April Bloomington Healthy Cells 2011

April 2011 FREE

HealthyCellsM A G A Z I N Ewww.healthycellsmagazine.com

areaPromotingHealthier Living in Your Community • Physical • Emotional • Nutritional

BLOOMINGTON/NORMAL

TM

Dr. Jeffrey Poulter and Dr. Paige HoltA Higher Level of Carepage 20

Hip Replacement Recovery Made Easierpage 23

No More“Bad Hair” Days page 16

Self ControlWould You Eat the Cookie? page 12

B L O O M I N G T O N | N O R M A L | P O N T I A C | D E C A T U R | C H I C A G O

1015 S. Mercer Ave. Bloomington, IL 61701

(309) 662-4321www.millenniumpaincenter.com

ACCEPTING ALL INSURANCES AND SELF-REFERRALS

Helping You Get Back to the Things You Love

April 2011 — Bloomington — Healthy Cells Magazine — Page 3

This Month’s Cover Story:Volume 6, Issue 4

6

8

10

12

14

16

18

23

24

26

29

30

32

34

37

40

42

44

48

Healthy Kids: 10 Helpful Tips for Picky Eaters

Healthy Habits: Habit Changing with Hypnotherapy

Physical: CT Lung Screening Can Reduce Lung Cancer Mortality

Emotional: Self-Control—Would You Eat the Cookie?

Nutritional: Intestinal Health 101 For a Healthier 2011

Keratin Treatment: No More “Bad Hair” Days

Environmental Health: Are You Getting Too Much BPA?

Orthopedic Surgery Advancements: Anterior Approach Hip Replacement

Back in the News: Talk, Talk, Talk…Is My Cell Phone Really Hurting My Brain?

Community Service: The Links

Diabetes Management: Have Questions? Get Answers.

Noise Induced Hearing Loss: International Noise Awareness Day

Chronic Pain Management: A Multi-disciplinary Approach

Healthy Feet: Does the Changing of the Seasons Mean More Pain in the Toes?

Healthy Finance: What Is a Roth IRA?

Timber Pointe Outdoor Center: Hidden Jewel in Central Illinois

Healthy Skin: Vitamin K

Paleo Diet: Hormonal Response of Our Body to Food, Part 2

Holistic Treatments: Nutritional Alternatives for ADD/ADHD

APRIL

Mission: The objective of Healthy Cells Magazine is to promote a stronger health-conscious community by means of offering education and support through the cooperative efforts among esteemed health and fitness professionals in the greater Bloomington-Normal area.

Healthy Cells Magazine is intended to heighten awareness of health and fitness information and does not suggest diagnosis or treatment. This information is not a substitute for medical attention. See your healthcare professional for medical advice and treatment. The opinions, statements, and claims expressed by the columnists, advertisers, and contributors to Healthy Cells Magazine are not necessarily those of the editors or publisher.

Healthy Cells Magazine is available FREE at over 450 locations, including major grocery stores throughout the Bloomington-Normal area as well as hospitals, physicians’ offices, pharmacies, and health clubs. Healthy Cells Magazine welcomes contributions pertaining to healthier living in the Bloomington-Normal area. Limelight Communications, Inc. assumes no responsibility for their publication or return.

Healthy Cells Magazine is a division of:

1711 W. Detweiller Dr., Peoria, IL 61615 Ph: 309-681-4418 Fax: [email protected]

For information about this publication, contact Cheryl Eash, owner, at 309-664-2524, [email protected]

2011

“I wish to thank all of the advertisers who make this magazine possible. They believe enough in providing positive health information to the public that they are willing to pay for it so you won’t have to.”

Cheryl Eash

Dr. Jeffrey Poulter and Dr. Paige Holt:

A Higher Level of Care page 20


Page 6 — Healthy Cells Magazine — Bloomington — April 2011

10 Helpful Tips for Picky

EatersBy Julaine Ingersoll, Chef, Katie’s Kids II

healthy kids

Many parents are concerned about the eating habits of their young children. They worry about their child getting proper nutrition when it seems as if the only thing they will eat is maca-

roni and cheese. We all know that force feeding a young child is not the answer! From my experience as a chef, who prepares meals and snacks everyday for young children, I offer you ten helpful hints to help encourage your child to eat a wider variety of foods at home.

1. Make meal preparation fun and exciting for you and your child. Take your child grocery shopping with you and let your child help choose some of the vegetables and fruits. When you get home, pull a stool up to the sink and let them wash the fruit and veg-etables. Children can help prepare the meal by tearing the lettuce for a salad; putting cheese on sandwiches, or buttering the toast

or bread. It has been my experience with my children and grand-children that they will eat what they help make.

2. Be patient when trying new food. It takes time to learn new habits. Studies have shown it usually takes people at least 9 times before they can really decide if they like something. When trying a new food, make sure the rest of the family is eating it too. Children learn by example. At Katie’s Kids, children often start eating a food when they see the other children and teachers eating. We try to talk about the color, texture, smell, and the taste. Chances are that if you enjoy something, your child will likely eat it too.

3. Try new foods yourself. Treat it like an adventure. A few months ago, I found the fruit called a dragon fruit. It was such a beautiful


color of a reddish pink with tentacles – it looked just like a dragon’s head. I gave it to my youngest granddaughter, who is a very picky eater. The cut fruit was just a beautiful light gray with tiny little black seeds, like strawberry seeds. The texture was like a kiwi and the taste and smell was very sweet. We had fun learning about a new food together.

4. Minimize distractions. Several teachers at the day care turn the light down low, put on soft music and pretend with the children they are in a nice restaurant. There should be no TV, phones, games, books or DS to distract from the meal. Meal time should be only about the family and the food

5. Respect your child’s appetite or lack of it. Young children will eat when they are hungry. Never force your child to eat. Don’t bribe. Please don’t make them a member of the clean plate club. This can only lead to problems down the road. Most children get plenty of variety and nutrition throughout the week. One hint: nix the sodas, milk, juice and other snacks at least an hour before dinner time; offer water if they need a drink.

6. Try to have a set meal time and stick to it. This is not always easy to do every day, but try as often as you can. You and your children will get used to having meals at the same time every day. You may notice that you and your children look forward to sitting down together and everyone will be hungry and ready to eat.

7. Don’t become a short order cook. Prepare one meal for everyone. Don’t give your children the choice of a PBJ or what you have

healthy kids

cooked. Keep serving good healthy meal choices and they will get used to it. Just remember it takes time for habits to change.

8. Don’t let your child eat for at least one hour after dinner. This way they get the hint that there will be nothing but what is on the table. Otherwise they may learn if they don’t eat now, they can still have a cookie or other snack in 5 or 10 minutes.

9. Be sneaky. Chop or grate vegetables to put in other dishes. For example, add broccoli into macaroni and cheese, or carrot, celery, and bell peppers in spaghetti sauce or chili. For breakfast, cut fresh fruit onto cereal, stir applesauce into pancake batter or slice bananas in oat meal.

10. Don’t offer dessert as a reward. Dessert is a treat to be enjoyed by everyone. Most days offer things like sliced apples, pears, a fruit salad, or yogurt for dessert. Make a family tradition to have one night as a special dessert night. This will give your family a memory and they will learn to make healthy choices.

Above all, don’t worry! Learn to enjoy and relax at meal time. Let your child fix his own plate and keep serving good healthy meals. Your children will learn to like different foods and will be on the path to a life of good nutrition.

Formoreinformation,youmaycontactMaureenKellyatKatie’sKidsLearningCenter,[email protected]. Theyhave two locations, 1602GlenbridgeRd. inBloomington and2003JacobssenDr.inNormalwhichoffersapart-daypreschooloption.


healthy habits

Habit Changing with HypnotherapyBy Rick Longstreth, CH, AHHH Hypnotherapy

You know you shouldn’t. You made a decision that you weren’t going to do it anymore. You know it’s the right thing for you, and your life will be much better for it. But you continue to do it anyhow. The whole time, telling yourself that it’s okay because this will be the last time. You’ll only do it this one last time and then you’ll quit. After all, it will be easier to quit tomorrow than today.

What is a habit? The simple answer is, almost everything we do is a habit. We walk, we talk, we drive, we work, we even eat and drink. All are habits. These are all examples of habits that are relatively good in moderation. Then we have habits that are mostly negative. Over eating and smoking are two of the most common negative habits people often think about. But what about poor sleeping habits, poor exercise habits, negative attitude habits? There are thousands of positive and negative habits that people do everyday that affect their daily life and health. How can hypnosis help change negative habits? Habits aren’t really controlled by the conscious mind. The powerful and compelling emotions and cravings that drive people toward negative behaviors come from the subconscious mind. And if that’s not bad enough, the subconscious mind


won’t listen to reason - it’s not capable of it. You can’t rationalize with it or persuade it. The subconscious mind is driven and controlled by emotions and feelings. Through hypnotherapy, we can communicate with the subconscious mind, without the conscious mind getting in the way. Then we can use powerful images, desires and intense emotions to persuade the subconscious mind to change. The most crucial step is the hypnotic state. The most powerful images, emotions and desires are useless without the hypnotic state because they can’t get past the conscious mind. The conscious mind acts like a filter and will keep the images, desires and emotions from getting to the subconscious mind. This is why hypnosis has been proven to work so very well for changing habits. Does it work for everyone? The answer is no, because deep down not everyone really wants to change negative habits. Maybe a spouse or employer is pushing them to change. A person may be very convincing when they say they want to quit smoking, but deep down they may feel like they are losing their best friend, so they don’t quit. They may not even realize this on a conscious level. Let’s say two people want to quit smoking. The first wants to quit because “she” is tired of paying so much money for the cigarettes, and the other wants to quit because it’s affecting the health of her children. The second person has a much higher chance of quitting because she is emotionally driven. In a 1992 meta-analysis from the University of Iowa totaling almost 72,000 people, hypnosis was the second most successful way to quit smoking, second only to a heart attack. Hypnosis was more successful than all other forms of smoking cessation It is also very important to be able to “see” yourself after that bad habit is changed. If you can’t imagine yourself achieving your goal, how can

you achieve it? Albert Einstein once said, “Imagination is more important then knowledge”. Think of your body as a robot and your mind as the computer. You are in control! If you’re not, who or what is? The following quote is from an anonymous writer. I hope it touches you, and makes you realize that you are in control of you.

“Iamyourconstantcompanion.Iamyourgreatesthelperorheaviestburden.Iwillpushyouonwardordragyoudowntofailure.Iamcom-pletelyatyourcommand.Mostofthethingsyoudoyoumightjustaswellturnovertome,andIwilldothemquicklyandcorrectly. Iameasilymanaged—youmustmerelybefirmwithme.Showmeexactlyhowyouwantsomethingdone,andafterafewlessonsIwilldoitautomatically.Iamtheservantofallgreatpeople;andalas,ofallfailures,aswell.Thosewhoaregreat,Ihavemadegreat.Thosewhoarefailures,Ihavemadefailures. Iamnotamachine,thoughIworkwithalltheprecisionofamachineplustheIntelligenceofahumanbeing.Youmayrunmeforprofitorturnmeforruin–itmakesnodifferencetome.Takeme,trainme,befirmwithme,andIwillplacetheworldatyourfeet.BeeasywithmeandIwilldestroyyou.”

Who am I? I am a HABIT. What habits do you need to change, and how long are you going to let them control your life?

For more information on how hypnosis can help you quitsmoking,loseweight,orchangenegativehabits,pleasecontactRickLongstreth,CertifiedHypnotherapistat309-261-2564oronthewebatAhhh-hypnotherapy.com.

Discover the difference at Lincoln College – NormalOffering fully accredited degree and professional certificate programs in:

• Business Management• Criminal Justice• Liberal Arts

• Supply Chain & Logistics Management• Sport Management• Massage Therapy and more!

