Transcript
Page 1: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structural disorder,Structural disorder,

prions, prions, amamyyloidloids and s and polpolyyglutaminglutaminee diseasesdiseases

Institute of EnzymologyHungarian Academy of Sciences

Budapest, Hungary

Peter Tompa

Page 2: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

AmAmyyloid loid diseasesdiseases

Disease Protein/peptide Aggregate

Alzheimer’s disease

Primary systemic amyloidosis

Senile systemic amyloidosis

Diabetes type II

Hemodialysis-associated amyloidosis

Familial systemic amyloidosis

Huntingon’s disease

Parkinson’s disease

CJD, other prion diseases

Taupathies, Pick disease, FTDP-17

Page 3: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Amyloid diseases: “traditional” classification

systemic vs. tissue-specific

juvenile vs. adult or old

inherited vs. spontaneous

primary vs. secondary

protein vs. peptide

mass in kgs vs. almost negligible

(globular vs. IUP)

so what is common ???

Page 4: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Amyloid fibrils

• 10 nm

• straight

• stable

• tinctorial properties (Congo red)

• cross-b

Page 5: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Symptoms fall into two broad classes

Systemic cases

- organ failure (heart, liver, kidney)

Tissue-specific cases

- cognitive impairment (dementia, often with psychiatric symptoms)

- loss of coordination of movement

- neurodegeneration

Page 6: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Amyloid diseases

Disease Protein/peptide Aggregate

Alzheimer’s disease A Senile plaq

Primary systemic amyloidosis Ig light chain

Senile systemic amyloidosis Transthyretin

Diabetes type II Amylin

Hemodialysis-associated amyloidosis 2-microglobulin

Familial systemic amyloidosis Lysozyme mutant

Huntingon’s disease Huntingtin Huntingtin inclusion

Parkinson’s disease -synuclein Lewy body

CJD, other prion diseases PrPSc Prion aggregate

Taupathies, Pick disease, FTDP-17 Tau protein PHF, Pick-body

Page 7: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

1) Protein (AL, ATTR, ALys)

2) Cause (spontaneous, mutation, induced)

3) Mechanism (loss or gain of function)

Amyloid diseases: modern classification

protein misfolding diseases

Page 8: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

AD plaque Neurofibrillary tangle (PHF)

Alzheimer’s disease

Page 9: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Amyloid precursor protein (APP)

(TACE, ADAM10)

(PSEN)

Page 10: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

„Lag-phase” and „seeding” (1D crystal growth)

Chen et al. (2001) JMB 311, 173

Long

incubation time

Exponential growth

„Seeding”

Page 11: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Familial systemic amyloidosis:

LLysysozozyymmee mut mutantsants

I56T

D67H

Page 12: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Reduced stability of amyloidogenic mutants

Wild type

Ile56Thr

Asp67His

Booth et al. (1997) Nature 385, 787

Page 13: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

normal

kidney

liver

123I-SAP scintigraphy

Pepys

Page 14: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Huntington’s disease (Huntingtin)

MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNG…

ATGGCGACCCTGGAAAAGCTGATGAAGGCCTTCGAGTCCCTCAAGTCCTTCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAGCCGCCACCGCCGCCGCCGCCGCCGCCGCCTCCTCAGCTTCCTCAGCCGCCGCCGCAGGCACAGCCGCTGCTGCCTCAGCCGCAGCCGCCCCCGCCGCCGCCCCCGCCGCCACCCGGCCCGGCTGTGGCTGAGGAGCCGCTGCACCGACCAAAGAAAGAACTTTCAGCTACCAAGAAAGACC…

Page 15: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

PolyQ expansion: polymorphisms

Wells (1996) JBC 271, 2875

Page 16: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Huntingtin inclusions in neuronal nuclei

Perutz (1999) TiBS 24, 58

Page 17: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Cause of disease?

