaIP). ClustalW (dotimgen.bcm.tmc.edu:93311multi
aIign/Options/clustaIw.html), Swiss EMBnet (www.ch.embnet.org/software/BOX_form)
(Boxshade) and links on the CMS MBR homepage (restools.sdsc.edu/).
59
Northern blot ana(vsis, probe construction, and band quantification.
RNA concentrations were determined spectrophotometrically and verified using
the Kodak 1D scientific imaging system (Kodak, New Haven, C1). Total cellular RNA
(3-5 ug) was denatured and loaded on a 0.75% formaldehyde agarose gels as described
(Hoffer and Christopher 1997). After electrophoresis and transfer to Genescreen plus
(NEN, Boston, MA), (Sambrook et al. 1989) the blots were prehybridized for 6 hours
and then hybridized to [a32p] dCTP-labeled probes. The probes were assembled as
follows: Anth17 full-length cDNA clone, Anth16 overlapping 5' and 3' regions from
RACE,psbA 1.3 KB fragment from arabidopsis, cab overlapping 5' and 3' regions from
RACE, ubi 1.3KB eDNA clone from Pineapple Library. The photosynthetic genes were
used as a reference for nuclear and chloroplast photosynthetic gene activity during
development (Rapp et al. 1992; Oh et al. 1996; Hajouj et al. 2000). Labeling was
performed with the decaprime kit (Ambion, Austin, TX) and unincorporated radioisotope
was removed with ProbeQuant G-50 Microcolumns (Amersham Pharmacia, Little
Chalfont, UK). Hybridization and prehybridization were done in 50% deionized
formamide, 5x SSPE and 2.5% SDS at 42°C for 24 hours. After hybridization, blots
were washed 3X for 30 minutes in 0.5X SSPE/1% SDS at 42°C before exposure to
Classic blue sensitive X-ray film (Molecular Technologies, St. Louis, MO). The blots
were exposed to a Cyclone storage phosphor screen, and radioactive bands were
quantified using the Optiquant imaging system (Packard Instrument Company, Inc.
Meriden, C1). Data (digital light units, DLUomm-2) was normalized to uniform probe
length and by subtracting background DLU. The mean ± standard error was calculated
for three replicated experiments using the highest value for each probe as 100%.
60
Results
Isolation and characterization of two cDNAs encoding cysteine proteases from anthurium
We sought to determine whether senescence-dependent cysteine protease genes
that were homologous to arabidopsis sag12 were present in anthurium. Primers were
designed, based on conserved amino acid sequences in plant cysteine proteases, and used
in RT-PCR of a mixture of poly(A)+ mRNA from different tissues at a ratio of 4:2:2,
senescent, mature and immature leaves, respectively. The mixture was used to increase
the probability of obtaining more than one developmentally expressed gene family
member. Two different PCR products were obtained that were homologous to cysteine
proteases. They were cloned and used as probes to screen a cDNA library made from the
same mixture of poly(A)+ mRNA. The resulting nucleotide and deduced amino acid
sequences of the full-length cDNAs corresponding to the two different cysteine proteases
(termed anth16 and anthl7), are shown in Figures 4.1 and 4.2 respectively.
The boxshade analysis of the deduced amino acid sequences of anth17 and anth16
shows highly conserved regions with both dieot and monocot cysteine proteases (Fig.
4.3). Anth16 and Anth17 contain several characteristic regions, such as the highly
conserved Cys-His-Asn catalytic triad, type II Gly residues, and several other conserved
cysteine residues (Fig. 4.3) (Kamphuis et al. 1985; Cohen et al. 1986; Watanabe et al.
1991). Both proteins also contain a hydrophobic signal peptide (Fig. 4.1 and 4.2), a
positively charged hydrophilic propeptide sequence (Fig. 4.9), and a C-terminal region
61
CGACTGGAGCACGAGGACACTGACATGGACTGAAGGAGTCGACTGGAGCACGAGGACACTGTACATGGACTGAAGGAGTAGAAAAAGA
100GCCATCGGTCTACAGCTTCCCACGATGGGCAATGGAAGGATCACAGTGCTACTCCTTTCCGTCGTGTTGCTCTCAGTTGCTCCCTCTGGG
MGNGRITVLLLSVVLLSVAPSG
200~TTGCAGCGCTGGGGAGTGGCCGAGCTCCGGGCAGGGGCCGGAGGACGTGGGGGCCGGTGGTGTGGAGGGAGGGCAGGAGCTGTTCGAG
SCSAGEWPSSGQGPEDVGAGGVEGGQELFE300 50
CGGTGGATGGAGAAGCACCGCAAGGTGTACGCCCACCCGGGGGAGAAGGCCAGGAGGTACGCCAACTTCCTGAGCAACCTCGCGTTCGTGR W M E K H R K V YAH P G E K A R R Y A NFL S N L A F V
400AGGAAGCGGAACGCCGAGGGGAGGCGGGCGCCGTCGTCGGGGCAGGGCGTGGGGATGAACGTGTTCGCGGACCTGAGCAACGAGGAGTTCR K RNA E G R RAP SSG Q G V G M N V FAD L S NEE F
AGGGAGGTGTACTCGTCGAGGGTGCTGAGGAAGAAGGCCGCGGAGGGGAJaaAGCGAGGCGGAGAGCCGGGGAGGGGAGAGTGGTGGCGREVYSSRVLRKKAAEGRGARRRAGEGRVVA
600GGGTGCGACGCGCCGGCTTCGCTGGATTGGAGGAAGCGGGGGGCTGTCACGGCGGTGAAAAACCAAGGCGATTGTGGGAGTTGCTGGGCAG C 0 A PAS LOW R K R G A V T A V K N Q G D C G S C VI A
150 700 •TTCTCTTCCACGGGAGCAATGGAAGGGATAAACGCCATTACCACAGGGGAGCTCATCAGCCTCTCCGAGCAAGAACTGGTCGACTGTGACF SST GAM E GIN A ITT GEL I S L SEQ E L V 0 C 0
~88ACCACCAACGAAGGCTGCGACGGGGGTTACATGGACTACGCATTCGAGTGGGTCATCAACAATGGAGGAATCGATTCAGAAGCCAACTACT T NEG COG GYM 0 Y A F E VI V INN G G IDS E ANY
CCCTACACCGGCCAGGCGGACAGCGTCTGCAACACCACAAAGGAGGAGATTAAAGTGGTGTCAATCGATGGCTACGAAGATGTTGCAACAPYTGQADSVCNTTKEEIKVVSIDGYEDVAT900 250AGCGAAAGCGCTCTCCTTTGTGCAGCCGTTCAGCAACCGGTCAGCGTGGGGATCGACGGATCGTCACTAGACTTCCAATTATACGCCGGASESALLCAAVQQPVSVGIDGSSLDFQLYAG
1000GGGATCTACGACGGCGACTGCTCGGGAAATCCCGACGACATCGACCACGCCGTGCTGGTCGTCGGCTACGGGCAGCAGGGAGGCACCGAC
G I Y 0 G D C [POOO GNP 0 DID ~ A V L V V G Y G Q Q G G T D
TACTGGATCGTGAAGAACTCGTGGGGAACCGATTGGGGGATGCAGGGATACATCTACATAAGGAGGAACACCGGGTTGCCCTACGGCGTCY VI I V K N S W G T D VI G M Q G Y I Y I R R N T G L P Y G V
TGCGCCATCGACGCC:TGGCCTCCTATCCc!i&~~GCAATTCGCACCCGCCGCCACTCCCCCGTCACCAGCGCCACCGC~~~GTCGCCGC A I DAM A S Y P T K Q F A P A A T P P SPA P P P P S P
1300CCGCCGCCGCCAACTCCCCCTAGCCCTTCACCATCTCAGTGCGGAGACTACTCATACTGCCCGTCGGATGAGACTTGCTGCTGCCTCGTGPPPPTPPSPSPSQCGDYSYCPSDETCCCLV
fJl&GAGTTGGGTGGCTTCTGTCTCATCTATGGCTGCTGCGCTTACCAGAATGCGGTGTGTTGCACCGGGACTGTCTACTGTTGCCCACAAGACELGGFCLIYGCCAYQNAVCCTGTVYCCPQD
1500TACCCAATCTGTGATGTGCCAGATGGGCTCTGCCTCCAGCACCTTGGAGATGTTGTGGGTGTGGCGGCAAGGAAGCGGAAGCTGGCCAAAYPICDVPDGLCLQHLGDVVGVAARKRKLAK
450 1600CACAAGTTCCCATGGACGAAAGCTGGAGACACGCCCCAGCAGTACTACCAGCCATTGCTGTGGAAGAGAGATGGAGTTGCAGCACTGCGGHKFPWTKAGDTPQQYYQPLLVlKRDGVAALR
NdbTGAAAACCGAAGACAGATAATTCTATCTGTTTTCACTTTGGATCAATGCTTGTTCCGGGGAATAACTATGATGCTCGTTGTCTTGATGGC
CATATTCTTTCCTGGGTCTGGAGTTTTTGGACACCATATGTAACTTATATTAGAACTCATCCTTGCGGATCTCTCTCTTATCTAAATAAA
1800ATTTCCAAACGTCGA
Figure 4.1. Nucleotide and deduced amino acid sequence of anth16. Computer analysis and assembly ofcDNA clone sequences was performed with the GCC package. Marked features include the predictedsignal peptide sequence (underline) and catalytic triad residues (Cys-Ris-Asn) marked with a circle.