Visit us online at lincolncollege.edu/normal or call 800.569.0558 today!Lincoln College - Normal715 W. Raab Rd. • Normal, IL 61761


physical

CT Lung Screening Can Reduce Lung Cancer Mortality

By Naveed Yousuf, M.D., Medical Director and Janet Hawkins, Administrator, Fort Jesse Imaging Center

CT (computed tomography) lung screening is a noninvasive, painless procedure that uses low-dose x-

rays to screen the lungs for cancer in just a few minutes. The screening CT lung scan allows the radiologist to look at different lev-els, or slices, of the lungs using a rotating X-ray beam. It is performed on a multi-slice spiral computed tomography scanner and can detect smaller nodules or cancer than standard chest X-rays. A tumor or nodule is a mass of extra cells that grows in the lungs. It can be benign (noncancerous) or malignant (cancerous). By detecting malig-nant tumors at an early stage with CT lung screening, intervention can occur at a time when the cancer is still curable and localized to the lungs.

Why is Lung Screening Important? Lung cancer is the number one cause of cancer-related deaths in the United States. This disease will claim 157,000 lives this year alone, more than breast, prostate, and colorectal cancers combined. In the United States, the lifetime risk of developing inva-sive lung cancer is 1 in 17 for men and 1 in 18 for women. Most patients discover the cancer too late for treatment, and 85% die from it. It is estimated that over 80% of lung cancers could be cured if detected at an early stage. Unfortunately, only 15% of lung cancers are caught at this stage, making the 5-year survival rate for all stages of lung cancer 20%. Diagnosing lung cancer in an early stage while it is still localized to the lungs is essential. A person’s chance of survival decreases when the tumor grows to be 3 cm or more. If the cancer spreads to areas of the body outside the lungs, the survival rate is only 3%, compared with 48% if the cancer is just in the lungs. CT lung screening is extremely capable of detecting lung nodules as small as 2 or 3 cm. By catching malignant tumors when they are still small, they can be surgically removed before disease spreads to other areas of the body.


Who Should Have Lung Screening? Lung screening is recommended for individuals between ages 50 and 80 who have any of the following risk factors:

• History of lung cancer • 10 pack, year or more smoking history (1 pack of cigarettes per day

for 10 years, 2 packs of cigarettes per day for 5 years, etc.) • Past history of smoking (less than 10 years ago) • Repeated exposure to secondhand smoke • Exposure to other cancer-causing agents (e.g., asbestos and radon)

Follow-up screening is recommended every 1 to 2 years for patients who remain at high risk. It is important for patients to be aware that having a negative scan (no nodules or cancer) does not mean that lung cancer will not develop in the future if they remain at high risk for the disease.

How Accurate is Lung Screening? Recent studies show that CT lung screening is more sensitive than standard lung screening methods (i.e., chest x-ray, sputum cytology) in detecting lung cancer. A recent trial sponsored by the National Cancer Institute and conducted by the American College of Radiology studied 53,000 high risk patients at 33 institutions across the United States, showed a 20% reduction in mortality from lung cancer using CT lung screening. These findings represent an enormous advance in cancer detection that could potentially save thousands of lives annually. Several lung cancer screening studies performed using conventional chest X-rays in the 1970s, failed to show any reduction in mortality from lung cancer. Unlike standard chest X-rays, CT lung screening

takes cross-sectional images of the lungs. This allows the radiologist to see the lungs from top to bottom. Chest X-rays only show views of the lungs from the front and sides. With 3D imaging, CT lung screening can measure the growth of tumors in all directions whereas standard X-rays can only measure tumors at their widest point, preventing the radiologist from tracking changes in the volume of the tumor. The National Lung screening trial also found that low dose CT lung scan also gives useful information on cardiovascular disease, emphy-sema and other pulmonary diseases, three other major killers of older individuals.

How is CT Lung Screening Performed? During the exam, patients lie on their backs on an exam table with arms above the head. They hold their breath briefly as the pictures are being taken. The scanner may cover their body for a short period of time, however the scanner is open at the back and front so that the patient can see out. The technologist is always able to see and hear the patient during the 15-minute-procedure. CT Lung Screening in-volves exposure to radiation in the form of x-rays, but the benefit of an accurate diagnosis far outweighs the risk. The effective radiation dose from this procedure is about 10 mSv, which is about the same as the average person receives from background radiation in three years.

Formore informationor toscheduleanappointment,pleasecallFt.JesseImagingCenterat(309-454-5552).ADoctor’sreferralisre-quired.Mostinsurancecompaniesdonotcoverscreeningprocedures.ThepriceforaCTLungScreeningis$300tobepaidatthetimeofservice.PatientswillbeprovidedadigitalcopyoftheCTscanonaCDandresultswillbepromptlycommunicatedtothepatient’sphysician.

Senior ExpoIndependence with a Quality Lifestyle

For more information, e-mail [email protected]

FREE• Admission • Parking • Bingo

sponsored by Alpha Care • Coffee & Donuts • Chair Massages • Blood Pressure

Screening • Seminars • Prizes, prizes, prizes

From Exercise to Remodeling, Health Services to Cleaning Services, Home

Care to Lawn Care, Be Content at Home has them all and many more.

A Central Illinois

Sponsored by: Nordine Remodeling, LLCHome of “NordineCare”

Free Seminars starting at 9:30 am

Invest in Your HealthDr. Uday L. Deoskar, M.D.

Living at Home Longer with “NordineCare”Brian Naber

Staying Active as We AgeNormal Township Senior’s Program

The Importance of life Long Learning Heartland College

MondayMay 2nd, 2011

9:00 am -- 3:00 pm

Parke Hotel & Conference Center1413 Leslie Drive

Bloomington, IL. 61704

emotional

Imagine you are four years old and your parents bring you to a strange place. Then your mother says, “Okay, go with this nice person and I will be right here when you are done. You are

escorted to a boring white room with no windows, a table, and a chair. The person then asks you to sit, hands you a cookie, and says, “If you wait to eat this cookie and show it to me when I come back, I will give you another cookie.” The person then leaves the room and the child is left with a decision. What do you think the child might do? What do you think you would have done when you were a child? Would you have eaten the cookie as fast as Cookie Monster from Sesame Street or would you be more like Bert and delay the pleasure of eat-ing the cookie so that you could have two cookies later? How would you face this challenge as an adult? Interestingly, we find ourselves in similar situations all of the time. For example, think of the last time you were planning to do something but you lost interest in the task because it took too long or you ended up not attaining the goal because there were too many steps to take before there was a sense of gratification (e.g. losing weight through exercising, eating a whole food healthy meal, or completing a complex task at work). Situations like these test our resolve, teach us how disciplined we may or may not be, and de-termine our ability to delay gratification. How did we learn to get better self control and how we can we teach this to our children who, like Cookie Monster, may have difficulty delaying gratification for a later reward? A recent study evaluated the development of impulse control in children and its relationship with their future success. Children who acted more like Bert rather than Cookie Monster were found to be more suc-cessful as adolescents. Using the “Cookie Scenario” described above the researchers measured self-control (whether the child ate the cookie before the person returned) and examined these same preschoolers ten years later. Curi-ously, the ado-lescents who

Self-Control: Would You Eat the Cookie?

By Tom Slattery, Psy.D., Child and Family Wellness Institute


emotional

had waited to eat the cookie and used some strategy to increase self-control were found to have better self-control skills (as ado-lescents) and be rated by their parents to be more attentive, or-ganized, focused, and intelligent. Furthermore, these adolescents were found to be more successful in academic achievement and to have better coping skills in times of frustration or stress. But not all children develop impulse control as readily as other children. So the question is: Can we teach impulse control to children for whom it doesn’t come naturally?” The answer is: Yes! We can teach children how to have bet-ter self control. Children can be taught to pause between wanting something now and acting on the impulse by thinking about options and consequences rather than impulsively acting without thinking. They can learn that waiting for a reward may bring them an even bigger reward in the future (two cookies!). They can also learn that they feel better when they learn to be in control of themselves. Learning to have better impulse control often takes effortful prac-tice; through regular practice of small acts of managing feelings, urges, and thoughts. And this increase in self-control will help them with many different situations. In fact, children who are taught bet-ter impulse control tend to worry less, feel less sadness/irritability, have fewer behavioral problems, are viewed more positively so-cially, and have better academic success. While parents play a role in teaching children to have better im-pulse control, occasionally children have particular difficulty in this area due to conditions that they may be experiencing. Specifically, children with anxiety, ADHD, behavioral disorders and/or OCD, for example, may have particular difficulty mastering this skill. When

this happens, no one is to blame - not the parent, not the child, and not the cookie. In these cases, specialized resources may be needed to improve impulse control through the child’s pediatrician, a psychologist trained in working with children, or resources from the school. Comprehensive neuropsychological or psychological evaluation and guided therapeutic treatment can often identify the cause of the delay in obtaining this skill; identify related behavioral, social, emotional or academic concerns; and find techniques to improve the child’s functioning both at home and school. We are then able to create a treatment plan in conjunction with parents, pediatri-cians, and teachers that help the child to build better self-control, so they too can live a life full of success. They learn that they can control their impulses and still eat the cookie.

FormoreinformationyoumaycontacttheChildandFamilyWell-ness Institute, adivisionofPsychologySpecialists, at 309-310-4636or online atwww.childandfamilywellnessinstitute.com.TheChildandFamilyWellnessInstituteprovidesservicestohelppeopleandfamilieswithalltypesofbehavioralandemotionalchallenges.Theyprovideservices,includingneuropsychologicaltesting,coun-seling,andconsultation, tohelpchildren,adolescentsandtheirfamilieswithdifficulties,suchas impulsivebehaviors, thatcausedistressathomeorschool.

Dr.TomSlatteryisapost-doctoralpsychologyresident.Referencesusedforthisarticleareavailableuponrequest.

THE EXPERIENCED PROFESSIONALS at Central I l l ino is OrthopedicSurgery del iver excel lence in a wide var iety of orthopedic proceduresand rehabi l i tat ion t reatments . Our goal i s to have you back towork, out on the play ing f ie ld, or just enjoy ing l i fe again in min imumtime with maximum resul ts !

• Jo int repai r/ replacement• Sports medicine• Work- re lated in jur ies• General or thopedic t reatment & surgery

Central Illinois Orthopedic Surgery. L.L.C.1505 East land Dr ive, Su i te 220 • B loomington, IL 61701 309-662-2278

www.ciosortho.com

Lawrence A. Nord, M.D.

Brett L. Keller, D.O.

W E S P E C I A L I Z EI N M I N I M A L LY

I N VA S I V EK N E E A N D H I PR E P L A C E M E N T

S U R G E R Y.

The O r t h o p e d i c S p e c i a l i s t s


How many times have you heard some-one discussing their bowel health and thought they were obsessed with

bowel function? It turns out they were correct to be concerned. Optimal health begins with a healthy gut. Simplistically, your digestive tract is a long open tube and its job is to digest food, then absorb amino acids, vitamins, minerals, etc. to nourish your body all the while keeping bad things like bacteria, parasites, viruses, chemi-cals, and other toxins from entering the body and causing you harm. Your intestines are much more complex and important than this - it’s no wonder that 75-80% of your immune system lines the intestinal tract! The down side of this is that chronic gut inflammation from dysbiosis can begin to suppress your immune system and lead to recurrent illness and other long term conditions from immune system dys-regulation. Your gut is normally inhabited by trillions of “good” bacteria – mostly lactobacillus strains in the small intestine and bifidobacteria strains in the large intestine. These good bacteria help with digestion and absorption of nutrients. They also produce important nutrients and vitamins like Vitamin K, B-1/2/3/6/12, and fo-late, and others, starve out other bad bacteria, literally produce antibiotics that can kill other bacteria, and help recycle bile salts needed to digest fats. Your normal gut flora is established when you start eating after birth as the gut is initially sterile. Breast feeding helps get us off to a good start with the best flora. Kids that are bottle fed already start life with a poorer mix and quality of bacteria, one theory why we have such an obesity epidemic as the bacteria are intimately involved with digestion and ab-sorption of nutrients. Exposure to antibiotics in childhood further drastically changes our normal gut flora making us susceptible to nutritional deficiencies that are felt to underlie some of the neurologic and

nutritional

Intestinal Health 101 For a Healthier

2011By Dr. Tom Rohde,

Renew Total Body Wellness Center


nutritional

psychiatric illnesses that affect our youth. This change to an abnormal gut flora is again called dysbiosis or leaky gut. Symptoms of dysbiosis in babies may be colic – gassiness, constipation, and stomach pains. As we grow, use of birth control pills in adolescence also negatively af-fects our gut flora. Dysbiosis leads to inflammation in the gut which can lead to permeability of the intestinal cells allowing toxins into the body that can literally cause all manner of health problems. By the time we reach early adulthood many of us now suffer with digestive abnormali-ties – heartburn, bloating, belching, and flatulence due to the abnormal digestive process leading to putrefaction and fermentation of food in the colon which allows these toxins to enter the body! These toxins can lead to further maladies: headaches, sleep problems, fatigue issues, asthma, skin conditions like eczema, and abnormal immune system function leading to autoimmune problems like Grave’s or Hashimoto’s thyroid disease. The gut also plays a role in emotional health! The majority of your Serotonin is produced in your gut and is responsible for gut motility and normal function. In the brain it is a major neurotransmitter and ac-counts for your stable mood and ability to deal with stressors, avoid depression and anxiety, and to sleep well! The gut and brain commu-nicate – anyone who has been under stress can verify that – a public presentation or a test, an altercation - all can lead to stomach growling, vomiting, and loose stools! Imagine the effects of long term stress we all seem to live these days….can you say depression, anxiety, inflam-matory bowel, autoimmune problems, perhaps even cancer? The health of our gut flora, and thereby our overall health, is dictated by the foods we eat, the chemicals we ingest and are exposed to, the use of antibiotics to treat other health conditions, even our stress levels.