Loss of function

Gain of function

Page 18: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Anticipation in polyQ-disease inheritance

- dynamic mutation, mutable mutation -

Tsuji (1997) Int. Med. 36, 3

Ag

e o

f on

set,

DR

PLA

CAG repeat units

Page 19: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Prion diseases (TSE)

ANIMALANIMAL

SCRAPIESCRAPIE sheepsheep

BSEBSE bovinebovine

TMETME minkmink

CWDCWD deerdeer

FSEFSE catcat

HUMANHUMAN

kurukuru

CJD (Creutzfeldt-Jakob)CJD (Creutzfeldt-Jakob)

GSS (Gerstmann,Straussler, GSS (Gerstmann,Straussler,

Sheinker)Sheinker)

FFIFFI

Page 20: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

• rapid cognitive impairment (dementia)• movement disorders• spongiform degeneration

Page 21: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Chronology

• XVIIIXVIII c. c. scrapiescrapie• 19201920 CJD (CJD (heritableheritable))• 19391939 scrapie scrapie transmissibletransmissible• 19541954 scrapie: „slow virus”scrapie: „slow virus”• 19591959 kuru kuru resemblesresembles CJD CJD• 19591959 kuru kuru resemblesresembles scrapie scrapie• 19661966 kuru kuru c chimpanzeehimpanzee transmissi transmissionon GAJDUSEKGAJDUSEK• 19821982 „prion” Prusiner„prion” Prusiner• 19861986 BSE (BSE (first case)first case)• 19971997 NobelNobel prize prize PRUSINERPRUSINER

Page 22: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Ancient scrapie?

Wickner (2005) Science 309, 864

fleedisease = like rash

`

،

Page 23: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Chronology

• XVIIIXVIII c. c. scrapiescrapie• 19201920 CJD (CJD (heritableheritable))• 19391939 scrapie scrapie transmissibletransmissible• 19541954 scrapie: „slow virus”scrapie: „slow virus”• 19591959 kuru kuru resemblesresembles CJD CJD• 19591959 kuru kuru resemblesresembles scrapie scrapie• 19661966 kuru kuru c chimpanzeehimpanzee transmissi transmissionon GAJDUSEKGAJDUSEK• 19821982 „prion” Prusiner„prion” Prusiner• 19861986 BSE (BSE (first case)first case)• 19971997 NobelNobel prize prize PRUSINERPRUSINER

Page 24: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Stanley B. Prusiner

• strange pathogen (resistance to UV, heat etc…)

• purification

• transmission to mouse (incubation time 150-300 days)

• 1975-77: transmission to hamster (70 days)

P rPC

P rP sen P rP 2 7-3 0P rP res

P rPS C

1 2 32

infectedinfected

proteinproteinasease K K

Page 25: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Infectious protein ?Infectious protein ?

• no DNA • PrPsc and infectivity purify together• properties of PrPsc match those of prion• PrP: encoded by the host• inherited forms: mutations of PrP gene

1982proteinaceous infectious

PRION

Page 26: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Patholopgical prion: structure of PrPC

(PHGGGWGQ)5

A127GAAA*AGAVVGGLGG133

GPI

***

*

*

**

*

*P107L* P102L

Amyloid: mad-cow disease

Page 27: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Extension of theExtension of the prion prion conceptconcept::

physiologicalphysiological prion prionss

Two yeastTwo yeast geneti genetic elementc element [[URE3URE3]], , [[PSI+PSI+]]

• domindominantant, n, nonon--Mendelian inheritanceMendelian inheritance (mei(meioois)is)• non-chnon-chromosromosomalomal (c (cyytoplatoplasmicsmic))• metastabmetastablele (curable) (curable)• sselective advantage ?elective advantage ?

Page 28: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

normnormalal Sup35p = Sup35p = [[psipsi--]]

prion Sup35p = prion Sup35p = [[PSIPSI++]]

Sup35p (translation release factor 3, eRF3)

Suppression Suppression of nof nonsensonsensee mutmutationsations

Page 29: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Sup35p: eukaryotic translation release factor3

MSNPQDQLSNDLANASISGDQSKQPQQQQPQQQQPY

FNPNQAQAFVPTGGYQQFQPQQQQQYGGYQQNYTQY

QAGGYQQNYNNRGGYQQNYNNRGGYQQNYNNRGGYQ

QQQQQQYQAYNPNQQYGGYQAYNPQQQQQQQTQSQG

MSLADFQKQKAEQQASLNKPAVKKTLKLASSSGIKL

ANATKKVDTAKPAASKEASPAPKDEEASAEPEAKKE

STPVPASSSPAPAAADSTPAPVKKESTPTPSVASKS

APVSASASVVTADALAKEQEDEVDEEVVKDMFGGKD

HVSIIFMGHVDA........