62
CMGrPCN:J'{fCCCCCGGGCCCTCTCTCACCTTTGAGCCTTCGACGCCGCTCGGGGAGGAACGAGATGGGTGTGCTCAG=CCGATGAM G V L RAP M M
100TGGTCCTCCTCCTCCTCCTGGCCCTGGTGGCCGCGAGTTCCAGGGGGATCGTGGCGGAGCGGACGGAGGAGGAGGTGAGGCTGCTGTPCGVLLLLLALVAASSRGIVAERTEEEVRLLYE
200AGGGGTGGCTGGTGGGAAACGGCAAGGCGTACAACCTGCTGGGTGAGAAGGAACGCCGCTTCGAGATCTTCTGGGACAACCTCCGCTPCA
G W L V G N G KAY N L L G EKE R R F ElF WON L R Y I50
300TCGPCGACCACAACCGGGCGGAGAACAACCACTCCTACACACTCGGCCTCACCCGCTTCGCCGACCTCACCAACGAGGAGrACCGCTCCA
DOH N RAE N N H S Y T L G L T R FAD L T NEE Y R S T
400=ACCTGGGGGTGAAGCCCGGCCAGGTGCGGCCCCGCAGGGCGAACCGGGCCCCCGGCCGCGGCCGCGACCTGTCCGCCAACGGCGACGJOL G V K P G Q V R P R RAN RAP G R G R 0 L SAN GOD
500ACCTGCCGCAGAAGGTGGACTGGAGGGAGAAGGGGGCCGTCGCPCCCATCAAGGATCAGGGCGGCTGTGGGAGCTGCTGGGCCTTCTCCA
L P Q K VOW R E K G A V A P I K 0 Q ~gG C G S ~ WAF S T
CTGTGGCTGCAGTGGAAGGCATCAACCAGATCGTTACGGGGGACTTGATAGTCTTGTCTGAGCAGGAGCTAGTTGATTGTGACACTGCCTV A A V E GIN Q I V T G 0 L I V L SEQ E L V 0 COT A Y
700ACAPCGAGGGCTGCAPCGGAGGGCTCATGGACTATGCCTTCCAGTTCATCATCTCCAATGGTGGCATCGACACCGAGGAGGATTACCCCT
NEG C N G G L M 0 Y A F Q F I I S N G G I D TEE 0 Y P Y200
ACAAGGAACGCGATGGGCTGTGCGATCCCAACAGGAAAAACGCCAAGGTTGTCTCCATTGATTCGTACGAGGATGTAT~ggAGAACGATGK E R D G LCD P N R K N A K V V SID S YEO V LEN 0 E
900AGCATGCCCTCAAMCAGCAGTCGCTCATCAPCCTGTTAGTGrTGCTATTGAAGGTGGTGGCCGGAGTTTCCAGCTCTACAAATCGGGCA
HAL K T A V A H Q P V S V A lEG G G R S F Q L Y K S G I250
TNrTCGATGGGAGNrGTGGCATAGATCTTGATCATGGTGTTGTTGCAGrAGGATATGGCACGGAGAGTGGGMGGPCTACTGGATCGTGAFDGRCGIDLDHGVVAVGYGTESGKDYWIVR
• 3001000
GGAACTCGTGGGGTAAAAGCTGGGGAGAGGCTGGATACATCAGMTGGAGCGTAATCTTCCTAGCTCCAGCAGTGGCMGTGCGGGATCGNSWGKSWGEAGYIRMERNLPSSSSGKCGIA
• 1100CCATTGAACCCTCGTACCCCATAMGAAGGGCCAAMCCCACCCAAACCTGCACCATCCCCTCCATCACCTGTGAAGCCTCCCACTGMT
I E P S Y P I K K G Q N P P K PAP S P P S P V K P PTE C1201jl50
GCGACAACTACTACTCCTGTCCAGAGAGCACTACTTGCTGCTGTGTCTATGAGTATGGCAMTACTGCTTTGCATGGGGNrGCTGTCCTCON Y Y S C PES T T C C C V Y E Y G K Y C F AW G C C P L
1300TAGTAAATGCTGTCTGCTGTGPCGATCATAGCAGCTGCTGCCCTCATGACTACCCAGTTTGCANrGTTAAGCAGGGAATATGCCTCGCTA
V N A V C COD H S S C C PHD Y PVC N V K Q G I C LAS400 1400
GCAAAAATAACCCACTTGGAGTGMGATGCTGAAACGCACTCCTGCAAAACCCCACCAGGCTTTCTCCGGAGCGGAGGGTGGAAGGAGCAK N N P L G V K M L K R T P A K P H Q A 4~0 S G A EGG R S S
1500GCATATGATMGTAGGTGCTTTCAAATTAAGCCATCGTACTAGTATATGCCTTTAGATGGTAGCTGGGCGCATAGTAGATGGCTTCGCCA
I1600
TGATTGAAGTGCACTGCCCCATCCATGGCTGCCACAAAGTAMCTATCGNrAGTGTCTGCTCAGrTTATTGGATCTGTGTATATCCTTAT
TTTCCATCGCAAGMGGATAGTACTTCAATTTTATTTCCMTGTACATTAAACATMTTCATCTATGTGCTTTCTMJJ:,~~k
Figure 4.2. Nucleotide and deduced amino acid sequence ofan/h] 7. Computer analysis and assembly ofcDNA clone sequences was performed with the GCC package. Matked features include the predictedsignal peptide sequence (underline) and catalytic triad residues (Cys-His-Asn) matked with a circle.
63
A17PVZXOZBVBBATA16XC
1 U8LALVAASSRGIVARR1 KSIISYDNABODKATMRT1 S RGGGLMSIVSTGSRT1 LL SLAAADKSIVSYGBRS1 LAPAPALGVPLTBIDLAS1 --------·-)(AKPIPIALALVA SP SIAOS-IPPTBlDLAS1 -·····-------)(ALKBHOIPLPVAlPSSPC.SITLSRPLD1 MGBGRITVLLLSVVLLS PSGSCSAGBWPSSGOGPBDVGAGQ1 -KAT8BSXITILIPLTTV TSISTK PSBPSILBGQBBDILSS
A
A17 163PV 160ZM 166OZ 162BV 165BB 163AT 163A16 179MC 176
DRSSDBYSDBYS
.. ~ .
•• ••
IPGQVRPRRANRAPGR . LSABGD~~~~rD'--PRRRL PS APRVGB
TR--··-POR - LGA' AADNBRRI·--·-PRRB' VSD TLAADNB
SRVRBBLSLSGG DGGPRTGDADHLPIIQRBRSQRGIQ NTGSrKTBNVGSLPIGVSALSSOSQTIMSP QNVSSG
SSRVLRlIAA.GRG~RAG.GRVVAGCD
SIVIGSRSNILIMGGVKRRMSVSSRTCD
PSPAPPPPSPP~~PISPSISOIGDlSTlPSDB.~IG~I.YQNlMllTGTV.1PPPPAPPSPP~PIIPTPPAlSIIGDPB~ADQ I~YR~I YSDlYJlKRSA S
76 ·--BNNBIT76 ···AIJf1lTT82 A-DAGVBSP78 A-DAGVB8'R79 - - - KRDMP r76 ---IKDAPYli.74 S-IPAGRTn89 GRRAPSSGQG88 --RKSBLDRT
A17PVZKOZBVBBATA16MC
A17 250PV 247ZM 253OZ 2UBV 251BB 2UAT 249A16 265 SMC 264
A17 336PV 333ZM 338OZ 334RV 337BR 335AT 335A16 353MC 352
443 IIIIDIPD~BLGDVV~AR~LIlaIPP.TIAGDTPOO~RDGVAALR--442 IIIIDIOAlYlYIHSAITP~AI~LIlaIMP.BIIBBTIIBBPQPLA.HRRPPAAAA---
A17PVZMOZBVBBATA16MC
416413418414
8l.-PL KL p. BOAPSGABGGRSSI----·····_-·-----·SIRNP. ALR P BGAPAGRKVSNA-·-···-------------·GIDSPLS SVlATKRTLAIRTOLSPATQLTALISSALRIRSVALORQQPO
~a~trl~~RDSPLAlXAL~LllPHLS'LPOHOIISSA------------------
Figure 4.3. Alignment of amino acid sequences derived from anth16 and anth 17 (Anthurium andraeanum)with those from 8 different plant proteases. Black boxshade denotes complete conserved amino acids,while grey boxshade denotes conservative amino acid replacements. Anth 16 and anth 17 are labeled alongwith other plant species abbreviations. The GENBANK Accession numbers, [PY] kidney bean (T12041),[ZM] com (TO I207), [OS] rice (P25776), [HY] barley (AADI0337), [HH] daylily (P43 156), [AT] sagl2(AAC49135), [Me] Matricaria chamomil/a (AAD54424). Key features * cysteine disulfide bonds Type II glycine residues C Type II glycine residues missing from anth16 • amino acids that form thecatalytic enzyme site. important tryptophan residues. A proline-rich segment is indicated by black bar,including the additional inserted region found in anth16 identified with a thicker black bar region. APotential targeting signal is boxed at the C-terminus of anthl6.
64
also predicted to be subject to post-translational cleavage (Abe et aJ. 1987; Watanabe et
aJ. 1991; Yamada et aJ. 2000).The cysteine proteases compared (Fig. 4.3) can be divided
into two groups based on the presence of an -100 amino acid c-terminal extension in the
predicted polypeptides from anthurium, kidney bean, corn, rice and chamomile. The
enzymes from arabidopsis, daylily and barley lack the c-terminal extension. Of the two
clones, anth17 is most closely related to seven out of eight of the plant cysteine proteases
analyzed, such as maize, rice, bean and, of special note, arabidopsis SAG12 (Table 4.1).
Anth16 is more closely related to a cysteine protease from chamomile. Interestingly, the
polypeptides for ChaTP and Anth16 contain a novel 10 residue proline-rich insertion
beginning at positions 372 and 373, respectively.
Anthurium 17 Anthurium 16Zea maize 77 58
mir3 cysteine proteasePhaseolus vulgaris 76 59
cysteine protease precursorOryza sativa 76 57
Alpha chain cysteine pro.Brassica napus 67 56
COT44 cysteine proteaseHordeum vulgare 62 58
cysteine protease precursorHemerocallis ssp. 64 54
Thiol protease Sen102Matricaria chamomilla 52 60
Thiol proteaseArabidopsis thaliana 58 51
SAG12 protein
Table 4.1. Percent identity and similarity (in parenthesis) between the deduced amino acid sequences ofcysteine proteases from 8 plant species and with anth16 and anth17 from Anthurium andraeanum.
65
Because a senescence-regulated system was identified in the transient reporter gene
expression assays (Table 3.1), we conducted northern blot hybridization analysis to
determine if either anth16 or anth17mRNA levels were regulated during senescence. As
a control for photosynthesis genes that are expected to be down-regulated during
senescence (Rapp et al. 1992; Dh et al. 1996; Buchanan-Wollaston and Ainsworth 1997;
Hajouj et al. 2000), we also isolated a cab cDNA, which encodes a light harvesting
chlorophyll-a,b-binding protein. It was used in conjunction with a heterologous barley
chloroplast psbA gene (encodes D1 subunit of P5II) and pineapple ubi cDNA (ubiquitin).
The samples consisted of total cellular RNAs from five different stages of leaf
development, including young (YG) and mature healthy (MG) leaves and leaves from
three stages of senescence (51, 52, 53). The three stages of anthurium leaf senescence
were defined based on chlorophyll levels, as shown in Figure 6 (51: 60%-90%, 52: 30%
60%,53: 5%-30%). In Figure 7, anth17 mRNA levels are low in healthy green leaves,
while they increase during senescence, reaching peak levels at 53. In contrast, anth16
mRNA levels are undetected during senescence and are highest in young leaves. The
mRNA levels for genes encoding the photosynthetic apparatus (nuclear-encoded cab and
chloroplast-encoded psbA) are high in healthy leaves and decrease markedly during
senescence. Cab mRNA levels decrease markedly compared to psbA mRNA levels. The
psbA mRNA levels may be maintained longer during senescence than cab because the
highly stable psbA mRNA has a half life of 48 hrs (Kim et al. 1993). Ubiquitin gene
expression increased markedly from MG to 53 and this may be associated with the
numerous proteolytic processes occurring during senescence.
66
535251MGYG
B
.--f--
rt- - -
r-- -l-
I-
f- r-ho
800
700
600
500
400
300
200
100
EtBr
AYG
anthl7
anthl601
........01::l
cab >.~
Q.0...
psbA .Q~
U
ubi
.VG _MG &lS1 DS2 DS3
100%
80%
60%
40% I
20%
0%
[
[
nanth17 anth16 cab ubi psbA
Figure 4.4. Expression of anth17, anth16, cab, psbA, and ubi mRNA in leaves at different developmentalstages (A). Northern blots carrying RNA isolated from leaf tissue were hybridized with the indicated [32p]_labeled probes. (B) Histogram displaying chlorophyll content ofdevelopmental leaves. YG refers to youngleaves, fully expanded, but slightly fleshy of a brownish-green color. MG refers to mature leaves, fullyridged of a rich green color. 8 I, 82, and 83 indicate senescing leaves determined by chlorophyllconcentration (81:90-60%, 82 60-30%, 83 30-5%). (C) Histograms of gene expression duringdevelopment for each probe set. The mean ± standard error was calculated for three replicated experimentsusing the highest value for each probe as 100%.
67
Synthetic cytokinin, BA, represses the expression ofanth17
One of the defining characteristics of sag12 expression is its repression upon
treatment with cytokinin. Sucrose also can affect senescence (Sheen 1990; Krapp et al.
1991; Jang et al. 1997b; Noh and Amasino 1999a). Therefore, Figure 4.5 provides the
analysis of synthetic cytokinin treatment (BA, 1,uM solution/1mM spray) and sucrose on
anth17 expression relative to psbA expression in excised whole leaves placed in darkness
for 10, 20, 30 and 40 days. Leaves incubated in water served as a control. Whole leaves
were selected 10-15 days after full expansion. The BA-treated leaves were also sprayed
with a 1 mM BA solution, similar to the treatment commercial cut anthurium flowers
received prior to sale to increase shelf life (paull and Chantrachit 2001). Anth17 mRNA
levels were significantly lower in BA treated leaves during all time periods (Fig. 4.5).