So what can we do to repair a lot of the conditions mentioned above caused by gut dysbiosis? First, testing to determine the cause of the problems – a metabolic or functional medicine approach – that will guide a targeted rehabilitation program. Then, eliminate abnormal bacteria, parasites, fungi, and gut flora with antibiotics or antifungals if needed, along with natural supplements to help “clean house” to allow a normal flora to rebuild. Dietary change is vital – eliminating irritants such as chemicals and toxins as well as foods that may be causing an allergic response. Gluten seems to be a major problem for many individuals and most individuals are usually unaware of the problems it is causing. Testing is again a good idea. Minimize meats that are harder to digest initially and switch to or-ganic grass fed meats with lower toxins and fat as they are re-intro-duced. Eliminate sugar and minimize carbohydrates as completely as possible initially as many pathogens feed on these sweet good-ies. Next, add in high quality pro-biotics to rebuild a normal gut flora along with supplements to decrease inflammation, soothe and heal an inflamed gut, and help to allow the permeable gut walls to heal and prevent further toxin entrance to the body. Many individuals who have suffered for many years with the chronic conditions I mentioned can start to see benefit from a gut restoration program in as little as a few weeks although some of the ailments may take months to heal, and some that have existed for an extended time may only be moderated or controlled.

Thesooneryoustart,thesooneryouwillreturntoapathofwellbeing–Ahealthygutcanleadtoahealthieryou!PleaseseemyWebsitewww.DrRohde.comformoreinformation,orcall217-864-2700.

• Only 3T MRI scanner in

Bloomington-Normal

• 99% of our patients said

they would recommend

Advanced MRI to a friend

or family

• CLEAREST images in the

FASTEST time

• All scans are read only by

Subspecialty trained

radiologists

• Windows allow natural light in

scanner room to help reduce

incidence of claustrophobia

• Riverscape mural creates

soothing atmosphere

• Enhance relaxation with your

choice of Satellite radio or

bring your own CD

• Private & quiet setting, just

steps from the parking lot to

the scanner


April showers are known to bring May flowers, but for many women (and men) with any type of curly or wavy hair, the wet and humid days of spring also bring uncontrollable frizz and rambunctious locks. Or perhaps your hair doesn’t

require any precipitation to completely unravel, as that is simply its natural state. Re-gardless of the events that lead to your frustrating mane, you can now tame it without the endless use of blow dryers, flat irons, curling irons and chemicals. Treat it to a Brazilian Blowout®. Created where its name suggests, this form of keratin treatment was invented to help manage the curly hair and high humidity combination that Brazilians deal with on a daily basis. The substance keratin is a protein that makes up our hair as well as our nails. The constant abuse that our hair experiences can strip the strands of this natural protein and cause a dull and brittle appearance and feel. However, this 90-minute treatment revives and refreshes hair to bring it back to its soft and shiny self. Here is the general process: after shampooing, the keratin solution is combed through each strand until wet. Then the hair is dried completely and straightened to seal the product in. Lastly, the hair is again washed, dried and straightened. Then you can enjoy the silky-smooth results, especially with the use of certain aftercare products that your stylist will suggest. Considering this type of treatment lasts about three months, you may assume that it is abrasive, though this is not the case. Apply-ing the keratin only replaces the natural element in your hair that has been lost due to persistent use of heat and other chemical products. There are many types of keratin treatments available and there has been some controversy due to the fact that some of them contain formaldehyde. However, the Brazilian Blowout® uses a process that does not require the use of the harsh chemi-cal, so it is completely safe. The other differences are that it doesn’t take nearly as long, does not require an uncomfortable few days of not being able to wash your hair, and is less expensive than other keratin treatments with results still lasting for about 12 weeks. “It was definitely worth it, I would recommend it to anyone,” said Jennifer Haske, a college student and first-time user of the treatment. “My hair has gotten back so much shine and is so much more manageable. Plus, with naturally curly hair it is almost a miracle that it will dry mostly straight and I still have the option to scrunch it and get my curls to bounce back.”

Keratin treatments should only be performed in a professional salon by a stylist who is trained in the proper technique. Make sure to ask questions about the particu-lar brand that is used to be sure you are getting a safe treatment. Instead of cringing every time the wind blows or the humidity rises, try a Brazilian Blowout® and cut your hair routine in half while still looking like you just left the salon. Your hair will continuously surprise you with its newfound ability to dry straight and frizz-free and you can say good-bye to your flat iron.

For more information or to make an appointment, you may contact Fox andHoundsHairStudio&DaySpa,309-829-0482,www.fox-n-hounds.com

No More “Bad Hair” DaysBy Hannah Squibb, Editorial Intern, Illinois Wesleyan University

keratin treatment

Before

After

“ I can’t believe what a relief it is to not fight with my hair every day! It’s been over 3 months, and my hair still looks

as good as the day I walked out of Fox & Hounds”.

- Emily Anderson


Mid-Illinois Hematology & Oncology Associates, LTD.

Our service is based at the Community Cancer Center.Bloomington-Normal with satellite clinics in

Pontiac, Gibson City, Clinton, Eureka, Forrest, Hopedale

309-452-9701407 E. Vernon, Normal, IL 61761

Bloomington-Normal and the surrounding communities deserve the best cancer care. We have continued our mission to provide that care since 1979.

State-of-the-Art Research. Utilization of a research coordinator and national research opportunities for our patients.

Dr. Pramern SriratanaDiplomate in Internal Medicine,

Hematology, Medical Oncology, Hospice & Palliative Medicine

Dr. John MigasDiplomate in

Internal Medicine, Medical Oncology

Dr. Hwan Gon JeongDiplomate in

Internal Medicine, Hematology, Medical Oncology

www.mihoaonline.org

2203 Eastland Dr.

Suite #7

Bloomington, IL 61704

Tel: (309) 808-1700

Fax: (309) 585-2951

•Chronic & Intractable

Headaches•

Fibromyalgia•

Chronic & Acute Neck and Back Pain

•Chronic Regional Pain Syndromeswww.guardianpaininstitute.com

This one-of-a-kind

medical facility will

focus on the diagnosis

and treatment of chronic

headaches and other pain

related conditions with

cutting edge technology

to help you get out and...

Dr. Benjamin Taimoorazy

is proud to announce

the opening of the

Guardian Headache

and Pain Management

Institute.

enjoy the world.


environmental health

Are You Getting Too Much BPA?By Laurine Brown, PhD MPH RD

If you’re like most Americans you’ve likely got some bisphenol A (BPA) cluttering your body. Given our intimate relationship with this tongue-twisting substance, we ought to understand more about its

origins and fate, especially since a growing body of evidence is linking it to serious health risks. What do we know? BPA is an industrial chemical used primarily in hard plastics (like polycarbonate) and epoxy resins. Used since the 1960s, it enhances many common consumer products like baby bottles, microwaveable plastic containers, metal food and beverage can liners, impact resistant safety equipment and medical devices, dental sealants and even cash register receipts. A stunning 93% of Americans recently sampled by the Centers for Disease Control (CDC) were found to have detectable levels of BPA in their urine. It’s even been measured in amniotic fluid and blood of unborn babies and in newborns. This shouldn’t surprise us because we make a lot of this chemical - an estimated 8 million pounds a year – earning its rank among the 2,000 chemicals which we produce in the highest quantities. Such universal exposures concern many scientists in light of mount-ing evidence of harm to human health. BPA is a man-made chemical that is thought to mimic the hormone estrogen. Over 100 peer-reviewed

studies have found disturbing evidence of health problems even at low doses and common exposure levels - breast and prostate cancer, heart disease, diabetes, obesity, miscarriages, reproductive problems, neurological and behavioral problems. BPA may cause “epigenetic” changes, meaning it alters the way genes switch on and off, and genet-ics that can be passed on to the next generation. While the science leaves us with unanswered questions, reduc-ing exposures seems prudent. Extrapolating from European studies, canned food is thought to be the main source of exposure for adults and teenagers, and polycarbonate baby bottles for infants. Groups like Consumers Union, the nonprofit group of Consumer Reports, believe manufacturers and government agencies should eliminate use of BPA in food containers. Interestingly, Japanese manufacturers voluntarily changed their can linings in 1997 due to health concerns, and a 2003 follow-up study found that urine levels of BPA dropped 50%. While US policy makers debate options, taking a few simple precautions may help reduce your individual exposures.

What can you do?• Eat fewer canned foods and drinks. Many can linings are coated with

a protective epoxy resin, and BPA can leach into the food, especially

A New Magazine For the Women of Bloomington-Normal

For All the Shades of YOUFor information, please call Cheryl Eash at 309.664.2524 or email her at [email protected]

Coming Soon


with acidic foods, like tomatoes. Choose fresh or frozen fruits and veg-etables (other perks – more nutrients, less preservatives, and taste better). Cook legumes from scratch (other perks are less sodium and cheaper). Canned soft drinks generally have lower levels than canned foods, but significant levels have still been detected, so choose drinks in glass bottles instead of cans (alternatively, individual plastic beverage bottles like water or soda usually do not contain BPA).

• Avoid polycarbonate plastics (may have #7 recycling code on the bottom) when possible. If you do use them, don’t heat them up. Hand-wash them, since repeated use of dishwashers and harsh de-tergents can cause them to deteriorate and leach more chemicals like BPA. Scratched containers (like Nalgene or baby bottles) have also been found to leach more, so discard these. Choose stainless steel re-usable water bottles or travel mugs (check to be sure they don’t have a plastic liner inside.)

• Don’t heat up plastics. Heating plastics (microwaving or putting hot beverages or food in plastic) speeds leaching of chemicals, like BPA, out of containers into the food or liquid. Interestingly many “micro-wavable” containers are made with polycarbonate plastic (which often contains BPA) because it is very strong and durable. Micro-wave, instead, in glass or porcelain.

• For baby feeding, go bottle-free by breastfeeding when possible. Breastmilk is nutritionally superior to formula and avoids hassles with containers. If bottles are needed, choose BPA free ones which include glass or (as a general rule) soft or cloudy plastic bottles; BPA-containing bottles are usually hard, clear plastic. For more in-formation, see “BPA Info for Parents” at www.hhs.gov/safety/bpa.

• Rinse your mouth well right after getting dental sealants or composite fillings. A small amount of BPA may form in the mouth immediately

after these are applied on teeth. But most experts believe these prod-ucts are invaluable– the benefits greatly outweigh the small risks of BPA exposure. Simple precautions like rinsing the mouth immediately after helps reduce your exposures.