Page 30: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Prion (amyloid) form of Sup35 promotes translation read-through

Page 31: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Sup35: disorder and modularity

Page 32: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Sup35: disorder and modularity

Page 33: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

„„Lag-phase” Lag-phase” andand „seeding” „seeding” (1D crystal (1D crystal growth)growth)

Chen et al. (2001) JMB 311, 173

Long

incubation time

Exponential growth

„Seeding”

Page 34: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Prion infection:Prion infection: „ „cross-cross-seeding”seeding”

Chen et al. (2001) JMB 311, 173

Long

incubation time

Exponential growth

„Cross-seeding”

Page 35: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Extension of prion concept:

prions and memory?

Page 36: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Hippocampus and memory

Page 37: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Aplysia californica

habituation, sensitisation

LTF GSW reflex

Eric Kandel

Page 38: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Aplysia neuronal CPEB is involved in LTF

5 x 5-HT

Si et al. (2004) Cell 115, 893

Page 39: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Si et al. (2004) Cell 115, 879

Aplysia neuronal CPEB is a prion

Page 40: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

The structure of amyloid(ogenic) proteins

Needs to be addressed:Needs to be addressed:

- structure of amyloidogenic - structure of amyloidogenic proteinprotein

- structure of intermediate- structure of intermediate

- structure of amyloid itself- structure of amyloid itself

Page 41: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structure of amyloidogenic proteins

Globular:lysoyzme

transthyretin (TTR)

insulin

b2-microglobulin

IDP:-synuclein

tau protein

polyQ regions

prion domains

Page 42: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structure: lyslysozozyymmee

I56T

D67H

Page 43: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structure: pStructure: polyQolyQ

Page 44: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Dedmon et al. (2005) JACS 127, 476

Structural ensemble of -synuclein

(NMR paramagnetic relaxation enhancement)

Page 45: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structure of amyloidogenic proteins

Globular:lysoyzme

transthyretin (TTR)

insulin

b2-microglobulin

IDP:-synuclein

tau protein

polyQ regions

prion domains

Page 46: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structure of amyloidogenic proteins

Globular: partial unfolding

lysoyzme

transthyretin (TTR)

insulin

b2-microglobulin

IDP: partial folding-synuclein

tau protein

polyQ regions

prion domains

Page 47: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

temp.temp.

Structure of the intermediate ?Structure of the intermediate ?

Page 48: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Partially ordered amyloid precursors

Uversky and Fink (2005) BBA 1698, 131

Page 49: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Wikipedia

SH3-PPII

The common denominator: polyproline II helix?The common denominator: polyproline II helix?

Page 50: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

PPII in a-synuclein PPII in a-synuclein (ROA)(ROA)

Syme (2002) EJB 269, 148

Page 51: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa
Page 52: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

57°C pH 2.0

Page 53: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structure of amyloid: cryo-EM

Page 54: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

A reasonable analogy: the Leu zipper

GCN-4 bZip

Page 55: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Polar zipper (vs. Leu zipper)

Perutz (1994) Prot. Sci. 3, 1629

Page 56: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Nelson et al. (2005) Nature 435, 773

Structure of Sup35 prion peptide (steric zipper)

DSNQGNNQQNYQQYSQNGNQQQGNNRYQGYQAYNAQAQPAGGYYQNYQGYSGYQQGGYQQYNPDAGYQQQYNPQGGYQQYNPQGGYQQQFNPQ

Page 57: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structure of A(beta) (1-40) protofilament

Luhrs (2005) PNAS 102, 16248

Page 58: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

Structural model of the CA150.WW2 Structural model of the CA150.WW2 protofilamentprotofilament

Ferguson (2006) PNAS 103, 162

Page 59: Structural disorder, prions, amyloids and polyglutamine diseases Institute of Enzymology Hungarian Academy of Sciences Budapest, Hungary Peter Tompa

PPooints of interferenceints of interference

Dobson (2004) Science 304, 1259


Recommended