The levels of psbA mRNAs were higher in the SA treatments for 10 and 40 days relative
to controls, but were not significantly different at 30 and 40 days. Sucrose repressed
psbA expression, but did not repress anth17 expression in whole leaves. This is
consistent with previous studies that showed sugars repress photosynthetic gene
expression (Sheen 1990; Jang et al. 1997).
In the experiment in Figure 4.5, it was not possible to use leaves at the exact
same stage of development. Thus, an additional approach was conducted using leaf
disks, which were harvested from a single leaf at the mature phase in each trial. A
second advantage of the leaf disks is a more uniform treatment of cells within the disk.
The leaf disks were incubated by floating on a 1,uM SA, sucrose, or an H20 solution for
3, 8, 14 and 20 days. Anth17 and psbA mRNA levels were measured via northern blot
hybridization analysis. In the SA treatments, anth17 mRNA levels were 50 to 75% lower
68
A BA treated whole leaf Sucrose treated whole leaf Control
10d 20d 30d 40d
anth171 ",.......
psbA
B psbA snth17
100% 1~
cS"80%]
80% a$UCIro..
1 00" 1_w_
a6ucro.e
I 80%_w_
I 80%
j 40% I 40"'-
20%120%
0% 0%10d 20d 30d 40d 10d 20d 30d 40d
Whole Leaf Hormone Chlorophyll
300
o 10d 0 20d 0 30d • 40d
200
100
o
400
800
700
600
~5' 500
i
c
Water Sucrose SA
Figure 4.5. Expression of anth17 in comparison with photosynthetic transcrifl psbA under cytokinintreatments. (A) Whole leaves were excised with petiole intact and incubated in darkness for 40 days withwater serving as a control. Leaves were harvested at corresponding intervals and RNA was extracted.Expression of anthl7 and psbA is indicated. Northern blots carrying RNA isolated from leaf tissue werehybridized with the indicated [32P]-labeled probes. (B) Histogram analysis of anth17 and psbA asexpressed in specified treatments.
69
A
anth17
psbA
EtBr
B
BA Sucrose
snth17 ".bA
100% 100%
lICJ'l(, 80%
1 1I 80"" : I
lICJ'l(,
I 40%~ j 40%1I
20%1 20%
0%' 0%W_ SA Sucro.. Wat« SA SUCI'08e
Figure 4.6. Leaf discs were excised from a single leaf and incubated for a time interval of 3, 8, 14, and 20days in 1uM BA, 3% sucrose, with water serving as a control. Expression of anthl 7 and psbA is indicated.EtBr staining is included to verii)' equal loading. (B) Histogram analysis of anth17 andpsbA as expressedin specified treatments. Histograms ofexpression data were calculated using the PhosphoImager.
70
relative to water controls for 3, 8 and 14 days (Fig. 4.6). No difference was observed
after 20 days, suggesting the effect of BA was breaking down. In the sucrose treatments,
anth17 mRNA levels were lower in the 3, 8 and 14 day periods relative to water controls.
The levels of psbA mRNA were not significantly different in the BA compared to the
water treatments, but decreased somewhat (25%) in the sucrose treatment (Fig. 4.6). The
lack of a marked effect of the treatments on psbA mRNA levels could be related to the
shorter time intervals (3-20 days, Fig. 9) relative to 10-40 days (Fig. 4.5) used to measure
this highly stable mRNA (Kim et al. 1993).
Discussion
RNA Isolation and Manipulation
Studying the molecular genetics of anthurium has been hampered by a lack of
suitable protocols for the extraction and analysis of DNA, RNA, and proteins. In order to
effectively research genes and promoters of any anthurium species, a suitable RNA and
DNA extraction method was developed to deal with the high concentration of phenolics,
polyphenolics, and polysaccharides located in all anthurium tissues. Phenolics are
compartmentalized in intact cells. During homogenization for nucleic acid recovery,
these compounds are oxidized and then interact irreversibly with proteins and nucleic
acids (Schneiderbauer et al. 1991).
Phenolics and polyphenols are characterized as having a high oxidation potential.
Phenolics most commonly oxidize to form quinones. These compounds are then
covalently coupled with nucleic acids preventing their isolation and extraction. The
nitrogen of the pyrimidine and the hydroxyl group of the carboxylic acid component of
71
RNA is highly reactive with phenolic components forming molecular aggregates. These
interactions can also occur with "face to face" and "edge to face" interaction of aromatic
surfaces, protonation of amides, hydrogen bonding, dipole-dipole, and dipole-induced
dipole interactions leading to the crystallization of the structures. These structures can
exist alone preventing separation or can form large molecular aggregates that sequester
proteins, carbohydrates, phenolics and nucleic acids (Sanenger 1984; Haslam 1998). The
resultant solution we observed in our attempts to extract RNA appeared in many forms.
It has resembled a dark brown mixture that becomes extremely fluffy during re
precipitation with salts, extremely viscous solutions containing many polysaccharides,
and a solution containing no RNA at all due to its removal during purification. These
types of solutions contained little or no recoverable nucleic acids available for analysis.
Many attempts were conducted to isolate total RNA from anthurium using
traditional extraction methods (Sambrook et al. 1989), guanidinium isothiocyanate
phenol-chloroform (Chomczynski and Sacchi 1987), high phenolics extractions
(Schneiderbauer et al. 1991; Levi et al. 1992), removal of polysaccharides, additional
precipitation steps, and commercially available RNA extraction kits (Qiagen, Valencia
CA; Ambion, Austin TX; Promega, Madison WI). None of these methods was suitable
for isolating high quality DNNRNA. It was determined that a broad variety of
secondary compounds, especially phenolics found in anthurium leaves, reacted with the
RNA and bound irreversibly, resulting in low 260/280 ratios. The RNA was also un
suitable for any further manipulation such a template for cDNA synthesis and subsequent
polymerase chain reactions. This is a typical result presented other attempts which
72
extract RNA or DNA from recalcitrant tissues (Schneiderbauer et al. 1991; Levi et al.
1992).
To extract high quality RNA from anthurium tissues of all developmental stages,
we assembled a variety of methods to create a reproducible technique. The core
extraction is based on a method published from researchers at the University of Hawaii
(Champagne and Kuehnle 2000). It is suggested that introducing phenol during the early
part of the extraction procedure may itself be responsible for an adverse reaction (Levi et
al. 1992). The extraction does not introduce phenol until after the cellular material and
non-nucleic acids have been removed by replacing early phenol/chloroforms steps with
pure chloroform extractions. Chloroform extractions are sufficient enough in removing
proteins and denaturizing ribonucleases (Murray and Thompson 1980). 13
mercaptoethanol and PVPP are two components present in the extraction buffer that
make a significant difference in preventing the oxidation of phenolic compounds.
Polyvinylpolypyrrolidone (PVPP) and Polyvinylpyrrolidone (PVP) have been
used in multiple RNA isolation protocols to reduce oxidation, to bind phenolics, and to
reduce contaminating substances. In an aqueous solution, PVP has a loose, random-coil
type of conformation analogous to that of proline rich proteins and displays a strong
affinity towards dissolved aromatic compounds including phenols (Molyneaux and Frank
1961). PVPP is an insoluble cross-linked polymer of PVP and resembles similar
properties to PVP, but differing in solubility. PVP is used in a many extractions to bind
contaminating phenolics by forming a complex by hydrogen bonding thereby protecting
nucleic acids. This generally allows the phenolics to be separated from the RNA when
combined with a phenol extraction of acidic pH. Insoluble PVP is preferred in extractions
73
since soluble PVP might obstruct or co-precipitate with the RNA. PVP may also be
incompatible with phenol and require an ethanol precipitation prior to the introduction of
phenol (Salzman et ai. 1999). p-mercaptoethanol is a well known and well used strong
reducing agent. In the absence of PVP, it has been shown to directly affect the quality of
extracted RNA when present in high enough concentrations (Lal et ai. 2001). Both
compounds were used to facilitate the rapid removal of phenolic compounds during
extraction, inhibiting oxidation reactions, which cause irreversible damage to the RNA.
Three versions of PVP/PVPP were used, a high molecular weight PVP (360,00
kDa), a low molecular weight PVP (40,000 kDa) and PVPP. p-mercaptoethanol was
added at a concentration of 550mM and the extraction was conducted in 15 ml to
maximize the dilution of polyphenolic compounds. Both PVP extractions seemed to
produce RNA at a mediocre quality, contaminated with polysaccharides and genomic
DNA but free of phenolics. Occasionally interfaces became unclear and a high loss of
RNA occurred during phenol/chloroform extractions. The substitution of PVP with
PVPP resulted in cleaner extractions and higher quality RNA. This method was also
reproducible. It appeared most PVPP was transferred to the organic phase in the first few
steps but was highly effective in eliminating phenolic contamination. PVPP also did not
interact with phenol when it was introduced. A white pellet may form following the first
precipitation, (2-propanol and Sodium Acetate) depending upon the preciseness of the
phase transfers during the extraction, and contains insoluble material and RNA.
However, if the pellet is exposed to gentle agitation at room temperature for a few hours,
high quality RNA is obtained after the insoluble fraction is centrifuged and removed.
This insoluble precipitate may be residual PVPP carried over in the precipitation. If in
74
fact this precipitate is PVPP it is able to be effectively removed from the RNA when
water is added. This is most likely due to its reversible binding to RNA which enables
PVPP to release the RNA when in a lower ionic solution. RNA yields are reasonable
(50-1001lg per gram of tissue), pure, and reproducible. Figure 4.7 shows 10Ilg of
developmental RNA fractions extracted from anthurium leaf tissue run on a 1.5%
FonnaidehydelMOPS gel and stained with ethidium bromide. It clearly shows the
quality of RNA does not diminish until the leaf is severely senescent and the low
presence of genomic DNA contamination. Figure 4.8 shows 14 separate leaf of hormone
treated RNA. This RNA was loaded directly on the gel (Sill) to show the reproducibility
of the extraction. This extraction is not efficient, fast, or cost effective but it has worked
on all tissues ofanthurium and Pineapple plants.
Figure 4.7. lOJ.1g ofTotaJ RNA loaded on a 1.5% Fonnaldehyde MOPS gel and stained with EthidiumBromide. RNA samples are from Immature, Healthy, Sl, S2, and S3 leaves (left to right).
75
Figure 4.8. 5J1l ofTotal RNA loaded on a 1.5% Fonnaldehyde MOPS gel and stained with EthidiurnBromide. RNA samples were extracted from 1 gram of leaf disc tissue.
Analysis ofAnth16 and Anth17protein sequences
Two genes were sequenced from cDNA created using mRNA isolated from
anthurium leaves. Comparisons of the deduced amino acid sequences with others that
have been reported indicate high homology with monocot cysteine proteases (Table 3.1).
The deduced polypeptide sequence of both cysteine proteases contain several regions
characteristic of cysteine proteases including a highly hydrophobic signal peptide, a
positively charged hydrophilic propeptide sequence, a mature protein, and a C-terminal
region also predicted to be subject to post-translational cleavage. In addition both
proteins contain the highly conserved Cys-His-Asn catalytic triad, type II Gly residues,
and cysteine residues. Figure 7 and 8 show the nucleotide and deduced amino acid
sequence of anth17 and anth16, respectively and also shows marked features that will be
discussed. Figure 4.3 shows boxshade analysis with other closely related cysteine
proteases including sag12 a known senescence-associated cysteine protease from
arabidopsis. Both clones were sequenced from cDNA created from mRNA extracted
from all developmental stages of anthurium leaf tissue. Based on the deduced amino acid
sequence, several attributes about the mature proteins can be predicted.
Anthl7 and Anthl6 have hydrophobic signal peptides located at Metl - Ala27 and
Metl-SecS respectively, which indicates the encoded polypeptides enter the secretory
76
pathway. The algorithms of (Nielsen et al. 1997; Emanuelsson et al. 2000) predict
Anth17 to be involved in the secretory pathway with a final destination outside the cel!.