• Be touch-free with receipts and keep them out of recycling stream. The Environmental Working Group found surprisingly high levels of BPA on some thermal papers used for receipts, like from supermar-kets, gas stations, ATMs or airline tickets. Coincidentally, people working in retail industries had 30% more BPA in their bodies than the “average” US adult in CDC studies. BPA is thought to rub off on hands (especially if wet or greasy), and get into the body when the hands go to the mouth. Try to minimize exposures by declining re-ceipts at gas pumps, ATMs, etc., when possible, or using paperless purchases. Store receipts separately in an envelope in wallet/purse. Wash your hands after handling receipts (but avoid alcohol-based cleaners which may enhance BPA absorption through skin.). Finally, don’t recycle thermal paper receipts since BPA will contaminate re-cycled paper.

Laurine Brown is a registered dietitian and Associate Professor of Health and Environmental Studies at Illinois Wesleyan University. This article is reprinted with permission from Illinois Wesleyan Uni-versity’s HealthWise Newsletter. References available at www.iwu.edu/~wellness

Formoreinformationaboutenvironmentalhealthandwellness,at-tendtheIllinoisSustainableLiving&WellnessExpoonSaturday,April9thfrom9–4.TheeventisheldatIWUShirkCenter,302E.EmersoninBloomington.Admissionisfree.

Croft Physical Therapy, Ltd.

• Pelvic Pain or Pressure

• Rectal Pain

• Pain in Bladder Area

• Discomfort When Sitting

• Urinary Frequency

• Sexual Pain

• Incontinence

• Bowel Dysfunction

Pe l v i c F loor Dys func t ion Rehab i l i t a t i on Se r v i ce s

309-452-0704www.pelvicfloorPT.com

If you suffer from any of these symptoms, ask your healthcare provider for a

referral and set up an evaluation today

Exclusively Treating Pelvic Floor Dysfunction

Page 20 — Healthy Cells Magazine

feature story

“It’s about the patient, not just the procedure” Anyone considering plastic surgery has questions. What can I expect? What’s involved in the procedure? What will be my recovery time and where will I spend it? What are the risks? No matter if you’re looking at surgery for reconstructive or cosmetic reasons, it’s a decision that should not be made lightly. Bloomington’s Dr. Jeffrey Poulter, M.D., FACS cares not only about the procedure, but the process of the pa-tient as well. In professional practice since 1992, Dr. Poulter’s impressive resume includes a host of honors, certifications, staff appointments and faculty/research projects. What you won’t see on that resume is the per-sonal side of a physician who has a reputation for giving his patients supe-rior attention and support.

Calling Bloomington home Dr. Poulter’s Midwest roots include graduating with honors from both the University of Illinois and Southern Illi-nois University School of Medicine. It was there he discovered plastic sur-gery. “I got to see some of the incred-ible changes that plastic surgeons were able to make, both in reconstruc-tion and cosmetic procedures,” he ex-plains. “I liked the fact that I was taking care of physically healthy patients who needed revisions or reconstructions.” So how did the Bloomington/Nor-mal area become Dr. Poulter’s place to call home? “Even though I’m from the Midwest, I looked all over the United States after completing my residency, but ultimately settled in Bloomington.” He continues “I’ve raised my family here and we’ve become very involved in the community. Bloomington has a lot to offer with regards to the arts, ed-ucation and medical care, and we can do quite a bit in our little community here that many towns our size can’t.”

Dr. Jeffrey Poulter and Dr. Paige Holt:

A Higher Level of CareBy Amy Kennard


feature story

Personalizing the “popular” procedures Dr. Poulter performs a variety of the most popular procedures out there today, from body contouring (liposuction, ab-dominoplasty and body lifting) to breast en-hancement (enlargement, lift, reduction and reconstruction), facial rejuvenation (face, brow and eyelid lift, ear surgery, laser resur-facing and rhinoplasty) as well as a number of medical spa services such as BOTOX®, Dermal fillers, laser skin resurfacing, laser vein treatment and laser hair removal. One procedure that is near and dear to his heart is reconstructive surgery after massive weight loss. “I’m one of the few physicians who will take the time necessary for the massive weight loss patients,” he says. “You have to be willing to commit four to six hours for the surgery and pay a lot of attention to detail.” These are the patients, Dr. Poulter says, who really have such a huge difference made in their lives by this surgery. They’ve lost massive amounts of weight – either through diet or surgery – and have all this extra skin with no place to put it. “It makes their lives difficult,” says Dr. Poulter. “Unfortunately, the procedure is considered cosmetic unless abdomino-plasty is required to repair hernias, treat extensive rashes or alleviate walking difficul-ties. Therefore, under many cases it’s not covered by insurance.”

His attention to detail is evident in his pride of one of his specialties – belly button reconstruction. During abdominoplasty, skin is removed or revised and replaced in the correct position. Inevitably, the belly but-ton is shifted or otherwise compromised. Dr. Poulter takes painstaking time to revise belly buttons, even making incisions inside the belly but-

ton to decrease scarring and maintain a more natural looking appearance. Another popular option today is the Mommy Makeover. For many women, one of their biggest concerns about themselves after giving birth is regaining their shape. Ac-cording to Dr. Poulter, the three most com-mon procedures done today are liposuction, breast augmentation and abdominoplasty. “Sometimes,” says Dr. Poulter, “I’m able to combine procedures to minimize the cost to the patient. It’s possible to do two procedures with one anesthetic, since it’s that first hour of anesthesia that is the most expensive.”

Post-surgery care with kid gloves All procedures are performed in Dr. Poul-ter’s own AAAASF (American Association for Accreditation of Ambulatory Surgery Facilities)-accredited, surgical suite. In addi-tion to its state-of-the-art operating room, it

also includes a fully equipped pre-op and post-op recovery room with Bear Hugger and Bear Paws patient warming systems as well as com-pression boots to aid in preventing blood clots. All anesthesia providers are joint commission accredited, including certified registered nurse anesthetists.

Seated (L to R): Lisa Snyder, Office Manager; Dr. Poulter; Dr. Holt Standing (L to R): Rachelle Spickard, Front Office Coordinator; Molly Braun, RN;

Tonya Wells, Certified Clinic Medical Assistant; Deanna West, CST; Cathy Greeneberg, Aesthetician;

Olivia Bellis, Receptionist; Andrea Currie, RN


“Some patients are concerned about the anesthesia,” he says. “There is newer, faster-acting anesthesia that leaves your system faster and has less incidents of post-anesthesia nausea. If you don’t have a family history or difficulties with anesthesia in the past, there’s very little risk involved. We make sure we have the patients’ past medical history and prescribe a plan in advance of their procedure.” When general anesthetics are used, Dr. Poulter is surprisingly old-school when it comes to recovery. “When I perform an abdominal-plasty, lower body lift or other involved procedure, I admit my patients to the hospital overnight, which is adjacent to my facility. I pay for their first and usually only night of hospital stay because there I can provide them with more aggressive pain management care and can address post-op concerns such as hydration, pain management and the pre-vention of blood clots. I’m available 24/7 if they need me.” In fact, one of the most frequent questions he gets from his pa-tients is the post-surgery pain management. “I utilize a multi-modal pain therapy, whether that is a pain catheter with a local anesthetic for a couple of days, dextromethorphan (cough suppressant) or muscle relaxers. They may need none, one, or all three. I encourage them to be mobile as soon as possible to prevent blood clots, alleviate discomfort and get their GI systems back on track.”

About the patient, not the procedure “My mission – and the mission of my staff – is to do the right thing for the right indication, every time.” Dr. Poulter praises his staff by say-ing, “They are very attuned to patient care and open to their concerns.” ‘The right thing’ may not always be surgery, he adds. “The first question I ask a person who comes to see me for a consultation is, ‘Why are you doing this?’ I want to know if it’s for them, or their boy-friend, or their spouse. If it’s for someone else, I tell them they’re not a good candidate at this time. In addition, if they’re in the middle of a social change – a death of a spouse, a divorce, a job change – that’s not a good time for plastic surgery. They need to be in a stable social environment to have this done so if they do have any complications they don’t have that angst that they made the wrong decision.” His patients appreciate not only his bedside manner, but the qual-ity of his work. “The most frequent comment I get is, ‘This procedure changed my life.’” he says. “It’s so gratifying to have someone write me a two or three page letter and say something like, ‘I know you do this every day but this did so much for my confidence, and I participate and am a more vibrant person because I like myself again.’” Sometimes that kind of reaction surprises me, but I know my staff does such a good job that I’m never surprised that my patients feel they have had a good experience.”

Dr. Jeffrey Poulter and Dr. Paige Holt are board-certified plastic surgeons. Dr. Poulter has over 18 years of experience. The Center for Cosmetic and

Laser Surgery has offices in Bloomington and Peoria. For more information, call (309) 663-1222 in Bloomington or (309) 692-6869 in Peoria or call toll-free (888) 841-4108. E-mail your questions to [email protected]. For additional information,

before and after photos and videos of various pro-cedures, visit www.drpoulter.com in the privacy of your own home. For more information about Dr. Holt,

visit www.osfplasticsurgery-bloomington.org.

feature story continued

New IPL Treatment Helps Restore Skin

Dr. Poulter’s practice is now offering Lumenis® IPL (Intensed Pulsed Light) Skin Treatment, which can be used to help restore the skin’s youthful appearance. Lumenis IPS is the newest, most powerful and efficient IPL machine made, using a light-based de-vice that uses filters to isolate specific wavelengths of light. This treatment improves the appearance of photoaged skin, removes age spots (sun-induced freckles), most benign brown pigments, and redness caused by broken capillaries through a process called photorejuvenation for face and body. The process requires no downtime and has a low risk of side effects. The gentle, non-abla-tive treatments use broad spectrum light to treat the face, chest, neck and hands—virtually anywhere that sun damage shows.

Meet Dr. Paige Holt

Dr. Poulter’s practice recently added a new associate, Dr. Paige Holt, a plastic surgeon specializing in cosmetic, reconstructive and hand surgeries. In addition to treat-ing conditions of the hand such as carpal tunnel, hand trauma, tumors and Dupuytren’s contracture (a hand deformity), Dr. Holt brings new technology and procedures to the practice including Vaser® liposuc-tion, an improved version of traditional liposuction that results in less swelling and bruising and a quicker recovery. Dr. Holt came to the Bloomington area from Quincy with her husband, Dr. Travis Holt, a colorectal surgeon, and says she’s pleased with all that the city has to offer. “We have family here,” she explains, “and it’s a very family-oriented town. There’s always something to do on the weekends – from activities to shopping to great restaurants.” What impresses her most about Dr. Poulter’s practice itself is the AAAASF surgery suite. “To have that all-encompassing facility is a huge benefit to the patients. They receive exceptional, one-on-one care and are able to recover in comfort and privacy.” With regards to Dr. Poulter, Dr. Holt has this to say. “He has so many years of experience, and an excellent staff. It’s great to have that camaraderie.” Dr. Poulter notes, “Dr. Holt truly cares about her patients, and that’s the key to this practice. In addition, she brings a new perspective on things – fresh eyes and fresh ideas.”


orthopedic surgery advancements

Walking out of the hospital the day after hip replacement surgery sounds almost impossible. But, not any more. Orthopedic surgeon Dr. Dangles spent the last two years transitioning

to the Anterior (front) Approach to hip replacement surgery. It’s con-vinced him that the technique is a better way, allowing motivated pa-tients to get out of the hospital and back on their feet much sooner than conventional methods. Yes, even as quickly as one day after surgery. There’s a bigger difference to the procedure than simply making the incision in the front instead of the more conventional back (Posterior) or side (Anterolateral) of the hip and it’s the key to a quicker recovery. The Anterior Approach allows doctors to part the natural space between muscles, rather than cutting through the gluteal tissue that controls hip function, resulting in less swelling and less tissue that needs to regener-ate. The resulting scar is smaller, too. With this less invasive approach, some doctors even perform it as an outpatient procedure. But, as a precaution, Dr. Dangles keeps patients in the hospital overnight for observation.

Anterior ApproachHip Replacement Recovery Made Easier

By Jennifer Sinclair Johnson

Other surgical methods require a longer hospital stay and a longer rehabilitation time. That can be a real stumbling block for people who need to get back to work and don’t want to endure weeks of difficulty sitting, using the toilet, or driving. A potentially lengthy recovery kept Mike, a 51-year-old locksmith, from getting his ailing hip replaced despite almost constant discomfort. “I was in pain all the time. Every step used to hurt. Getting in the car, sitting down, going to bed…all used to hurt. I thought I’d be laid up for three months up if I got it fixed, but it wasn’t that way at all. I had the surgery on a Monday, walked on Tuesday, and was working on Saturday.” Almost everyone suffering from hip pain, arthritis, and other prob-lems is a good candidate regardless of age and weight, although Dr. Dangles doesn’t recommend it for osteoporotic or elderly patients with weak bones. How quickly patients recover depends on a variety of factors, including their general health, age, and how long they have had hip disease. Today’s hip replacement techniques have helped millions of people enjoy more productive, pain-free lives. The Anterior Approach is build-ing on that success, gaining in popularity by making a positive differ-ence in the patient’s experience. Dr. Dangles is convinced that it gives patients an easier recovery period. An Illinois State University graduate with ties to our community since 1967, Dr. Dangles currently practices at the Orthopedic & Sports Enhancement Center with privileges at Gibson City Hospital, which he describes in glowing terms. “It’s a wonderful little hospital. They have every right to be proud of it.” Dr. Dangles is equally pleased with the results the Anterior Approach to hip replacement surgery gives people.

For more information you may contact Dr. Dangles at theOrthopedic & Sports Enhancement Center, 2406 East Empire inBloomington.309-663-9300.

• Workers Compensation• Personal Injury

• Social Security Disability

FREE CONSULTATIONSServing the Bloomington-Normal area since 1964

www.WilliamsSwee.com

Robert E. Williams

Jean A. Swee

Steven R. Williams

Dirk A. May

2011 Fox Creek RoadBloomington, IL 61701(309) 827-4371

Williams & Swee Ltd.


back in the news

Is My Cell Phone Really Hurting My Brain?By Edward W. Pegg MD and Christina Pegg

Cell phone usage and its effects on the brain have recently been in the news. Many people (even some patients of my mine) have now spiraled into a turmoil of worry, thinking cell phones may be

making swiss cheese of our brains—or worse—causing Cancer. The article popping up in the media was published several weeks ago by the highly regarded Journal of the American Medical Associa-tion (JAMA). It investigates the effects of electromagnetic fields (EMFs) created by cell phones on metabolism within the brain. The idea that cell phones may cause changes in brain activity and may even cause damage is not new. Interest in the effects of cell phone use on brain cells has been around since they first came on the market. Previous studies have also caused us to raise our eyebrows in concern, includ-

ing studies using PET scans to examine changes in blood flow after cell phone use and correlation studies that look for a direct connection between cell phone usage and brain tumors. However, these previous studies have failed to show significance or a real danger. The cell phone culprit has also failed in a court of law. Not too long ago, Johnnie Cochran—the famous defense lawyer for O.J. Simpson—attempted to sue cell phone companies for negligence. He believed he had developed a brain tumor from years of cell phone use. This time Cochran did not fare so well with the courts. Solid facts supporting cell phones as tumor creators were non-existent. This time Cochran’s infa-mous line, “If the glove don’t fit, you must acquit,” would work against him as the cell phone companies were innocent of any wrong-doing.

TALKTALK

TALK…


So if the evidence doesn’t support any health danger with cell phone use, why are we still hearing about this? According to the recent JAMA article, it appears we just haven’t been looking hard enough. This study was carefully designed to assure confounding factors were eliminated and only significant changes observed. All of the people in this study were healthy volunteers, eliminating the risk of abnormal activity in the brain. Two cell phones were used rather than one—so that people would not predict where stimulation would occur since even the act of their prediction could change brain activity. Also, the cell phones were muted so no activity from the auditory region of the brain would interfere with the readings. Next, the two cell phones were turned on or off in a double blind manner. This means that neither the doctor nor the patient knew when the cell phone was on or off—eliminating the risk of the data being influenced by either the patient’s or the doctor’s perspective. Finally, the test used was much more sensitive than the previous PET study, which only measured bloodflow in relation to cell phone ac-tivity. The PET-FDG scan uses a glucose analogue (FDG), which acts as a tracer in the person’s brain. After being injected into the blood-stream, the FDG is taken up by active brain cells which would normally utilize glucose. The relative amount of FDG taken up by the cells can be visualized on a computer screen where it is analyzed. Now, rather than looking at just the change in bloodflow—which doesn’t happen very easily—doctors can see a change in the activity of the cells based on their use or metabolism of glucose. Low and behold, this careful study actually did find a significant increase in glucose metabolism when comparing the cellular activity of the brain with the phone turned on as compared to when it was off. How big was that increase you ask? Only about 7 percent above base-line. What does that mean in terms of basic physiology? The study

says “…the effects on the human brain are unclear.” I say, let’s get a reference point. For example, a much greater increase in cellular activ-ity (about 28%) is observed when a person merely looks at a flashing checkerboard on a computer screen. Why are we worrying so much about cell phones when a far more gripping concern may be what’s happening to our kids’ brains after a night of playing video games? Electromagnetic energy, sometimes referred to as “Electromagnetic Radiation”, seems to strike fear in our hearts that we are being bom-barded by “atomic energy”. But they are not the same. There are no ionizing energies in EMF fields of cell phones. While this study shows that EMFs can slightly activate cells, we must keep in mind that it does so with much less intensity than a simple video game (checker boards flashing on a computer screen). And when you have an MRI scan, you are exposed to a magnet that is 10,000 times as strong as a cell phone signal! So at this point I don’t feel we have to run for cover, in fact, I wouldn’t even break stride on this one.

For more information on any neurological issue, you maycontactDr.Peggat309-661-7344.ChristinaPeggisastudentatISUobtainingaMastersDegreeinbiology.

“Electromagnetic energy, sometimes referred to as ‘Electromagnetic Radiation’, seems to strike

fear in our hearts that we are being bombarded by ‘atomic energy’. But they are not the same.”

Amy L. McFarland Attorney at Law

Family

Adoption

Mediation & Divorce

Estate Planning

Real Estate

309-827-8900

www.bloomingtonlegal.com


community service

The Links, Incorporated is an organization in our community that has nothing to do with playing golf. You may be surprised to know that it is one of the nation’s oldest volunteer service orga-

nizations of women who are “committed to enriching, sustaining and ensuring the culture and economic survival of African Americans and other persons of African ancestry” through a faceted approach includ-ing Services to Youth, National Trends (health and education), Interna-tional Trends and The Arts. The Links, Incorporated was founded in 1946 and The Central Illinois Chapter began in 1975, servicing Bloom-ington-Normal, Champaign-Urbana, Charleston, Decatur, Peoria and Springfield.

The primary focus for the Central Illinois Chapter is education, health and wellness for the African American family. They sponsor an event in October called “Women Taking STEPS Together” which is a one day workshop designed to raise awareness of health issues such as breast cancer, especially among African-American women who have the highest death rate from breast cancer . They actively participate in events such as contributing to Haitian relief in conjunction with the Midwest Food Bank, American Heart Association Walk as a sponsor and participant, the Relay for Life and the Komen Race for the Cure. In addition, they serve youth through service programs such as the 4-H Best of All Club and the “Healthy Hearts” workshop for children, which is focused on building self esteem, promoting healthy lifestyles and preventing childhood obesity. They currently sponsor two Haitian children and provide scholarships annually to deserving High School graduates within their service area.

Their signature event is the annual “Tea” fundraiser to be held at the Marriott in uptown Normal on April 9th

from 11:30 – 2:30. This event encourages mothers and daughters to dress up and experience a fun time

together. Kathy Buckley, “America’s First Hearing Impaired Comedienne” is the featured entertainment

along with musicians from local high schools and Illinois Wesleyan. Proceeds from this fundraiser are used for all the programs that they support in the community as well

as providing money for scholarships.

FormoreinformationabouttheCentralIllinoisChapterofTheLinks,youmaycon-tactthemat309-661-0165orthroughtheirwebsite,www.CentralIllinoisLinksInc.org.

The LinksBy Karen Tucker

You Are Invited to A Royal Tea

Saturday, April 9, 2011

11:30 a.m. - 2:30 p.m.

Bloomington-Normal Marriott Hotel


Functional Medicine and Hormonal Evaluation

OVERWHELMED?TIRED OF BEING TIRED?

3798 E. Fulton Ave. Decatur, IL 62521

www.DrRohde.com217-864-2700

Dr. Rohde can help!

Cal l now to set up a free weight loss consultat ion/evaluation

Since my sessions with Rick and using self-hypnosis on a daily basis, I have lost weight and made lifestyle changes: scheduled time for me, do weekly meal planning, watch food portions, and eat less fast/processed foods. With the help of my personal trainer, I am now flexible, physically stronger, and have more energy. My knee replacements are now responding to me and not the other way around. And, I am able to control my diabetes with minimum oral medication.

- P.M. - Bloomington

Diet is a four-letter word! Are you ready to make a lifestyle change to achieve longterm weight loss? Are you ready to make 2011 the best year of your life? It could be weight loss like the client above, or any number of other things. I am here to help you achieve the you, that you want to be!

Rick Longstreth, CH 309-261-2564

2310 East Oakland Ave. Suite 11B Bloomington, IL 61701

www.CentralIllinoisHypnotherapy.com


1415 Woodbine Road • Bloomington, IL

309•665•0000

Childcare that goes outside the lines!

Preschool

Daycare

Before/after school care

Full time, part time, and hourly

—create your own schedule—

Obstructive Sleep ApneaOSA is a serious, potentially life-altering, health issue. People with this disorder

stop breathing during sleep for 10-45 seconds at a time, occurring up to 400 times every night. This usually wakes the person, or their partner, resulting in

neither getting enough rest.

The person having the breathing interruptions will usually not remember waking throughout the night, but may notice sleepiness during the day—or the

feeling of not being able to get enough sleep.

• An estimated 5 to 10 percent of adults in the US have OSA• Of these, 85 to 90% have not been identified• Sleep apnea can affect persons of any age

• It is more common among those 40 years of age or older

Please contact your physician if you believe you have symptoms of sleep apnea.

Implant and Cosmetic Dentistry

• Surgical placement and restoration over implants.

• Free consultation for implant treatment.

• All implant procedures performed in one office.

• IV Sedation

Emil M. Verban Jr. DDSPC2103 E. Washington St.Bloomington, IL 61701309-662-8448Member International Team of Implantology

New Patients Welcome CIGNA Insurance Provider

www.mcleancountydental.com


diabetes management

Being diagnosed with dia-betes can be overwhelm-ing and frightening. The

misinformation given to us by the media—and maybe our friends and family—doesn’t help. What’s a person to believe? One of the most important things a person can do when they are diagnosed is align themselves with a medical team that can take care of them now and help them prevent com-plications down the road. Be open with your physician about your questions and concerns. Prepare yourself before you go for your check-ups. Have your questions written down so that you don’t forget to ask. Keep a list of the things that “you have heard” so that your physician can give you the facts.

Here are some of the com-mon misconceptions about diabetes:

• Eating “too much” sugar causes diabetes. False. Eat-ing sugar does not cause dia-betes. Eating too much sugar, or carbohydrates, may cause weight gain and weight gain may increase the risk of developing diabetes.

• People with diabetes can never eat sugar or carbohydrates again. False. People with diabetes are encouraged to eat the same healthy diet we all should eat, but many choose not to. People with diabetes should eat a balanced diet of carbohydrates, proteins, fats and vegetables. Meals should be spaced evenly throughout the day. They should eat foods that are high in fiber, drink water more often, and limit the juice they drink. Desserts can be eaten in moderation. People with diabetes should try to get at least 30 minutes of physical activity most days.