The same algorithm predicts Anth16 to also enter the secretory pathway and may
associate with the plasma membrane to some degree. The prediction for Anth16 is at a
lower level of confidence than Anth17. Several papers indicate common regions that are
unique identifiers of cysteine proteases. Anth17 and Anth16 contain the conserved
catalytic triad (17:Cys154_HiS290
_Asn31 C)(16:Cys170_His30B-Asn328
) considered to be
integral to the active site of cysteine proteases. 6 Cys residues integral for the formation
of disulfide bridges are also present in their respective locations (17: 151,185,284,336)
(16:167,201,299,353). A conserved glutamine (17:148)(16:164) has been suggested to be
the proton donor necessary for cleavage of the peptide bond. When the hydropathy
profiles (Fig. 4.9) of both proteins are compared, the longer Anth16 seems to have
increased regions of hydrophobicity over Anth17.
Kamphuis, Drenth and Baker (1985) performed comparative studies based on
high-resolution structures of several thiol proteases and defined several key structural
attributes necessary for proper activity. Cysteine proteases contain specific glycine
residues that are usual!y associated with conformational flexibility of the protein that are
involved mainly in secondary structure turns. Type I residues provide conformational
flexibility and facilitate insertions and deletions in the sequence while type II are less
flexible. Serious alterations of the main-chain conformation through steric interactions
caused by the C~ of amino acids other than glycine.
77
4
3
- Anth17- Anth16
-3
I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I Io 20 40 &0 00 100 120 1+0 1&0 100 200 220 240 2&0 200 300 320 340 3&0 3eo 400 420 440 4&0 4eo SOO
I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I t Io 20 4' D' 0 100 120 140 1&0 100 200 220 240 2&0 200 300::120 040 0&0 000 400 420 440
Figure 4.9. Hydropathy profile of the deduced amino acid sequences of Anth 16 and Anth17 predictedusing the Kyle and Doolittle method. Plot was derived to compare the two cysteine protease sequenceswith each other, substituting gaps in areas to increase alignment. Gaps are indicated below the region ofintroduction with the line color corresponding to the protein with the missing segment.
Position 284 may not be serious because of the presence of glycine residues
upstream of 284 and directly following a conserved Glu-Pro-Val-Ser-Val segment.
Position 300 is of particular interest because it is directly following an important Cys
residue, and includes a 3 amino acid insertion increasing the distance between the Cys
residue and the integral His involved in the catalytic triad. This substitution increases the
distance between this highly conserved region from 5 to 8 amino acids. There is a small
number of single amino acid insertions/deletions in the mature protein region of various
cysteine proteases, however generally the interior portion of the polypeptide is extremely
conserved. Anth16 and a thiol protease isolated from cultured shoot primordia of
Matricaria chamomilla (termed ChaTP for identification purposes in this report) both
exhibit this 3 amino acid insertion as well as the missing glycine residues.
78
Mature cysteine proteases are translated into long polypeptides and then cleaved,
generally at both the NH and COOH termini, to produce a functionally active enzyme.
Oryzain, a family of rice seed cysteine proteases, follows this methodology, while some
cysteine proteases lack an extended COOH terminus tail (Abe et al. 1987; Watanabe et al.
1991; Yamada et al. 2000). Anth17 exhibits similar properties to these types of cysteine
protease and it is most likely that the two termini tails are processed to yield a fUlly
functional protein. The cleavage in the NH termini typically occurs before the first
conserved Leucine (17: Lue l3C) and near the Asp-Pro-Pro (17: Asp 351) sequence at the
COOH termini. This cleavage would produce a mature fully functional cysteine protease
of about 23.5 kilodaltons (Abe et al. 1987).
Anth16 and ChaTP exhibit slightly different properties at these two cleavage sites.
At the NH termini cleavage site, they are missing the characteristic luecine which is
replaced by a Cys-Asp-Ala motif before the highly conserved region begins at Pro147•
The COOH terminus includes a 10 amino acid, proline-rich, addition that includes the
absence of the Asn-Pro-Pro conserved motif. No conserved or special sequence has been
identified that regulates cleavage at these locations, however the Asn-Pro-Pro sequence
of long tailed COOH cysteine proteases seems to be followed by a proline-rich segment
that includes as many as 10 proline residues within a 15 amino acid segment. Anth16
and ChaTP have 17 and 19 proline residues, respectively, within a 26 amino acid
segment.
Anth16 is unique in that the inserted 10 amino acid proline-rich segment contains
a possible palindrome-like sequence that includes a Ser-Pro4 segment. The Ser-Pro4,
generally referred as Ser-Hyp4 due to the post-translational hydroxylation of proline
79
residues in specific amino acid combinations, is present in almost all types of extensin
peptides in repeats of three or more (Kieliszewski 94 for review). Extensin modules can
also be found in chimeric proteins where the protein is homologous to a certain family,
and a module, such as a tail region, is homologous to extensin. Such examples include
cysteine-rich lectins (Kieliszewski and Lamport 1994), stylar transmitting tissue proteins
(Baldwin et al. 1992), and chitinases (Sticher et al. 1992) as well as specialist proteins
involved in defense (Kurata et al. 1993), wounding (Sheng et al. 1991), and lateral root
initiation (Keller and Lamb 1989). Anth16 contains a proline-rich region that is longer
slightly more organized than most long-tailed cysteine protease propeptides. It is unclear
whether this region is of appropriate size or configuration to be considered a proline-rich
region, however TARGETP analysis of the deduced amino acid sequence suggests that
Anth16 may be specifically targeted towards the plasma membrane or cell wall, in
comparison with the more conserved Anth17 which is predicted to go outside or to
vacuole locations. Both proteins are predicted to be secreted.
Anth16 contains a COOH terminus tail sequence that includes a di-luecine (LL)
and the Tyr-based sorting motif, YXXlD (where Y referes to tyrosine, X refers to any
amino acid residues, and lD refers to hydrophobic residues with a bulky side-chain). Both
motifs regulate specific sorting of proteins through intracellular vesicle compartments by
associating with coat complexes such as clathrin (Sandoval and Bakke 1994; Mellman
1996). Although Anth16 contains both the YXXlD and the LL signals, its is not known
whether these motifs or the proline-rich sequence serve as anything that is functionally
significant for differences in targeting, location, or unique function from other cysteine
proteases.
80
It is interesting to note the inclusion of three potential signal or structural motifs
in Anth16 and characterize it as having a potential function unique in comparison with
typical cysteine proteases. Several proteins with similar signaling motifs have been
identified or suggested to exhibit protease like functions. A class of groupI allergens from
grass pollen has the characteristic catalytic triad and exhibits some protease activity after
the propeptide sequence is cleaved (Grobe et at. 2002). An arabidopsis drought-inducible
cysteine protease-like protein was identified as putatively GPI
(glycosylphosphatidylinositol) anchored (Borner et at. 2002). GPI anchors provide a
potential mechanism for targeting the protein to the plant plasma membrane and cell wall
(Morita et at. 1996; Youl et at. 1998; Sherrier et at. 1999). Extracellular proteases could
be involved in the remodeling and degradation of plant extracellular matrix (ECM)
proteins and are also involved in pathogen or wound response such as a matrix
metalloproteinase that is activated in response to pathogen infection in soybean (Uu et al.
2001).
Both Anthurium andraeanum and Matricaria chamomilla are plant species that
exhibit unique secondary metabolites. Anthurium includes a diverse combination of
phenolics, polysaccharides, and cell wall components. This type of cysteine protease
may playa role in negotiating interactions between these compounds during development
as shown by the Northern analysis. Anth16 is expressed at low levels in immature tissues
and not later in development. Analysis of the mature protein size, post-translational
modification, and sub-cellular location would help further characterize this type of
cysteine protease in anthurium.
81
Expression analysis ofcysteine proteases during development
Gene expression throughout plant development tends to fluctuate and is greatly
influenced by environmental factors. Any gene that plays a role in senescence can be
considered as Senescence-Associated Gene or SAG. These genes can be present during
other developmental stages, be induced by pathogen attack, or extremely sensitive to
hormone interactions. A gene only needs to be regulated to some extent during
senescence to be classified as a SAG. Other genes are senescence-enhanced, or
senescence-upregulated, due to increased mRNA accumulation during senescence.
However, only a select few show increasing expression from the precise onset of
senescence through its conclusion, without being present during development. These
genes are extremely important to any program which uses very specifically regulated
promoters to manipulate senescence. In general these genes are not induced by pathogen
attack, wounding, or desiccation. Overall a SAG gene is characterized by observing
enhanced transcript abundance coupled with chlorophyll loss. Many SAG mRNAs
appear to increase only after decreases in the nUclear-encoded cab mRNA, an important
protein involved with photosynthesis (Rapp et al. 1992; Oh et al. 1996; Hajouj et al.
2000). Many factors can classify genes as senescence-associated, nevertheless a
combination of factors needs to be analyzed to determine to what extent a gene is age
dependently senescence-upregulated or regulated by other senescing inducing pressures.
It can be reasonably concluded that the anthurium cysteine protease gene, anth17,
has an expression pattern consistent with that of a senescence-associated gene. It is also
determined that anth17 is senescence upregulated and shows little or no expression
during early development and maturity. Anth17 expression increases during
82
developmental senescence and is present in increasing quantities even as total RNA
levels decline 90% as senescence progresses (Fig. 4.4A). S3 stage RNA, -10%-30%
chlorophyll content compared to healthy leaves, show this expression pattern. A
histogram of chlorophyll levels throughout development is provided (Fig. 4.4B). Anth16
shows relatively light expression and is present only in the early development of leaves.
Photosynthetic gene expression is a good indicator of senescence initiation (Hensel et al.
1993). We show that the expression of the nuclear encoded gene for light-harvesting
chlorophyll alb binding protein (cab) is down-regulated rapidly in correlation to
chlorophyll levels in senescing tissues (SI, S2, S3, Fig. 4.4). In comparison, expression
of the chloroplast encoded gene psbA shows a more progressive decline during
developmental phases SI, S2 and S3. This is consistent with the longevity of chloroplast
transcripts and a potential delayed response to signaling events involved with senescence.
The psbA mRNA levels may be maintained longer during senescence than cab because
the highly stable psbA mRNA has a half life of 48 hrs (Kim et al. 1993).
The ubiquitin gene shows baseline expression during early development and
increases expression throughout senescence. Thought to be constitutive, ubiquitin
pathway genes have been shown to increase during senescence, since the massive
degradation of proteins during leaf senescence likely involves ubiquitin tagging and
proteolysis (Park, Oh et al 1998). Northern analysis of developmental leaf RNA was
conducted several times with consistent results. The combination of many trials is
displayed in a histogram of gene expression (Fig. 4.4C). The average percent is
calculated as a function of the highest expression within each gene transcript listed.
Some radiolabeled probes were stronger than others and certain mRNA levels
83
represented stronger than others in each developmental fraction. Figure 4.4C is presented
to give an indication of overall change of expression throughout development for each
individual transcript, rather than show exact expression intensity in comparison with the
entire group. The histogram accurately reflects by providing the highest level for each
transcript sample as 100%.
This research has concluded some rules and exceptions for SAG characterization
compared to other SAG research. Detaching leaves from the plant and incubating them
in total darkness is a popular technique first reported by Thimann (1980). This technique
has been extensively researched (Becker 1993; Oh et al. 1996; Weaver et al. 1998) and
concluded to be a controlled method to induce senescence as determined by chlorophyll
concentrations, but includes mixed results. One result shows an increase in SAGs
transcripts of detached leaves incubated in darkness but not observed in natural
senescence. (Becker 1993). Another shows that 9 out of 10 SAGs are induced in older
leaves, however 2 out of 10 SAGs were induced when younger leaves were detached and
placed in darkness (Weaver et al. 1998). Most studies that use the dark detached leaf
treatment conclude that senescence-associated genes are differentially regulated when
leaf senescence is induced by different factors. Factors which induce chlorophyll loss are
most likely to mimic gene expression of natural age-induced leaf senescence.
Expression analysis of anth17 mRNA under dark induced senescence and hormone
treatment.
Cytokinins have long been associated as a senescence-retarding hormone that
delays the loss of chlorophyll and proteins (Gan and Amasino 1997; Nooden et al. 1997).