• Diabetes can be “cured.” False. Unfortunately, there is no cure for diabetes. Some people are successful at controlling their diabe-tes without medication. A person that does not take medication still needs to manage their diabetes with a balanced diet, being physically active, and following up with their physician. For people who do take medication, it does not indicate that your diabetes is “worse” or that you are doing a “bad job.” Diabetes affects each person differently

and treatment plans for each patient are very individualized. What works for one person may not work for the next person.

• All people with diabetes will develop a complication. False. While having diabetes does increase your risk of developing a com-plication, not everyone will. Millions of people live with diabetes and are complication-free and healthy. Prevention is the key to avoiding a complication. Regular visits with your physician, lab work, vision and dental exams, and checking your feet and blood sugar daily are all ways to help prevent complications.

More than half a million people in Illinois have diabetes. If you or someone you love has diabetes, please know that there are pro-grams available to better educate you and your family.

Formoreinformationaboutdiabeteseducationandmanagement,contacttheJoslinDiabetesCenterofBloomington,anaffiliateatOSFHealthCareat309-664-3800orvisitwww.joslin.org.

Have Questions?Get Answers.

By Amy E. Van Hoveln RN, BSN, CDEJoslin Diabetes Center Site Manager at OSF Medical Group – College Avenue

noise induced hearing loss

Noise is in the news. Just look at the headlines… U2 fined for noise pollution in Spain; Park Service Seeks Quiet in Grand Canyon; Passengers Push

for Child-Free Flights; Noisy Wind Turbines Attract Com-plaints; World Cups Incessant Drone Will Stay for Now; It’s a Library, Not a Starbucks. It’s not just affecting humans either. Animal habi-tats and mating and migratory patterns are all affected by noise… How Noise Pollution is Affecting 10 Ani-mals; Noise Pollution Threatens Earth’s Ecosystem; Human Noise May Distract Animals; Firecracker noise tortures animals. There are Facebook groups petitioning to stop the noise. Governmental and advocacy organizations all over the world have the responsibility of creating guidelines and reducing the effects of hazardous noise. So why all of the uproar about the noise? Our ears can only handle so much sound before perma-nent damage, known as noise-induced hearing loss, oc-curs. Signs of noise-induced hearing loss include muffled hearing and/or ringing in the ears. Some exposures result in only temporary muffling or ringing and hearing seems to return to normal after 12-24 hours. But let me assure you, damage has been done and it will add up to a permanent loss of hearing with time and subsequent exposures. The Occupational and Safety Health Ad-ministration (OSHA), the main federal agency charged with the enforcement of safety and health regulations, has created standards based on the relationship between the amount of time you are exposed and the loudness of the sound. The louder the sound is, the less time you can spend in it before it causes damage. In-versely, if a sound is less intense you are allowed more time in that environment. So what do you do if you don’t have a sound level meter and the OSHA standards with you? A good rule of thumb is that if you have to shout over a noise to talk to some-one an arm’s length away, then it may be damaging your hearing. And the word noise is not meant to imply something that we don’t like to listen to; it may be something that we really enjoy. Take a minute to think about the possibilities… lawn mowers, concerts, power tools, motorcycles, aerobics studios, bas-ketball games, noisy toys, musical instruments.

International Noise Awareness DayBy Natalie McKee, Au.D., Doctor of Audiology, Bloomington-Normal Audiology



The goal is to increase recognition of hazardous noise and educate people regarding the adverse effects on our health and environment. It may not be just where you work, but at home and recreational activities as well. Studies have shown that noise exposure causes increased blood pressure, stress, anxiety, digestive problems, and sleep distur-bances.

What you can do:• Take responsibility and turn down the volume on your TVs, comput-

ers, and music players.• Be your own advocate. Don’t be afraid to ask your movie theater or

aerobics instructor to turn it down. Others may be thinking the same thing but too afraid to ask.

• Find hearing protection that works for you. There are so many variet-ies that offer great levels of protection – foam, pre-molded, filtered and valved earplugs, earmuffs, and even custom fit. The best one is the one that fits.

• When you can’t control the volume, wear hearing protection and/or take a break from the noise. Giving your ears periods of quiet time to limit continuous exposure will help protect them.

• Buy quiet. Power tools are manufactured to be quieter, especially electric versions of previously gas-powered machines.

• Avoid noisy toys. Children hold or are placed considerably close to their toys when playing. If a toy you already own is loud, tape over speakers to limit the loudness if they don’t have a way to turn it down or off.

• Talk to an Audiologist. Have your hearing tested, especially if you are already experiencing signs of noise-induced hearing loss (ringing and/or muffled hearing).

It is never too late to protect your hearing. Noise-induced hearing loss is preventable. Take some time to recognize what may be harm-ing you and what you can do to protect yourself. Talk about it with your family, friends, and co-workers to heighten awareness. Make changes together to protect your well-being and your environment.

Formoreinformationonanyhearingrelatedissue,youmaycon-tactBloomington-NormalAudiologyat309-662-8346oronthewebatwww.bloomingtonnormalaudio.com.Theyarelocatedat1404East-landDrive,Suite203inBloomingtonand1508ReynoldsSuiteBinPontiac.YoumayvisiteitheroftheirofficesanytimeduringthemonthsofMarchandAprilforafreesetofnon-customearplugs.

“International Noise Awareness Day is

April 27, 2011. This day of recognition

was founded by The Center for Hearing and

Communication (www.chchearing.org).”


chronic pain management

The Greek goddess of revenge, Poena, was sent to punish the mortal fools who had angered

the gods. Poena also gave us the word pain. Many ancient cultures believed pain and disease were pun-ishment for human folly. They tried to appease angry gods with rituals like votive offerings and scapegoats, sac-rificial animals that carried the sins of people out into the wilderness. Some of the medical practices from the ancient world have been updated for use by modern physi-cians: “ The Egyptians used to take electric Eels of the Nile lay them over the wound of patients”. A similar technique is used today to relieve pain. Transcutaneous electrical nerve stimulation or TENS is a popular treatment for lower back and arthritis pain. The first new significant treatment for pain occurred in 1846 with use of anesthesia for surgery. The growth of pain clinics has paralleled the growth of anesthesia as specialty. The in-volvement of anesthesiologists was an extension of their role in post op-erative pain relief and regional anes-thesia. In spite of the dazzling array of modern treatments for pain, some experts wonder if ancient and primi-tive cultures still have much to teach us about pain and human health. Ancient people saw pain more ac-curately- pain not only as a physical condition but as an emotional and spiritual condition. They would work with the entire patient. By definition pain is considered to be chronic when it has lasted more than 3-6 months, has significant psychological / emotional affects and limits the ability of a person to fully function. This may be associ-ated with sleep disturbances, lack of energy and depression. In many chronic pain conditions the pain per-sists beyond the usual course of an acute disease or healing of an injury and people may spend years seeking relief from the unrelenting and agoniz-ing pain and suffering.

A Multi-disciplinary ApproachBy Dr. Benjamin Taimoorazy, Guardian Headache and Pain Management Institute


The first modern pain management center was set up at the Uni-versity of Washington in 1961. In the 1970s Fordyce and Sternbach established the principles of pain treatment using a multidisciplinary approach. This approach allows treatment of physical, emotional, behavioral, vocational, and social aspects of the pain in a more effec-tive manner. Chronic pain usually results from many causes and it is important to understand and treat all of the causes in order to alleviate and manage the pain. Patient education is a crucial part of this pain management approach as patients may have already spent years see-ing various specialists and misconceptions about the nature of the pain and its significance may need to be dispelled. The goal is to decrease the subjective pain experience, increase the general level of activity, decrease drug consumption and finally, return to employment and full quality of life. The high prevalance and significant negative impact from chronic headache conditions suggest a need for effective identification and management of headache complaints in clinical practice. Many people with chronic pain can be helped if they understand all the causes of pain and the many and varied steps that can be taken to undo what chronic pain has done. Scientists believe that advances in neuroscience will lead to more and better treatments for chronic pain in the years to come.

Formoreinformationaboutthediagnosisandtreatmentofchronicheadachesandotherpainrelatedconditions,youmaycontactDr.Benja-minTaimoorazyatGuardianHeadacheandPainManagementInstitute,309-808-1700,www.theGuardianPainInstitute.comThisnewpractice,locatedat2203EastlandDrive,Suite#7,inBloomington,openedonMarch7thandoffersamulti-disciplinaryapproachtomanagingpain.

This ad space generously donated by:Edward W. Pegg, III, M.D.


healthy feet

As spring approaches and we take off those winter boots, please be sure to check your feet for any rough spots (calluses, corns, or redness) that may

have been caused by those winter shoes. Too often, patients let the simple things that “hurt a little” slide for far too long. Ingrown toenails are one of those common problems that we let slide and are something that podia-trists often see when those helpful winter boots were a little too snug! An ingrown toenail typically occurs because the nail was not cut straight across and the ‘edge’ of the nail that was curved to the side is now grown out and digging into the skin next to it. They can also be caused by a pair of shoes that are too tight and rub the skin into the nail fold. This problem can lead to infections – some patients even require antibiotics to help treat the problem if they wait too long to be seen! Fortunately there is a simple procedure that can be performed to correct the problem of an ingrown toenail. It involves numbing the affected toe, using the same type of medication a dentist would use to numb your mouth for a cavity, and removing the ingrown nail down to the root. Sometimes it is advisable to also have a chemical put into the nail root area to ‘kill’ it – so no more ingrown toenails! Recovery time for an ingrown toenail procedure is minimal – the numbing medication will wear off in 2-4 hours and usually the pressure relief from not having the nail in the corner is immediate. Daily dressing changes with antibiotic medication and band-aids are the preferred treatment for about two weeks after the procedure. Sometimes people will also soak their feet in Epsom salts and water as directed by their podiatrist. Prevention is, as always, the key to helping solve the vicious cycle of ingrown toenails. Trim nails straight across, avoid shoes that are too

snug, and always stop by your podiatrist’s office if you feel any pain – even if it only “hurts a little bit!”

Formore informationabout ingrowntoenails,pleasecontactDr.MelissaLockwoodatHeartlandFootandAnkleAssociates,P.C.at309-661-9975orwww.heartlandfootandankle.com.

Does the Changing of the Seasons Mean More Pain in the Toes?

By Melissa J. Lockwood, DPM, Heartland Foot and Ankle Associates, P.C.

Visit Us Online: www.Alpha-Care.com 309-663-4680 or 800-219-1313


SURGERY EMGMRIPhysical Therapy

2502 E. Empire • Bloomington • 61704www.mcleancountyorthopedics.com

Non-Invasive Medical Imaging Services for Clear and Detailed Visualization

McLean County Orthopedics (MCO) is well known in Illinois. Founded in 1976 by Dr. Jerald Bratberg, a graduate of Harvard Medical School, MCO has always attracted the finest health care professionals, including its nine physicians, 11 therapists, and over 60 employees. MCO also started and spun-off The Center for Outpatient Medicine (TCOM), which is the largest

freestanding surgery center in central Illinois and the only one certified for overnight stay. Located across route 9 (Empire) from the old Bloomington airport, MCO treats all types of orthopedic conditions and offers a comprehensive range of services. Most patients can call for an appointment, although there are some insurances (i.e. Health Alliance, OSF) that first require referral from a primary care physician.

Magnetic Resonance Imaging (MRI) An MRI is a non-invasive medical test that helps physicians diagnose and treat many medical conditions. In many cases an MRI gives different information about structures in the body than any other test. An MRI has proven valuable in diagnosing a broad range of conditions, including cancer, heart and vascular disease, and muscular and bone abnormalities.

McLean County Orthopedics has an open MRI. Many people who have issues with claustrophobia (fear of closed spaces), are able to undergo the diagnostic studies they need in an open MRI with less apprehension than they would experience in the more traditional closed type MRI. We strive to make MRI studies as comfortable as possible for our patients.

For more information, or for an appointment, call 309 - 6 6 3 - 6 4 6 1


LET US HELP PUT YOUR

INVESTMENTSON THE

RIGHT COURSE!

Securities are not FDIC insured, carry no bank guarantee and may lose value. Securities and Investment Advisory Services are offered through Midwestern Securities Trading Company, LLC.

4001 GE Road • Bloomington IL 61704 • 309.663.6200

Contact Investment Manager Brock Westbrook for a FREE consultation!

03/05/2012EasterCel-01-g359

To order, please call or visit:

309-661-01002205 E. Oakland Avenue

Jewel PlazaBloomington, IL 61701

2


Roth IRAs are tax-favored financial vehicles that enable investors to save money for retirement. They differ from traditional IRAs in that taxpayers cannot deduct contributions made to a Roth.

However, qualified Roth IRA distributions in retirement are free of fed-eral income tax and aren’t included in a taxpayer’s gross income. That can be advantageous, especially if the account owner is in a higher tax bracket in retirement or taxes are higher in the future. A Roth IRA is subject to the same contribution limits as a traditional IRA ($5,000 in 2010). Special “catch-up” contributions enable those nearing retirement (age 50 and older) to save at an accelerated rate by contributing $1,000 more than the regular annual limits. Another way in which Roth IRAs can be advantageous is that in-vestors can contribute to a Roth after age 70½ as long as they have earned income, and they don’t have to begin taking mandatory distri-butions due to age, as they do with traditional IRAs. Roth IRA withdrawals of contributions (not earnings) can be made at any time and for any reason; they are tax-free and not subject to the 10% federal income tax penalty for early withdrawals. In order to make a qualified tax-free and penalty free distribution of earnings, the ac-count must have been in place for at least five tax years and you must be age 59½ or older. Otherwise, these withdrawals are subject to the 10 percent federal income tax penalty with certain exceptions which include death, disability, medical expenses in excess of 7.5 percent of adjusted gross income, higher education expenses, and to purchase a first home (up to a $10,000 lifetime cap). However, these withdrawals would be subject to ordinary income tax. To qualify for a tax-free and penalty-free withdrawal of earnings in retirement (after age 59½), a Roth IRA must have been in place for at least five tax years. Keep in mind that even though qualified Roth IRA distributions are free of federal income tax, they may be subject to state and/or local income taxes. Eligibility to contribute to a Roth IRA phases out for taxpayers with higher incomes. If you’re looking for a retirement savings vehicle with some distinct tax advantages, the Roth IRA could be appropriate for you. Formoreinformation,youmaycontactBrockWestbrook,Invest-mentManager forFirstFarmersStateBank InvestmentServices,adivisionofFirstFarmersStateBank,locatedatthecornerofTowandaBarnes&GERoadinBloomington.Brockcanbereachedbyphoneat309.663.6200orbyemailatbrockw@firstfarmers.com

ThismaterialwaswrittenandpreparedbyEmeraldforusebyMidwesternSecuritiesTradingCompany,LLC,Broker/DealerforFirstFarmersStateInvestmentServices.Theinformationinthisarticleisnotintendedtobetaxorlegaladvice,anditmaynotbereliedonforthepurposeofavoidinganyfederaltaxpenalties.Youareencouragedtoseektaxorlegaladvicefromanindependentprofessionaladvisor.

healthy finance

What Is a Roth IRA?

Submitted by Brock Westbrook, Investment Manager, First Farmers State Bank Investment Services



H a l e C o s m e c e u t i c a l s

C o m p l e t e P r o d u c t I n f o r m a t i o n a t w w w . h a l e c o s m e c e u t i c a l s . c o m

R e t a i l O u t l e t • 2 0 1 1 S . M a i n , S t e 1 0 6 • B l o o m i n g t o n • 1 - 8 0 0 - 9 5 1 - 7 0 0 5

Younger looking Sk in Without Cosmetic Surgery

Safe and Effective

Peptides, anti-aging components, keep collagen and elastins in their free form, effectively reducing

wrinkles and fine lines.

P

MRI • CT (COMPUTERIZED TOMOGRAPHY) • PET/CT • ULTRASOUND • X-RAYBONE DENSITOMETRY • DIGITAL MAMMOGRAPHY WITH CAD


Easter Seals Timber Pointe Outdoor Center is like a hidden jewel in the midst of Central Illinois. The camp serves hundreds of chil-dren and adults with a wide variety of disabilities each summer.

Located just 10 minutes north of Bloomington/Normal on the southern end of beautiful Lake Bloomington, the camp’s peaceful wooded sur-roundings and multiple activities provides the same type of unforget-table camping experience many people have grown up with, but in a setting that is physically and intellectually accessible for any child, youth or adult. Whether they have Muscular Dystrophy, Spina Bifida, Autism, ADHD/ADD, Cerebral Palsy, Traumatic Brain Injuries, Cancer or HIV/AIDS, etc. Timber Pointe will serve them in one of the many camps offered during the summer or one of the fall or spring weekend camps. Timber Pointe has both open camps for children and adults as well as Partner Camps with various organizations that serve people with disabilities. The camp is proud of its long term affiliation with The Au-tism Society of McLean County, Traumatic Brain Injury Association of Illinois, Children’s Oncology Camping Organization with Univ. of South-ern Illinois, the Muscular Dystrophy Association of Central Illinois, As-sociation of Horizon, the Sickle Cell Disease Association of Illinois and others. The camping experiences these groups have and the fun of swimming, boating, horseback riding, outdoor sports and others in activities with their peers, makes camping a fun experience where they feel “like just one of the other campers”. The camp is staffed by collegians in the allied health fields that often are beginning a career in serving individuals with disabilities. The annual challenge to recruit dedicated staff is facilitated by word of mouth and former staff. They come from the Midwest and around the world in order to get a first class experience at Timber Pointe. They are trained over the course of a week in all the medical, personal and emotional care for the campers. Experts in various disabilities are often brought in to train the staff on specific needs for specific campers. The counselors typi-cally end the summer feeling they are the biggest winners, claiming “the campers gave them far more than they could ever possibly return”.

The camp was originally Camp Heffernan Boy Scout Camp until its purchase by Easter Seals in 1989. The original trails and cabins still exist. Even the old log cabin built from the telephone poles that once graced Route 66 still houses campers. Since its purchase the camp has grown and expanded in large part due to the guidance and support of the Central Illinois Easter Seals Board of Directors and the Timber Pointe Charitable Foundation. Cabins have been built, a swimming pool added, high and low ropes challenge course added and just this year a horse stable and pasture was carved out of the forest. The crowning jewel of the camp is the Main Lodge dining hall/meet-ing center overlooking the lake. It serves as a testimony of the co-operation of countless organizations in central Illinois that range from the Rotarians and Kiwanis Clubs to The McLean County Sportsmen’s Association, State Farm and Caterpillar. Spearheaded by the Timber Pointe Charitable Foundation, the Main Lodge now serves the commu-nity in the off season as a place for those who love nature and want to hold their group meetings/retreats or wedding receptions/ parties in a natural setting. The cabins are rented out in the fall, spring and winter to any group that wants to keep their travel time short but have the feel of an exclusive wooded retreat center. Some athletic teams/fraternal societies/churches/businesses groups will utilize the challenge courses on a daily basis to experience real team building while being challenged by traversing the 40’ high ropes course or the 300’ zip line. Ultimately Easter Seals Timber Pointe Outdoor Center is a camp for any person of any ability that wants to retreat to the outdoors and experience the natural wooded surroundings and peaceful lake setting to gain per-spective and refreshment.

For more information, you may contact Craig Anderson at(309)365-8021.

EasterSealsprovidesexceptionalservicestoensurethatallpeoplewithdisabilitiesorspecialneedsandtheirfamilieshaveequalopportunitiestolive,learn,workandplayintheircommunities.

Hidden Jewel in Central IllinoisBy Craig Anderson, Easter Seals

timber pointe outdoor center


In Constitution Place at

716 E. Empire, Suite 2

At the Corner of Linden and Empire, Next to Constitution Trail

Showroom hours:Monday-Friday 8 am - 5 pm

(Wed till 7 pm)

www.heartlandhomemedical.net

Visit Us

Phone: 309-829-8122 • Toll Free: 1-800-591-6203Call Now for More Details

• Theracycle Therapy• Fitness Assessments

and Body Composition• Travel Training• Employee Wellness• Girls Club

• Fitness Trainers• Medical Group Exercise• Golden Fitness• One on One Fitness

and Nutrition Training• Youth Fitness

There Are NO Monthly Membership Fees!( F e e s B a s e d o n I n d i v i d u a l S e r v i c e s )

w w w . h e a r t l a n d f i t n e s s . o r g


healthy skin

First there was A. Then there was E, after that C. Now there’s yet another con-tender in the alphabet soup of vitamin-

based skin cream ingredients claiming to do everything from smoothing wrinkles to evening out tone. Vitamin K. Anyone who’s studied bi-ology might ask, “Isn’t K the vitamin that helps blood clot? How could smearing it on skin im-prove my appearance?” Much to the surprise of many scientists, IT CAN! Researcher at New York University and various dermatology centers have found that vitamin K may help turn around three skin con-ditions that plague millions of women: rosa-cea, spider veins and dark circles under the eyes. “When you look at the before and after photos from studies done on women with these conditions, you notice a difference,” says Avid E. Bank, a dermatologist from Mt. Kisco, NY. “There’s only one glitch. Nobody knows how it works.” There are theories, though. “Vitamin K likely functions in two different ways,” says Melvin Elason, the Nashville based dermatologist who invented a method that gets vitamin K to skin (vitamins can’t penetrate skin without a deliv-ery system) and who holds the patent on its topical formulation. “First, it connects with re-ceptors on blood vessels, making them small and preventing blood leakage. This reduces spider veins and rosacea. Second, vitamin K carries pigment out of the skin, lightening up dark circles.” Many non-cosmetic companies are also interested in Vitamin K products. Certain companies have already developed a line of vitamin based products to prevent bleeding and lessen bruising. When considering which skin care prod-ucts to purchase, it is important to pay at-tention to the ingredients in the product – not just the claims it may make. A skin care lotion that includes Vitamin K, derived from natural sources, can truly help your skin look healthier as well as provide relief from spider vein pressure and itching.

For more information, you may contactHale Cosmeceuticals Inc. at 309-820-7447oronlineatwww.halecosmeceuticals.com .TheyarealocalSkinHealthCompanylocatedinBloomingtonwithacomplete lineof skincareproducts,includingamilklotionfortifiedwithVitaminK.

Vitamin K Submitted by Hale Cosmeceuticals


I N T R O D U C I N GD R . A L B E R T K I M , D . D . S .

The Foehr Group would like to welcome Dr. Albert Kim to our practice! Dr. Kim received his Doctor of Dental Surgery degree from Loma Linda University, Loma Linda, California in 2005. Since graduating he has completed several Prosthetic, Surgical and Implant courses along with courses in Oral and Nitrous Sedation and Occlusion. Dr. Foehr feels very confident in his abilities and knows that he can bring some new and exciting services that we previously did not offer such as: placing of dental implants, oral surgery and oral sedation. Dr. Kim also has a family with a wife and two boys and is fluent in the Korean language. Please help welcome him to our practice and get 10% off

appointments booked with Dr. Kim for mentioning this ad.

Dr. Joseph NorrisSpecialist in

Arthroscopic Surgery

Aminimallyinvasivesurgicalproceduretotreatboneandjoint

problems,includingrotatorcuffrepair,andkneeandshoulder

instabilities.

”2406 East Empire

Bloomington

(309) 663-9300

2502 East EmpireBloomington

(309) 663-6461

“Arthroscopy…


Everything we put in our mouth elicits a hormonal response. Hor-mones are the governing elements of our body – telling it to gain weight, lose fat, or put on muscle; signaling the brain to be hun-

gry or full; and determining how we age and think. Hormones are clearly important and having the proper hormone ratios is essential to health and longevity. It is helpful to have a scientific understanding of why the Paleo food choices of quality animal proteins, vegetables and fruits, and healthy fats, are optimal not only for good health, but for looking and feeling your best. Let’s dig a little deeper into the hormonal response of our body to food, starting with the macronutrients protein and carbohy-drates. Protein Protein is broken down into amino acids, which are the building blocks of our body. Skin, muscle, hair, hormones, and neurotrans-mitters, for example, all depend on proteins. When we say proteins, we mean animal proteins. Proteins from plants (such as beans), will allow us to survive, but will not let us thrive. Consuming protein elicits a response from the hormone glucagon. Glucagon is a mobilization hormone, meaning it helps sugar, fat, and nutrients leave our cells to be utilized as energy. This is obviously preferable because it helps maintain energy levels, normalize blood sugar, and burn fat.