84
Cytokinin has also been shown to reestablish leaves to a pre-senescent state after they
have begun to exhibit senescent characteristics. It is considered that tissues high in
cytokinins compete more effectively as nutrient and sugar sinks. This is apparent in
developing tissues and those with apical dominance. Tissues rich in nutrients and sugars
have a longer lifespan in addition to cytokinins concentrations that regulate molecular
and signal transduction events to keep leaves actively developing and metabolizing,
preventing senescence. Cytokinins are more likely to keep pre-senescent leaves in a pre
senescent state than to prevent SAG induction in older leaves. Cytokinins are able to
frequently block visible senescence but do not necessarily block expression of all SAGs
(Oh et al. 1996). The common idea is that cytokinins may only block a portion of
senescence progression. This is reflected by a loss in photochemical efficiency detected
in dark detached BA treated leaves (Oh et al. 1996). Although only a portion of the
senescence program is blocked, most SAG transcripts are retarded by endogenously
applied cytokinins. Most importantly for this work, exogenous treatments of the synthetic
cytokinin benzyladenine show a repression of senescence characteristics when applied on
anthurium leaves and flowers (Paull and Chantrachit 2001).
True senescence, induced by age, is a finely tuned process involving delicate
regulation of gene expression. It is clear that many different pathways may be involved
in inducing senescence. Commonly suggested methods include: drought or desiccation;
dark incubated whole plants; detached leaves in light or darkness; abscisic acid treatment;
ethylene treatment; cold treatment; wounding; and pathogen attack. A particularly
interesting report describes the induction of senescence through the placement of
"mittens" on individual leaves still attached to the plant. This type of senescence actually
85
increases if re-exposed to light. Interestingly, if a hole is punched in the mittens,
yellowing occurs in all covered areas of the leaf but not the punched portion that is
exposed to light (Weaver et al. 1998).
This result is consistent with that of Rouseaux et al. (1997) that showing far-red
induced chlorophyll loss is extremely localized. This may suggest that the senescence
response is highly localized, and possibly cell autonomous (Weaver et al. 2001). This
type of example solidifies the suggestion that a phytochrome may be directly or indirectly
involved with the light-mediated inhibition of senescence. Both continuous white light
and pulses of red light are able to inhibit senescence in detached leaves and that the red
light effect is reversible by far-red light (Tucker 1981; Biswal et aI. 1983; Biswal and
Biswal 1984). More recently this result was reconfirmed in soybean (Guiamet et al.
1989), sunflower (Rousseaux et al. 1996), and tobacco (Rousseaux et al. 1997) when the
plants senesced more rapidly when the red: far-red ratio was decreased. These results
suggest that phytochrome involvement may be and important inducer of the senescence
pathway which has many different signifigant branches. Weaver and Amasino (1998)
present a model stating that senescence induced by age occurs in a "leaf autonomous"
fashion, while senescence induced by darkness occurs in a "cell autonomous" fashion. If
this is correct it may be possible for senescence to occur in a cell autonomous fashion in
response to wounding, stress or even pathogen attack. This remains to be elucidated but
it also suggests that phytochrome involvement may be a cellular or subcellular inducer of
senescence in all plant tissues.
Considering sugars are the main product of photosynthesis and certain sugars can
serve as signaling molecules, changing sugar levels during photosynthetic decline may
86
act as a senescing-inducing signal (lang et al. 1997). Sucrose can effectively repress the
accumulation of certain SAG transcripts when applied to detached leaves (Noh and
Amasino 1999a). However, in nonsenescent leaves, sugar accumulation can lead to a
decline in chlorophyll and photosynthetic proteins (Stitt et al. 1990; Von Schaewen et al.
1990; Krapp et al. 1991; Krapp and Stitt 1994). Sugars can repress the transcription of
photosynthetic genes (Sheen 1990) and tend to increase during leaf senescence (Crafts
Brandner et al. 1984). The accumulation of sugars can both accelerate and delay
senescence. This is as a result of other factors in the leaf including Nitrogen and Carbon
ratios (Paul and Driscoll 1997), light (Dijkwel et al. 1997), and plant growth regulators
(Koch 1996).
In an effort to further characterize anth17 as a true senescence-upregulated gene,
a few previously described methods were attempted. Anthurium leaves 10 days after full
expansion were cut at the base of the stem and incubated in 12 hours light and 12 hours
of darkness. The leaves incubated in light seemed to senesce at variable rates lasting
from 15 to 40 days. Leaves incubated in darkness senesced in a more controlled fashion.
Leaves covered with a "mitten" type covering failed to induce senescence even after 30
days. A whole healthy anthurium leaf was cut into sections and incubated in darkness
floating on appropriate solutions. This experiment was successful but the leaf discs
showed no chlorophyll loss over 28 days. Leaves were also desiccated, wounded, and
treated with cytokinin (Benzyladenine). It was determined that dark incubation of
detached whole leaves provided the best method for inducing senescence similar to age
dependent senescence. Extreme care was exercised in choosing anthurium leaves of an
identical developmental stage even though anthurium plants have many variable
87
attributes. Leaf discs may have been more reliable because all of the treated tissue was
provided from a single leaf, assuring a controlled developmental phase as a starting point.
Whole leaves might have suffered from "stem plugging" (PaUll and Goo 1982) resulting
in an accelerated senescence state and also differ in developmental attributes caused by
differences in age of the anthurium plant, time of harvest, and environmental pressures
during leaf maturity.
Leaf disc experiments show that anthi7 expression was moderately inhibited by
cytokinin and sucrose treatments for 14 days in comparison with the water control.
Visible markers of senescence such as a sharp decline in Chlorophyll levels were not
detected during the experiment. The leaves were incubated in the dark for 20 days
without any appreciable difference in chlorophyll concentration. The expression of
anthi7 was inhibited by cytokinins and sucrose in these treatments for up to 18 days.
Leaves floated only on water and incubated in the dark showed a consistently high level
of anthi7 mRNA throughout the experiment. Baseline levels of anthi7 mRNA in all
samples may suggest a type of wound response. Northern analysis of cab expression in
leaf disc samples showed no transcripts. This is consistent with reports that show cab
mRNA transcripts and proteins nearly disappear after 2 days in dark incubated leaves (Oh
et al. 1996; Weaver et al. 1998; Hajouj et al. 2000; Weaver et al. 2001). Northern
analysis of psbA mRNA was also inconclusive due to the stable nature of the transcript.
Whole leaf treatments show a similar pattern with developmental populations when
whole leaves are excised and incubated in darkness for 40 days. Leaves incubated in a
cytokinin solution, in combination with a cytokinin spray treatment, show delayed
expression of anthi7 and prolonged cab and psbA expression. These leaves also showed
88
a delay in chlorophyll loss compared with the control. Leaves incubated in a sucrose
solution senesced extremely rapidly as indicated in the histogram of chlorophyll levels.
Both treatments confirm that cytokinin inhibits the expression of anth17. Whole leaf
treatments may be a more reliable indicator of inhibition due to chlorophyll loss, and
comparable to developmental expression of leaves from plants. It is not surprising that
the addition of a sucrose solution to incubated leaves in the dark increased the rate of
senescence. Many studies show sugar accumulation in non-senescent leaves can lead to a
decline in chlorophyll, photosynthetic proteins (Krapp et al. 1991), and photosynthetic
gene transcripts (Sheen 1990). Both results are consistent with research that shows
cytokinins are frequently able to block visible senescence and tend to retard the
expression of some SAGs depending on developmental stage and treatment parameters
(Becker 1993; Dh et al. 1996; Weaver et al. 1998).
The results presented here are consistent with previous studies on SAG type
genes. Anth17 is a SAG cysteine protease from the Anthurium species. This protease is
most likely senescence-upregulated. Anth17 occasionally shows very slight expression
in healthy leaves, but this may be as a result of cell autonomous expression, localized
wounding, or curling of the leaf perimeter. An anthurium leaf can still be productive and
green even if wounded, torn, or under pathogenic attack, making it plausible that
senescence conditions in anthurium leaves can both be cell and leaf autonomous. Anth17
increases dramatically throughout senescence and the transcript is at its highest levels as
the leaf nears necrosis. This result is consistent with that of sag12 expression from
arabidopsis.
89
CHAPTER V
CONCLUSION AND PROSPECTIVE
The research contained in this dissertation was funded by a special grant of the
USDA tenned Tropical & Subtropical Agriculture Research (T-STAR) awarded to Dr.
David A. Christopher. Some of the program goals include providing research that
maintains and enhances production of established tropical and subtropical agriculture
products; enhancing the role of value-added agriculture in tropical island ecosystems;
developing agricultural practices in the tropics and subtropics that are environmentally
acceptable through an agro-ecosystems approach; expanding tropical and subtropical
agricultures linkages to related industries and economic sectors. This research provides a
foundation for enhancement in post-harvest quality of Anthuirium flowers and a more
productive crop. We also harvest molecular resources from anthurium in an effort to
design an auto-regulatory senescence inhibition system from anthurium components. The
research also contributes to some fundamental questions of molecular biology.
Establishing Molecular Techniques to Deal with Recalcitrant Tropical
Species
Plant Molecular Biology and Physiology are advancing fields of science that
require a thorough understanding of molecular methods unique to each individual species
being researched. Molecular methods involved with researching tropical species are
90
more difficult because of the recalcitrant nature of the plant materials and the uniqueness
of the evolutionary divergent molecular physiology. This research defines techniques
that are new developments in the field concerning the anthurium species and can serve as
a reference for future studies involving anthurium molecular biology. These techniques
include RNA and DNA extraction; successful reporter gene introduction and analysis;
transient expression; cDNA library construction; and foreign promoter evaluation, SAG
characterization, and hormone and stress treatments. These molecular tools can also be
used to successfully evaluate other economically valuable tropical ornamentals for
increased yield and post-harvest quality. The research has characterized the SAG gene
anth17 and establishes the effective regulation of Pr-SAF12 in anthurium tissues
confirming that the molecular events of senescence do occur supporting the claim that
orthologous mechanisms exist between monocots and dicots.
Our understanding of anth17, its role during development, and regulation by
cytokinins, will lead to the isolation of a SAG promoter and the eventual development of
pANTII17-ipt, an auto-regulatory senescence inhibition system that is regulated by an
anthurium SAG promoter. This system is considered a more ideal approach to molecular
engineering since the regulatory element is native to the plant. The research enables the
isolation of Pr-ANTHI7 and its comparison to other SAG promoters to determine its relative
homology and conserved regions. This type of analysis helps to further our
understanding of the regulatory elements, transcription factors and enhancer regions
involved with SAG expression.
91
Contribution to the Fields of Post-Harvest Physiology and Molecular
Biology of Leaf Senescence
Post-harvest physiology is an important science concerning many agricultural
crops. These concerns range from preserving the quality and life of a commodity from
grower to consumer, increasing the commodities resistance to the stresses of shipping and
storage, and manipulation to increase or produce beneficial compounds upon harvest.
Senescence is an extensively investigated field that includes the study of plant growth
regulators, gene expression, proteins, and metabolites contributing to a better
understanding of plant molecular physiology. Many of these processes contribute to the
overall knowledge of all plant cell and molecular systems. This research provides
additional resources to the overall goal of understanding leaf senescence by providing
information on two novel Anthurium cysteine proteases, their role in developmental,
hormonal, and stress induced senescence, and the comparison and addition of them to the
GENBANK database. This research also defines the senescence-upregulated
performance of a dicot promoter in a monocot system suggesting similarities between
dicot and monocot senescence transcription machinery. Publishing the information
obtained through this research contributes to the molecular analysis of senescence and
post-harvest physiology of tropical ornamentals. Finally, research on senescence
regulated gene expression in a tropical species may be valuable for studies on other
tropical species involved with food, medicine, and ecosystem management fulfilling
many of the T-STAR program goals and improving the future of tropical plant research.
92
Cysteine Proteases: Form and Function for Commercial and Industrial
Applications
Hydrolases which cleave peptide bonds are generally known as protease,
peptidases, proteinases or proteolytic enzymes. Enzymatic studies on such enzymes
usually focus on those directly involved in the digestion of dietary protein, such as
trypsin and chymotrypsin, which are completely characterised. Proteases are amongst the
most studied proteins. It is through detailed characterization of the structure and function
of several proteases that they are also used as models in explaining the basics of enzyme
function. Cysteine proteases are actively researched for expression profiling during
senescence because some of the most specific age-dependent SAG genes are cysteine
proteases. In this sense, gene expression and promoter regulation of cysteine proteases is
very important for models explaining senescence.
Other proteases with varying functions, especially those pertaining to the
regulation of physiological processes, have also been studied. Proteolytic activity
involved in the processing and regulation of enzymes and hormones, cascade reactions in
the blood coagulating process, fertilization, embryo development and industrial processes
for food and feed production.
Proteases are found in all forms of organisms regardless of kingdom. Some
examples include plant proteases include papain of papaya, commonly used as a meat
tenderizer, and bromalein a mixture of several proteases of pineapple used in meat
tenderizers, chill-proofing beer, manufacturing precooked cereals, certain cosmetics, and
in preparations to treat edema and inflammation. Bromelain is also nematicidal. Animal
proteases include rennin, used in dairy industry to produce a stable curd with good flavor,
93
chymotrypsin, used extensively in deallergenizing of milk protein hydrolysates, and
trypsin, used for the biocontrol of insects and in the preparation of bacteriological media.
Proteases of bacteria, fungi and viruses are of interest due to the importance and
subsequent application of those enzymes in industry and biotechnology. Examples of
these include application of bacterial neutral and alkaline proteases from the Bacillus sp.
in fermentation and detergent industry; acid protease of Aspergillus sp. in food industry
namely, the production of cheese. Commercial application of microbial proteases is
attractive due to the relative ease of large scale production as compared to proteases from
plants and animals. However, some proteases from plants have specific functions,
substrates, and inhibitors, making them more attractive for use in unique applications.
Microbial proteases have been studied for their role in the development and
manifestation of diseases such as AIDS, cancer and acute and chronic systemic
infections. Characterization of these proteases, as with other virulence factors, provides
vital information to design new approaches in treatment, therapy and control of infectious
diseases, which include designing and production of vaccines, synthetic protease
inhibitors and pharmaceutical research. One such success story is of the HIV protease.
Structural studies of HIV protease have enabled the successful development of synthetic
HIV protease inhibitors for the treatment of AIDS patients. Similar studies are being
undertaken to develop synthetic inhibitors/2nd generation antibiotics for bacterial
proteases.
For each application there is a different protease that performs the work, or is
stable in the environment. Unique proteases may increase the efficiency or lower the cost
of production of a particular product. By performing knockout experiments with recently
94
isolated proteases, we can beller understand its role in development and subcellular
metabolism. Characterization of two cysteine protease genes, anth16 and anth17 from
Anthurium andraeanum contributes to this knowledge.
95
LITERATURE CITED
Abe, K., Kondo, H. and Arai, S. (1987). Purification and properties of a Icysteine protease fromgerminating rice seeds. Agrlc. Bioi. Chern. 51: 1509-1514.
Aharoni, N. and AE, R. (1978). Endogenous gihherellin and abscisic acid content as related to senescenceof detached lettuce leaves. Plant PhysioI62(2): 224-228.
Akamine, E. and Goo, T. (1975). Vase life extension of anthurium f1nwers with commercial fioralpreservatives, chemical compounds and other materials. Floral Review 155(4236): 14-15, 50-60.
Anderson, J. and Spilatro, S. (1989). Jasmonic acid dependent increase in the level of vegetative storageproteins in soybean. Plant Science 62: 45-52.
Asif, M. H., Puneet, D. and Nath, P. (2000). A Simple Procedure for the Isolation of High Quality RNAfrom Ripening Banana Fruit. Plant Mol Bioi Rep 18: 109-115.
Baldwin, T. c., Coen, E. S. and Dickinson, H. G. (] 992). The pHI gene expressed in the transmitting tissueof Antirrhinum encodes an extensin-like protein. PlantJ 2(5): 733-9.
Baulcombe, D. and Buffard, D. (1983). Gibberellic-acid regulated expression of alpha-amylase and sixother genes in wheat aleurone layers. Planta ]57: 493-501.
Becker, W. A., K (1993). Differences in gene expression between natural and artificially induced leafsenescence. Planta 189(1): 74-79.
Beevers, L. (1976). Leaf Senescence. Plant Biochemistry. J. Bonner and J. Varner. London, AcademicPress: 771-794.
Biswal, B., Choudhury, N. K., Sahu, P. and Biswal, U. C. (1983). Senescence of detached fern leaves.Plant Cell PhysioI24(1203-1208).
Biswal, U. C. and Biswal, B. (1984). Photocontrol of leaf senescence. Photochem Photobiol39: 875-879.
Borner, G. H., Sherrier, D. J., Stevens, T. J., Arkin, I. T. and Dupree, P. (2002). Prediction ofglycosylphosphatidylinositol-anchored proteins in Arabidopsis. A genomic analysis. Plant Physiol129(2): 486-99.
Buchanan-Wollaston, V. (1994). Isolation of cDNA clones for genes that are expressed during leafsenescence in Brassica napus. Identification of a gene encoding a senescence-specificmetallothionein-like protein. Plant Physloll05(3): 839-46.
Buchanan-Wollaston, V. and Ainsworth, C. (1997). Leaf senescence in Brassica napus: cloning ofsenescence related genes by subtractive hybridization. Plant Mol Bioi 33(5): 821-34.
Butt, A., Mousley, C., Morris, K., Beynon, J., Can, C., Holub, E., Greenberg, J. T. and BuchananWollaston, V. (1998). Differential expression of a senescence-enhanced metallothionein gene inArabidopsis in response to isolates of Peronospora parasitica and Pseudomonas syringae. Plant J16(2): 209-21.
96
Butt, V. and Lamb, C. (1981). Oxygenases and the metabolism of plant products. The biochemistry ofplants. C. EE. New York, Academic Press. 7: 626-665.
CabellO-Hurtado, F., Batard, Y., Salaun, J. P., Durst, F., Pinot, F. and Werck-Reichhart, D. (1998).Cloning, expression in yeast, and functional characterization of CYP81Bl, a plant cytochromeP450 that catalyzes in-chain hydroxylation of fatty acids. J Bioi Chern 273(13): 7260-7.
Champagne, M. and Kuehnle, A. (2000). An effective method for isolating RNA from tissues ofDendrobium. Lindleyana 15: 165-168.
Chen, c., Jin, G., Anderson, B. and Ert!, J. (1993). Modulation of plant gene expression by cytokinins.Australian Journal ofPlant Physiology 20: 609-619.
Chen, G. H., Huang, L. T., Yap, M. N., Lee, R. H., Huang, Y. J., Cheng, M. C. and Chen, S. C. (2002).Molecular characterization of a senescence-associated gene encoding cysteine proteinase and itsgene expression during leaf senescence in sweet potato. Plant Cell Physiol 43(9): 984-91.
Chomczynski, P. and Sacchi, N. (1987). Single-step method of RNA isolation by acid guanidiniumthiocyanate- phenol-chloroform extraction. Anal Biochem 162(1): 156-9.
Chary, J. and Voytas, D. (1987). Gibberellin-induced changes in the populations of translatable mRNAsand accumulated polypeptides in dwarfs of maize and pea. Plant Physiology 83: 15-23.
Chubatsu, L. and Meneghini, R. (1993). Metallothionein protects DNA from oxidative damage. Biochem J291: 193-198.
Clark, D. G., Richards, c., Hilioti, Z., Lind-Iversen, S. and Brown, K. (1997). Effect of pollination onaccumulation of ACC synthase and ACC oxidase transcripts, ethylene production and flower petalabscission in geranium (Pelargonium x hortorum L.H. Bailey). Plant Mol Bioi 34(6): 855-65.
Cohen, L. W., Coghlan, V. M. and Dihel, L. C. (1986). Cloning and sequencing of papain-encoding eDNA.Gene 48(2-3): 219-27.
Crafts-Brandner, S. J., Below, F. E., Wittenbach, V. A., Harper, J. E. and Hageman, R. H. (1984).Differential senescence of maize hybrids follOWing ear removal. II. Selected leaf. Plant Physiol74: 368-373.
Creelman, R. and Mullet, J. (1997). Oligosaccharins, brassinolides, and jasmonates: nontraditionalregulators of plant growth, development, and gene expression. Plant Cell 9(7): 1211-1223.
Dai, J. and Paull, R. (1990). The role of leaf development on anthurium flower growth. Journal ofAmerican Society ofHorticultural Science 115(6): 901-905.
Delorme, V., McCabe, P., Kim, D. and Leaver, C. (2000). A matrix metalloproteinase gene is expressed atthe boundary of senescence and programmed cell death in cucumber. Plant Physiol123: 917-927.
Diaz, 1., Carmona, M. J. and Garcia-Olmedo, F. (1992). Effects of thionins on beta-glucuronidase in vitroand in plant protoplasts. FEBS Lett 296(3): 279-82.
Dijkwel, P. P., Huijser, c., Weisbeek, P. J., Chua, N. H. and Smeekens, S. C. (1997). Sucrose control ofphytochrome A signaling in Atabidopsis. Plant Ce1l9(4): 583-95.
EI-Antably, H. and Wareing, P. (1967). Some physiological responses to D, L abscisin (dormin). Planra 73:74-90.
97
Emanuelsson, 0., Nielsen, H., Brunal<, S. and von Heijne, G. (2000). Predicting subcellular localization ofproteins based on their N- terminal amino acid sequence. J Mol Bioi 300(4): 1005-16.
Even-Chen, Z. and Atsmon, D. (1978). Hormonal aspects of senescence in detached tobacco leaves.Physiol Plant 44: 377-382.
Farmer, E. and Ryan, C (1990). Interplant communication: Airborn methyl jasmonate induces synthesis ofproteinase inhibitors in plant leaves. Proceedings of rhe National Academy of Sciences USA 87:7713-7716.
FeUer, U. and Fischer, A. (1994). Nitrogen metabolism in senescing leaves. Crit Rev Plant Sci 13(3): 241273.
Fletcher, R. and Osbourn, D. (1966). Gibberellin, as a regulator of protein and ribonucleic acid synthesisduring senescence in leaf cells of Taraxacum officinale. Canadian Journal ofBotany 44: 739-745.
Flores, S. and Tobin, E. (1988). Cytokinin modulation of LHCP mRNA levels: The involvement of posttranscriptional regulation. Plant Molecular Biology 11: 409-415.
Fu, Y., Ding, Y., Liu, X., Sun, C, Cao, S., Wang, D., He, S., Wang, X., Li, L. and Tian, W. (1998). Ricetransformation with a senescence-inhibition chimeric gene. Chinese Science Bulliten 43: 18101815.
Gan, S. and Amasino, R. (1995). Inhibition of leaf senescence by autoregulated production of cytokinin.Science 270(5244): 1986-1988.
Gan, S. and Amasino, R. (1997). Making sense of senescence: molecular genetic regulation andmanipulation ofleaf senescence. Plant Physiol113: 313-319.
Garbarino, J., Oosumi, T. and Belknap, W. (1995). Isolation of a polyubiquitin promoter and its expressionin transgenic potato plants. PlantPhysiol109: 1371-1378.
Grbic, V. and Bleecker, A. (1995). Ethylene reguiates the timing of leaf senescence in Arabidopsis. Plant J8(4): 595-602.
Grobe, K., Poppelmann, M., Becker, W. M. and Petersen, A. (2002). Properties of group I aUergens fromgrass pollen and their relation to cathepsin B, a member of the Cl family of cysteine proteinases.Eur J Biochem 269(8): 2083-92.
Grover, A. (1993). How do senescing leaves lose photosynthetic activity? Current Science 64: 226-233.