Carbohydrates come in three forms: • Mono-saccharides are single sugar molecules and include glucose

and fructose. Glucose is used to fuel the body while fructose, glu-cose’s evil cousin, is only absorbed by the liver and binds easily to proteins in the body, causing us to age faster.

• Di-saccharides are formed when two mono-saccharides are joined together. The most common is sucrose or table sugar which is glu-cose and fructose bound together.

• Poly-saccharides, which literally means “many sugars”, are complex carbohydrates like starch found in rice, potatoes, corn, flour, pasta, bread, etc.

Di and Polysaccharides must be broken down into single sugar mol-ecules (glucose or fructose) to be absorbed. Does it make sense that a diet based around consistently consuming “many sugars” would be good for us? Of course the answer is no. Which is why chronic over consumption of carbohydrates is a primary cause of many sicknesses that plague us. When carbohydrates enter our body, they are cleaved down to single sugar molecules (glucose/fructose) and then released into our blood stream. Our body releases the hormone insulin as a response to this increased blood sugar. As a storage hormone, insulin’s job is to

paleo diet

get the sugars into the appropriate tissues (muscles and organs). The balance between glucagon and insulin is crucial in making sure things are released and/or stored at the right times. Too many carbohydrates is the same as too much insulin, which means that your body is in a constant state of storage – obviously not a good thing for managing energy levels or burning fat. Once our muscles are full, our liver converts excess carbohydrates to pal-mitic acid (PA), which becomes stored in our arteries (atherosclero-sis) or as bodyfat. PA also negatively affects our satiety hormones (leptin, ghrelin, adiponectin, and Peptide YY), which leads to an in-ability to feel full and further over-consumption. This in turn leads to chronically elevated insulin, and eventually, insulin resistance. If this cycle is not broken, the result is often pre-diabetes, clogged arter-ies, and chronically elevated insulin; all of which have been shown to increase rates of cancer, aging, and the incidence of neurodegen-erative diseases like Alzheimer’s. While the prevailing wisdom may advocate a low-fat/high-carb diet to control weight and help prevent disease, when we actu-ally investigate how the body works, we come to see that protein (from grassfed/pastured animals) and fat consumption (which is hormone neutral) are biologically healthy and that we need only enough carbohydrates to support activity. This is slowly coming to light more and more as recent scientific studies are coming to the same conclusion. It is important to eat the “right” carbs, primarily from vegetables and fruit (organic if possible), and not so much from whole grains. Animals in a feedlot are a completely different “animal” than those that are grass-fed or pastured. Nutritionally, they aren’t even close. As long as meat is from grassfed/pastured animals, the saturated fat content isn’t an issue. Fat in foods isn’t stored unless it’s in the presence of a high volume of carbs (insulin). In a diet like this it’s used by the body as fuel. If all this scientific explanation seems complicated, a good first step is to eliminate refined starches and sugars. Then eat more vegetables and fruit (organic if possible), more animal protein (from grassfed / pastured animals) and don’t obsess about fats. You’ll look and feel better and will lower your risk for many diseases. If you missed the first article that covered the basics of the Paleo Diet Lifestyle, you may read it online at www.HealthyCellsMagazine.com. The next article will discuss what happens on a cellular level when we eat “healthy whole grains”.

FormoreinformationaboutthePaleoDietorCrossfitTraining,youmaycontactJJKrupkaat309-662-5678ore-mailinfo@crossfitbloomington-normal.com.Theirnewlocationis401BroncoDriveinBloomington.

Hormonal Response of Our Body to Food Part 2

By JJ Krupka, Owner/Coach, CrossFit Bloomington-Normal


Vicki L. TiltonVicki L. TiltonCe r t i f i e d T e chn i c i an

Permanent CosmeticsPermanent Cosmetics

309•242•4951 www.vickitilton.com

cosmetic or medical applications • eyebrows • eyelinerscar camouflage • allergies

active lifestyle • areola restoration

Member of the Society of Permanent Cosmetic Professionals

Enjoy a safe and natural-looking alternative to your daily makeup routine.


Exper i ence the d i f f e r ence

Jessica Hoelscher, D.C.


FEEL BETTER FASTER AFTER YOUR PLASTIC SURGERY WITH ON-Q® PAINBUSTER®

➤ Starts working right after surgery

➤ Provides significantly better pain relief than narcotics

➤ Gets you back to normal faster

➤ Helps reduce narcotic side-effects

ON-Q® PainBuster® is a non-narcotic post-surgery pain relief pump that provides continual and targeted pain relief where it’s needed most.

Offices in Bloomington and Peoria(309) 663-1222 or (888) 841-4108

THE CENTER FOR COSMETIC AND LASER SURGERY

C E L E B R A T I N G O V E R 1 8 Y E A R S

www.AskYourSurgeon.com

Rx only. ON-Q, PainBuster, and www.AskYourSurgeon.com are registered trademarks of I-Flow Corporation. Redefining Recovery is a trademark of I-Flow

Corporation. ©2008 I-Flow Corporation. All rights reserved.

www.drpoulter.com

CONFIDENCE IN CONTOURINGPaige Holt, M.D.Jeffrey S. Poulter, M.D. FACS

Eastland Medical Plaza1505 Eastland Drive, Ste. 350, Bloomington

(309) 663-1222www.osfplasticsurgery-bloomington.com

Dr. Keshav Joshi

W h a t W e T r e a t : • Back Pain • Myofascial Pain • Peripheral Neuropathy • Neck Pain • Sciatica • Failed Back Surgery • Work & Sport • Shingles Syndrome Injuries • Post Herpetic • Phantom Limb / Stump • Cancer Pain • Reflex Sympathetic Pain • Head Aches/Migraines Dystrophy • And More…

The Dr. John Warner Pain Center of Central Illinois is an interventional spine and pain center dedicated to relieving both chronic and acute pain. Contact us today to find out how we can help you address your pain needs.

2 1 7 - 9 3 7 - 5 2 9 7422 West White Street Cl inton, IL 61727

2 1 7 - 9 3 7 - 5 2 9 7


Ritalin has been heavily associated as the treatment of choice for those with ADD/ADHD. However, there has been increas-ing controversy over this option as more information about the

potential side effects becomes available. For some, this treatment op-tion seems to work as the patient seems calmer and is able to process increasingly complex situations. For others the results can vary, ranging from no effect to life threatening. It is always important to recognize and evaluate the risks and alternatives to any drug intervention and stimulants, such as Ritalin, are certainly no exception. It is well accepted by most holistic practitioners that a person’s diet has some influence on ADD/ADHD symptoms, but there is debate regarding exactly what that level of influence might be. It is relatively easy to monitor the specific level of influence. One test is to check your resting pulse and then recheck about 20 minutes after the food

is eaten. If there is a rise of 20 points or more then the food, or an ingredient in the food, is suspect of allergy. To confirm this, the food should be eliminated from the diet for one week while symptoms and episodes are monitored. Another way to test involves handwrit-ing changes that have been observed after a food is eaten. This is often most effective when a substance is suspect and should be eaten alone with handwriting occurring 20 minutes before the test, during the test, and 60 minutes after the test on separate pieces of paper. Another method of testing is to keep a food diary with cor-responding “mood monitoring” to identify any consistencies. While these methods may not be exact and may involve bit of “detective work”, they can serve as a good starting point. The major advantage to these methods is that neither the test nor the intervention carry the risks of drug therapy.

Nutritional Alternatives for ADD/ADHD

By Jessica Hoelscher D.C, Eastland Chiropractic & Wellness Center

holistic treatments


A George Washington University School of Medicine study found that hyperactive children who ate a meal high in protein did as well or better in school than their non-hyperactive counterparts. This has been established by many subsequent reports. An Oxford University study found that essential fatty acids (EFA) significantly improved symptoms of ADHD students. The connection between EFA and ADHD was first established in 1981 with subsequent research supporting this discov-ery while also establishing a similar connection for those with ADD. Later research confirmed that lack of Omega-3 fatty acids were a cul-prit for many with ADD/ADHD. Flax seed and flax seed oil have been shown to have the highest levels of Omega-3. It can be added to most recipes, semi-solid foods, smoothies, etc. with 1-2 tablespoons usually being sufficient. This is especially helpful for children who may not like foods where EFAs occur naturally (salmon, mackerel, etc). EFAs are critical components of the brain and nervous system and, along with other vitamins and minerals, are necessary for the brain and nervous system to function properly. Research also indicates that 95% of ADHD children were deficient in Magnesium. Another study identified a Zinc deficiency with ADD/ADHD children having 2/3 the values of children without ADHD. For over 30 years studies have supported the connection between be-havior and food colorings and at least one food preservative. Due to numerous similar reports the American Academy of Pediatrics agrees that it is reasonable to eliminate these from an ADD/ADHD child’s diet. Research supports the removal of artificial colors, especially red and yellow, and food additives such as aspartame, MSG, and nitrites. While some studies have shown caffeine to help with some ADHD symptoms, most experts still recommend avoiding caffeine as the side effects and risks often outweigh the benefits.

Ritalin and Adderral are classified as addictive substances which share an FDA Schedule II distinction along with cocaine, morphine, oxycodone, and methamphetamines. Some studies have concluded that Ritalin consumption may stunt growth, provoke seizures and chest pain, cause changes in blood pressure, lead to depression along with other side effects. Furthermore, it is not known what the long term side effects of taking these drugs are, especially on the developing child. This is not to say that drug therapy serves no useful purpose and should never be used, rather it is to inform parents whose children are diagnosed with ADD/ADHD that there are numerous negative potential consequences to drug therapy and it should therefore be considered only after other more conservative treatments have been exhausted. Nutritional adjustments are certainly a safer option that may be just as effective in some children. As always, your doctor should be consulted regarding supplementation and any changes you wish to make to cur-rent prescriptions.

Formoreinformation,youmaycontactEastlandChiropracticandWellnessCenterat309-662-8418,www.eastlandchiro.comTheyarelocatedat2406E.WashingtonSt.inBloomington.

“It is well accepted by most holistic practitioners

that a person’s diet has some influence on ADD/

ADHD symptoms, but there is debate regarding

exactly what that level of influence might be.”


Anjum Bashir, MD Psychiatry205 N. Williamsburg Dr. Suite E, Bloomington, IL

Say Goodbye to DepressionTranscranial Magnetic Stimulation (TMS) for Depression

FDA ApprovedNO MedicationsNO Weight GainNO Sexual Side EffectsNO Memory Loss

NO SeizuresNO AnesthesiaNO HospitalizationState of the ArtCutting Edge Technology

309-531-0050

EVALUATION AND TREATMENT OF ALL NEUROLOGICAL DISORDERS

1015 S. Mercer Ave.Bloomington, IL 61701

877.566.3879309.662.7500

www.cinhs.com

Central Illinois Neuro Health Sciences is the leading provider of neurosurgical, rehabilitation and pain management services in Central Illinois. A multimodality approach is taken in the management of intracranial, spinal and peripheral nerve diseases to best address the needs of our patients. Neurosurgeons, physiatrists, neuroradiologists, and pain management specialists work with referring physicians to provide comprehensive and technologically advanced care.

CINHS offers evaluation and treatment of all neurologicaldisorders including:

• Aneurysm • Arteriovenous Malformation • Back & Neck Pain • Brain and Spine Tumor • Carpal Tunnel & Peripheral • Nerve Pain • Cavernous Malformation • Compression Fracture • Facial Pain / Trigeminal • Neuralgia • Head & Spine Trauma • Hydrocephalus • Pituitary Tumor

Keith A. Kattner, D.O. • Emilio M. Nardone, M.D. • Jason Seibly, D.O. • Ann R. Stroink, M.D., FAHA

Documents

April Bloomington Healthy Cells 2011