Guiamet, J. J., Willemoes, J. G. and Montaldi, E. R. (1989). Modulation of progressive leaf senescence bythe far-red ratio of incident light. Bot Gaz 150: 148-151.
Gut, H. and Matile, P. (1988). Apparent induction of key enzymes of the glyoxylic acid cycle in senescentbarley leaves. Planta 176: 548-550.
Hajouj, T., Michelis, R. and Gepstein, S. (2000). Cloning and characterization of a receptor-like proteinkinase gene associated with senescence. Plant PhysioI124(3): 1305-14.
Hanfrey, C, Fife, M. and Buchanan-Wollaston, V. (1996). Leaf senescence in Brassica napus: expressionof genes encoding pathogenesis-related proteins. Plant Mol Bioi 30(3): 597-609.
98
Haseloff, J., Siemering, K. R., Prasher, D. C. and Hodge, S. (1997). Removal of a cryptic intron andsubcellular localization of green fluorescent protein are required to mark transgenic Arabidopsisplants brightly. Proc Nat! Acad Sci USA 94(6): 2122·7.
Haslam, E. (1998). Practical Polyphenolics: From structure to molecular recognition and physiologicalaction. Cambridge UK, Cambridge University Press.
He, Y., Fukushige, H., Hildebrand, D. and Gan, S. (2002). Evidence supporting a role of jasmonic acid inArabidopsis leaf senescence. Plant Physiology 128: 876·884.
Hensel, L. L., Grbic, V., Baumgarten, D. A. and Bleecker, A. B. (1993). Developmental and age-relatedprocesses that influence the tongevity and senescence of photosynthetic tissues in arabidopsis.Plant Cell 5(5): 553-64.
Higaki, T., Watson, D. and Leonhardt, K. (1979). Anthurium Culture in Hawaii. Honolulu, HI, Universityof Hawaii.
Hobbs, S. L., Kpodar, P. and Delong, C. M. (1990). The effect of T-DNA copy number, position andmethylation on reporter gene expression in tobacco transformants. Plant Mol Bioi 15(6): 851-64.
Hoffer, P. H. and Christopher, D. A. (1997). Structure and blue-light-responsive transcription of achloroplast psbD promoter from Arabidopsis thaliana. Plant PhysioI115(1): 213-22.
Hong, Y., Wang, T., Hudak, K., Schade, F., Froese, C. and Thompson, J. (2000). An ethylene-inducedeDNA encoding a lipase expressed at the onset of senescence. Proc Natl Acad Sci USA 97: 87178722.
Huang, Y. J., To, K. Y., Yap, M. N., Chiang, W. J., Suen, D. F. and Chen, S. C. (2001). Cloning andcharacterization of teaf senescence up-regulated genes in sweet potato. Physiol Plant 113(3): 384391.
Itaya, A., Hickman, H., Bao, Y., Nelson, R. and Ding, B. (1997). Cell-to-cell trafficking of cucumbermosiac virus movement protein: green fluorescent protein fusion produced by biolistic genebombardment in tobacco. Plant J 12: 1223-1230.
Jang, J., Leon, P., Zhou, P. and Sheen, J. (1997a). Hexokinase as a sugar sensor in higher plants. Plant Cell9: 5-19.
Jang, J. c., Leon, P., Zhou, L. and Sheen, J. (1997b). Hexokinase as a sugar sensor in higher plants. PlantCell 9(1): 5-19.
Jefferson, R. and Kavanagh, T. (1987). GUS fusions: B-glucuronidase as a sensitive and versatile genefusion marker in higher plants. EMBO J 6: 3901-3907.
John, I., Hackett, R., Cooper, W., Drake, R., Farrell, A. and Grierson, D. (1997). Cloning andcharacterization of tomato leaf senescence-related cDNAs. Plant Mol BioI 33: 641-651.
John, I. H., R. Cooper, W. Drake, R. Farrell, A. Grierson, D. (1997). Cloning and characterization oftomato leaf senescence-related cDNAs. Plant Molecular Biology 33: 641-651.
lordi, W., Schanpendonk, C., Davelarr, E., StoopeD, G., Pot, C., De Visser, R., Van Rhijn, J., Gao, S. andAmasino, R. (2000). Increased cytokinin levels in transgenic PsagI2-IPT tobacco plants havelarge direct and indirect effects on leaf senescence, photosynthesis, and N partitioning. Plant celland Em'ironment 23: 279-289.
99
Kakimoto, T. (1996). CKIl, a histidine kinase homologue implicated in cytokinin signal transduction.Science 274: 982-985.
Kamphuis, I. G., Drenth, J. and Baker, E. N. (1985). Thiol proteases. Comparative studies based on thehigh-resolution structures of papain and actinidin, and on amino acid sequence information forcathepsins Band H, and stem bromelain. J Mol Bioi 182(2): 317-29.
Keller, B. and Lamb, C. J. (1989). Specific expression of a novel cell wall hydroxyproline-richglycoprotein gene in lateral root initiation. Genes Dev 3(10): 1639-46.
Kelly, M. and Davies, P. (1988). The control of whole plant senescence. Crit Rev Plant Sci 7: 139-173.
Kieliszewski, M. J. and Lamport, D. T. (1994). Extensin: repetitive motifs, functional sites, posttranslational codes, and phylogeny. PlantJ 5(2): 157-72.
Kim, M., Christopher, D. A. and Mullet, J. E. (1993). Direct evidence fot selective modulation of psM,rpoA, rbeL and 16S RNA stability during barley chloroplast development. Plant Mol Bioi 22(3):447-63.
Koch, K. E. (1996). Carbohydrate-modulated gene expression in plants. Annu Rev Plant Physiol Plant MolBioi 47: 509-540.
Koizumi, M., Yamaguchi-Shinozaki, K., Tsujio, H. and Shinozaki, K. (1993). Structure and expression oftwo genes that encode distinct drought-inducible cysteine proteinases in Arabidopsis thaliana.Gene 129(2): 175-182.
Krapp, A., Quick, W. P. and Stitt, M. (1991). Ribulose-l,5-biphosphate carboxylase-oxygenase, otherCalvin-cycle enzyme, and chlorophyll decrease when glucose is supplied ot mature spinach leavesvia the transpiration stream. Planta 186(1): 58-69.
Krapp, A. and Stitt, M. (1994). Infiuence of high carbohydrate content on the activity of plasMic andcytosolic isoenzyme pairs in photosynthetic tissues. Plant Cell Environ 17: 861-866.
Kuehnle, A. and Chen, F.-C. (1994). Genetic transformation in anthurium. Biotech Agric Forest 29: 217225.
Kumar, S. and Fladung, M. (2000). Determination of transgene repeat formation and promoter methylationin transgenic plants. Biotechniques 28(6): 1128 1130, 1132, 1134 passim.
Kurata, H., Cheng, H. M., Kozutsumi, Y., Yokota, Y. and Kawasaki, T. (1993). Role of the collagen-likedomain of the human serum mannan-binding protein in the activation of complement and thesecretion of this lectin. Biochem Biophys Res Commun 191(3): 1204-10.
Lal, L., Sahoo, R., Gupta, R. K., Sharma, P. and Kumar, S. (2001). RNA isolation from high-phenolic tealeaves and apical buds. Plant Mol Bioi Rep 19: 181a-18H.
Lauriere, C. and Daussant, J. (1983). Identification of the ammonium-dependent isoenzyme of glutamatedehydrogenase as the form induced by senescence or darkness stress in the first leaf of wheat.Physiologia Platarum 58: 89-92.
Lee, R., Wang, c., Huang, L. and Chen, S. (2001). Leaf senescence in rice plants: cloning andcharacterization of senescence up-regulated genes. Journal of Experimental Botany 52: 11171121.
100
Lers, A, Jiang, W. B., Lomaniec, E. and Aharoni, N. (1998). Proteins that functionally andimmunogenically related to pathogenesis-related proteins are induced during parsley leafsenescence. Physiol Plant 103: 497·502.
Levi, A., Galau, G. and Wetzstein, H. (1992). A Rapid Procedure for the isolation of RNA from highphenolic-containing tissues of pecan. Hort Sci 27(12): 1316-1318.
Li, Q., Bettany, A. J., Donnison, I., Griffiths, C. M., Thomas, H. and Scott, I. M. (2000). Characterizationof a cysteine protease eDNA from Lolium multiflorum leaves and its expression duringsenescence and cytokinin treatment. Biochim Biophys Acta 1492(1): 233-6.
Li, Y., Hagan, G. and Guilfoyle, T. (1992). Altered morphology in transgenic tobacco plants thatoverproduce cytokinins in specific tissues and organs. Developmental Biology 153: 386-395.
Litchtenthaler, H. K. (1987). Chlorophylls and carotenoids: pigments of photosynthetic biomembranes.Methods Enzymol148: 351-382.
Liu, Y., Dammann, C. and Bhattacharyya, M. K. (2001). The matrix metalloproteinase gene GmMMP2 isactivated in response to pathogenic infections in soybean. Plant Physiol127(4): 1788-97.
Lohman, K, Gan, S., John, M. and Amasino, R. (1994). Molecular analysis of natural leaf senescence inArabidopsis thaliana. Physiologia Platarum 92: 322-328.
Matile, P. (1992). Chloroplast Senescence. Crop photosynthesis spatial and temporal determinants. N.Baker and H. Thomas. Amsterdam, Elsevier: 413-440.
McCabe, M., Garratt, L., Schepers, F., lordi, W., Stoopen, G., Davelarr, E., Van Rhijn, J., Power, J. andDavey, M. (2001). Effects of Psag12-IPT gene expression on development and senescence intransgenic lettuce. Plant Physiology 127: 505-516.
McCabe, M., Mohapatra, D., Schepers, F., van Dun, K, Power, J. and Davey, M. (1998). Delayedsenescence in transgenic lettuce using an autoregulated ipt gene. Journal ofExperimental BotanySuppl(49): 49.
Mellman, I. (1996). Membranes and sorting. Curr Opin Cell Bioi 8(4): 497-8.
Meyer, R. c., Jr., Goldsbrough, P. B. and Woodson, W. R. (1991). An ethylene-responsive flowersenescence~related gene from carnation encodes a protein homologous to gJutathione S·transferases. Plant Mol Bioi 17(2): 277-81.
Mitsuhashi, W. and Feller, D. (1992). Effects of light and external solutes on the catabolism of nuclearencoded stromal proteins in intact chloroplasts isolated from pea leaves. Plant Physiol100: 21002105.
Molyneaux, P. and Frank, H. P. (1961). The interaction of polyvinylpyrrolidone with aromatic compoundsin aqueous solution. Part 1. Thermodynamics of the binding equilibria and interaction forces. JAmer Chem 83: 3169-3171.
Morita, K (1980). Release of nitrogen from chloroplasts during leaf senescence in rice (Oryza sativa L.).Annals ofbotany. 46: 297-302.
Morita, N., Nakazato, H., Okuyama, H., Kim, Y. and Thompson, G. A, Jr. (1996). Evidence for aglycosylinositolphospholipid-anchored alkaline phosphatase in the aquatic plant Spirodelao!igorrhiza. Biochim Biophys Acta 1290(1): 53-62.
101
Murray, M. G. and Thompson, W. F. (1980). Rapid isolation of high molecular weight plant DNA. NucleicAcids Res 8(19): 4321-5.
Nguyen, K., Kane, E. and Dix, P. (1998). Hormonal regulation of senescence in cauliflower. Plantbiotechnology and In vitro biology 21st Century, IX International Congress Plant Tissue Culture,Dordrecht, The Netherlands, Kluwer Academic Publishers.
Nielsen, H., Engelbrecht, J., Bruna!<, S. and von Heijne, G. (1997). Identification of prokaryotic andeukaryotic signal peptides and prediction of their cleavage sites. Protein Eng 10(1): 1-6.
Noh, Y. and Amasino, R. (1999a). Identification of a promoter region responsible for the senescencespecific expression of SAGI2. Piant Molecuiar Biology 41: 181-194.
Noh, Y. S. and Amasino, R. M. (1999b). Regulation of developmental senescence is conserved betweenATabidopsis and Brassica napus. Plant Mol Bioi 41(2): 195-206.
Nooden, L., Guiamet, I. and John, M. (1997). Senescence Mechanisms. Plam Physiology 101: 746-753.
Oh, S. A., Lee, S. Y., Chung, I. K., Lee, C. H. and Nam, H. G. (1996). A senescence-associated gene ofATabidopsis thaliana is distinctively regulated during natural and artificially induced leafsenescence. Plant Mol Bioi 30(4): 739-54.
Okazawa, K., Sato, Y., Nakagawa, T., Asada, K., Kato, I., Tomita, E. and Nishitani, K. (1993). Molecularcloning and eDNA sequencing of endoxyloglucan transferase, a novel class of glycosyltransferasethat mediates molecular grafting between matrix polysaccharides in plant cell walls. J Bioi Chern268(34): 25364-8.
Panavas, T., Pikula, A., Reid, P., Rubinstein, B. and Walker, E. (1999). Identification of senescenceassociated genes from daylily petals. Plant Mol Bioi 40: 237-248.
Park, J. H., Oh, S. A., Kim, Y. H., Woo, H. R. and Nam, H. G. (1998). Differential expression ofsenescence-associated mRNAs during leaf senescence induced by different senescence-inducingfactors in ATabidopsis. Plant Mol 8ioI37(3): 445-54.
Paul, M. J. and Driscoll, S. P. (1997). Sugar repression of photosynthesis: the role of carbohydrates insignaling nitrogen deficiency through source: sink imbalance. Plant Cell Environ 20: 110-116.
Paull, R. and Chantrachit, T. (2001). Benzyladenine and the vase life of tropical ornamentals. PostharvestBiology and Technology 21: 303-310.
Paull, R., Chen, N. and Deputy, J. (1985). Physiological changes associated with senescence of cutanthurium flowers. Journal ofAmerican Society ofHorticultural Science 110(2): 156·162.
Paull, R. and Goo, T. (1982). Pulse treatment with silver nitrate extends vase life of anthuriums. Journal ofAmerican Society ofHorticultural Science 110(1): 842-844.
Picton, S., Gray, J., Barton, S., AbuBakar, U., Lowe, A. and Grierson, D. (1993). eDNA cloning andcharacterization of novel ripening-related mRNAs with altered patterns of accumulation in theripening inhibitor (rin) tomato ripening mutant. Plam Mol Bioi 23(1): 193-207.
Quirino, B. F., Noh, Y. S., Himelblau, E. and Amasino, R. M. (2000). Molecular aspects of leafsenescence. Trends Plant Sci 5(7): 278-82.
102
Rapp, J. C, Baumgartner, B. J. and Mullet, J. (1992). Quantitative analysis of transcription and RNA levelsof 15 barley chloroplast genes. Transcription rates and mRNA levels vary over 300- fold;predicted mRNA stabilities vary 30-fold.] Bioi Chern 267(30): 21404-11.
Rechsteiner, M. (1991). Natural substrates of the ubiquitin proteolytic pathway. Ce1l66(4): 615-618.
Roberts, D., Walker, M., Thompson, J. and Dumbroff, E. (1983). The effects of inhibitors of polyamine andethylene biosynthesis on senescence, ethylene production, and polyamine levels in cut carnations.Plant Cell Physiol25: 315-322.
Rousseaux, M. C, Ballare, C. L., Jordan, E. T. and Vierstra, R. D. (1997). Directed overexpression ofPHYA locally suppresses stem elongation and leaf senescence responses to far-red radiation. PlantCell Enl'iron 20: 1551-1558.
Rousseaux, M. C, Hall, H. J. and Sanchez, R. A. (1996). Far-red enrichment and photosynthetically activeradiation level influence leaf senescence in field-grown sunflower. Physiol Plant 96: 217-224.
Salzman, R. A., Fujita, T., Zhu-Salzman, K., Hasegawa, P. M. and Bressan, R. A. (1999). An improvedRNA isolation method for plant tissues containing high levels of phenolic compounds orcarbohydrates. Plant Mol Bioi Rep 17: 11-17.
Sambrook, J., Fritsch, E. and Maniatis, T. (1989). Molecular Cloning: A Laboratory Manual, Ed. 2. ColdSpring Harbor, NY, Cold Spring Harbor Laboratory Press.
Sancher, J. (1973). Senescence and postharvest physiology. Annu ReI' Plant Physiol24: 197-224.
Sandoval, I. and Bakke, O. (1994). Targeting of membrane proteins to endosomes and lysosomes. TrendsCell Bioi 4: 292-297.
Sanenger, W. (1984). Principles ofNucleic Structure. New York, Springer-Verlag.
Schenk, P., Elliott, A. and Manners, J. (1998). Assessment of transient gene expression in plant tissuesusing the green fluorescent protein as a reference. Plant Mol Bioi Rep 16: 313-322.
Schneiderbauer, A., Sanderman, H. and Ernst, D. (1991). Isolation of functional RNA from plant tissuesrich in phenolic compounds.AnalyticalBiochernistry 197: 91-95.
Sexton, R. and Woolhouse, H. (1984). Senescence and Abscission. Plant Physiol. M. Wilkins. London,Pitman Press: 469-497.
Sheen, J. (1990). Metabolic repression of transcription in higher plants. Plant Cell 2(10): 1027-38.
Sheng, J., D'Ovidio, R. and Mehdy, M. C (1991). Negative and positive regulation of a novel proline-richprotein mRNA by fungal elicitor and wounding. Plant] 1(3): 345-54.
Sherrier, D. J., Prime, T. A. and Dupree, P. (1999). Glycosylphosphatidylinositol-anchored cell-surfaceproteins from Arabidopsis.Electrophoresis 20(10): 2027-35.
Simpson, R. and Dalling, M. (1981). Natural substrates of the ubiquitin proteolytic pathway. Planta 151:447-456.
Smart, C. (1994). Gene expression during leaf senescence. New Phytology 126: 419-448.
103
Smart, c., Hsken, S., Thomas, H., Greaves, J., Blair, B. and Schuch, W. (1995). The timing of maize leafsenescence and characterization of senescence-related cDNAs. Physiol Plant 93: 673-682.
Sticher, L., Hofsteenge, J., Milani, A., Neuhaus, J. M. and Meins, F., Jr. (1992). Vacuolar chitinases oftobacco: a new class of hydroxyproline- containing proteins. Science 257(5070): 655-7.
Stitt, M., Von Schaewen, A. and Willmitzer, L. (1990). "Sink" regulation of photosynthetic metabolism intransgenic tobacco plants expressing yeast invertase in their cell wall involves a decrease of theCalvin-cycle enzymes and an increase of glycolytic enzymes. Planta 183: 40-50.
Teramoto, H., Tomoko, T., Takeba, G. and Tsuji, H. (1995). Changes in expression of two cytokininrepressed genes, CR9 and CR20, in relation to aging, greening and wounding in cucumber. Planta196: 387-395.
Tetley, R. and Thimann, K. (1974). The metabolism of oat leaves during senescence. Respiration,carbohydrate metabolism and the action of cytokinins. Plant Physiol54: 294-303.
Thimann, K. (1980). Leaf Senescence. Senescence in Plants. K. Thimann. Boca Raton, FL, CRC press: 85115.
Thompson, W. and Platt-Aloia, K. (1980). Leaf Senescence. Annu Rev Plant Physiol31: 83-111.
Tucker, D. J. (1981). Phytochrome regulation of leaf senescence in cucumber and tomato. Plant Sci Lell23(103-108).
Ueda, J. and Kato, J. (1981). Promotive effect of methyl jasmonate on oat leaf senescence in light.Zeitschrift fur Pflanzenphysiologie 103: 357-359.
Vatpuesta, V., Lange, C., Guerrero, C. and Reid, M. (1995). Up-regulation of a cysteine proteaseaccompanies the ethylene-insensitive senescence of daylily (Hemerocallis) flowers. PlantMolecular Biology 28: 575-582.
Van Staden, J., E. Cook, LD Nooden (1988). Cytokinins and senescence. Senescence and Aging in Plants.L. Nooden and A. C. Leopold. London, Academic Press: 281-328.
Vick, B. A., D. C. Zimmerman (1983). The biosynthesis of jasmonic acid: a physiological role for plantlipoxygenase. Biochem Biophys Res Commun 111(2): 470-477.
Von Schaewen, A., Stitt, M., Schmidt, R., Sonnewald, U. and Willmitzer, L. (1990). Expression of a yeastderived invertase in the cell wall of tobacco and Arabidopsis plants leads to accumulation ofcarbohydrate and inhibition of photosynthesis and strongly influences growth and phenotype oftransgenic tobacco plants. EmhoJ 9(10): 3033-44.
Wang, H., Brandt, A. S. and Woodson, W. R. (1993). A flower senescence-related mRNA from carnationencodes a novel protein related to enzymes involved in phosphonate biosynthesis. Plant Mol Bioi22(4): 719-24.
Wang, N. N., Yang, S. F. and Charng, Y. (2001). Differential expression of I-aminocyclopropane-Icarboxylate synthase genes during orchid flower senescence induced by the protein phosphataseinhihitor okadaic acid. Plant PhysioI126(1): 253-60.
Watanabe, A. and Imasek, H. (1982). Changes in translatable mRNA in senescing wheat leaves. Plant CellPhysiol23: 489-497.
104
Watanabe, H., Abe, K., Emori, Y., Hosoyama, H. and Arai, S. (1991). Molecular cloning and gibberellininduced expression of multiple cysteine proteinases of rice seeds (oryzains). J Bioi Chern 266(25):16897-902.
Weaver, L., Himelblau, E. and Amasino, R. (2001). Senescence is induced in individually darkenedArabidopsis leaves, but inhibited in whole darkened plants. Plant Physiology 127(876-886).
Weaver, L. M., Gan, S., Quirino, B. and Amasino, R. M. (1998). A comparison of the expression patternsof several senescence- associated genes in response to stress and hormone treatment. Plant MolBioi 37(3): 455-69.
Woo, H., Chung, K., Park, J., Oh, S., Abn, T., Hong, S., Jang, S. and Nam, H. (2001). ORE9, an F-boxprotein that regulates leaf senescence in Arabidopsis. Plant Cell 13: 1779-1790.
Xu, F. X. and Chye, M. L. (1999). Expression of cysteine proteinase during developmental eventsassociated with programmed cell death in brinjal. PlantJ 17(3): 321-7.
Xu, W., Campbell, P., Vargheese, A. K. and Braam, J. (1996). The Arabidopsis XET-related gene family:environmental and hormonal regulation of expression. PlantJ 9(6): 879-89.
Yamada, T., Ohta, H., Shinohara, A., Iwamatsu, A., Shimada, H., Tsuchiya, T., Masuda, T. and Takamiya,K. (2000). A cysteine protease from maize isolated in a complex with cystatin. Plant Cell Physiol41(2): 185-91.
Yang, Q. and Z., G. (2002). Purification and Characterization of an Ethylene-Induced Antifungal Proteinfrom Leaves of Guilder Rose (Hydrangea macrophylla). Protein Expr Purif24(1): 76-82.
Yang, T. and Poovaiah, B. W. (2000). An early ethylene up-regulated gene encoding a calmodulin-bindingprotein involved in plant senescence and death. J Bioi Chern 275(49): 38467-73.
Yoshida, S., Ito, M., Nishida, 1. and Watanabe, A. (2001). Isolation and RNA gel blot analysis of genes thatcould serve as potential molecular markers for leaf senescence in Arabidopsis thaliana. Plant Celland Physiology 42: 170-178.
Youl, J. J., Bacic, A. and Oxley, D. (1998). Arabinogalactan-proteins from Nicotiana alata and Pyruscommunis contain glycosylphosphatidylinositol membrane anchors. Proc Natl Acad Sci USA95(14): 7921-6.
105