Transcript
Page 1: Natural Awakenings - S.E. Louisiana May 2011

1natural awakenings May 2011

HEALTHY LIVING HEALTHY PLANET

feel goodlive simplylaugh more

FREE

Your Guide to

NATURAL BEAUTY

A HEAD-TO-TOE HOLISTIC APPROACH

MASSAGEBLISSFUL BENEFITS

NATURAL PETALZHEIMER’SALTERNATIVES

LOCALGARDENS

FRESH, HEALTHYSUSTAINABLE

MAY 2011 | S.E. Louisiana Edition | NOLANaturalAwakeningsMag.com

Page 2: Natural Awakenings - S.E. Louisiana May 2011

2 New Orleans NOLANaturalAwakeningsMag.com

Page 3: Natural Awakenings - S.E. Louisiana May 2011

3natural awakenings May 2011

Natural Awakenings is printed on recycled newsprint with soy based ink.

SUBSCRIPTIONSSubscriptions are available for $24 (for 12 issues). Please call 504-330-2157 with credit card information or mail a check made out to Natural Awakenings – S.E. Louisiana to the above address.

© 2011 by Natural Awakenings. All rights reserved. Although some parts of this publication may be repro-duced and reprinted, we require that prior permission be obtained in writing.

Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is avail-able in selected stores, health and education centers, healing centers, public libraries and wherever free publi-cations are generally seen. Please call for a location near you or if you would like copies placed at your business.

We do not necessarily endorse the views expressed in the articles and advertisements, nor are we respon-sible for the products and services advertised. We welcome your ideas, articles and feedback.

contact usPublisher/Editor

Lolita Werhan

Assistant EditorsLinda Sechrist • S. Alison Chabonais

Paul Scott • Linda Agnello Colleen Morgan

Design & ProductionPaul Scott

Advertising SalesLolita Werhan • Colleen Morgan

Distribution Gillian Rice-Duncan • Sonny Daniels

Clay Thomas • Peggy Scott Carey Mischler • Mel Borne Elizabeth Ohmer Pellegrin

Veronica Jeanfreau

To contact Natural Awakenings S.E. Louisiana Edition:

PO Box 750758 New Orleans, LA 70175-0758

Phone: 504-330-2157 Fax: 504-324-0131

[email protected] www.NOLANaturalAwakeningsMag.com

Attachment Psychotherapy / EMDR

“You too can move away from the past and towards a life of vitality, wholeness and fulfilling relationships.”

Individual, Couples& Family Therapy

Andrea Scheele, LCSW, LMFT1303 Amelia Street

New Orleans, LA 70115(504) 899-2686

Help your friends & clients achieve relaxation & healing in our fun, educational workshops! Open to anyone with an interest in the healing arts. CEUs available for LMTs.

Pure EnergyBodywork Seminars

Advanced Practitioner & Registered Instructor • 20 years [email protected] – 504-352-0039 – PureenergyBodywork.coM

Peggy Scott

June 11-12Visiting Instructor from Hawaii

Advanced Instructor, Richard Valasek, R.N.

Ortho-Bionomy Phase 5The Language of the Body

July 30-31Basics of Cranio-Sacral Therapy

Ortho-Bionomy®

Reflexology

Cranio-Sacral Therapy

Page 4: Natural Awakenings - S.E. Louisiana May 2011

4 New Orleans NOLANaturalAwakeningsMag.com

Let Us Design and Install Your Rainwater Harvesting System

6065 Magazine St., New Orleans, LA 70118

504-897-5001 • www.nolabamboo.com

Bamboo Fencing • Custom Natural Shades • Other Green Building SuppliesLarge selection of Bamboo Accessories and Gift Items

Our Products Give You Natural Beauty, Sustainability, Good Value and are Eco-Friendly.

Why Would You Buy Any Other Way?

• Grow healthier plants• Save money on your water bills• Minimize street flooding

• Minimize pollution from storm water into water works

letterfrompublisher

Like many of our readers, this year I will celebrate Mother’s Day as both a daughter and a mother. But really, I’ve been blessed with the mothering of three remarkable women.

Mom, a widow and single parent, worked full time in an era when fewer women worked outside the home; she was my role model when I too became a working mom. Because I was an only child, I also relished my regular childhood visits with Aunt Toby and my four cousins. Then along came Marjorie, my mother-in-law, a source of needed solace and support when my mother died during my 20s; she has stayed a wonderful presence in my life ever since. I can only hope that I have measured up to these women’s standards in mothering my son Ben. Now, at age 27, he thinks I’ve done a reasonably good job even though he summarily fired me at age three, shouting, “Well, you’re not my mother anymore!” It was a child’s response to not getting his way about something or other. Of course, the next moment that he needed comforting, I was back in his circle of trust. Such are the vicissitudes of motherhood. It isn’t easy to be a mother or father in any age, but today’s culture seems to carry exponential challenges. Many women work paid jobs. Fewer can rely on the many hands available through a local extended family. Most are so busy meeting family demands that they enjoy little caretaking time for themselves, even though it’s vital to their health and happiness and, therefore, the ongoing viability of family life. With that in mind, our Women’s Wellness issue explores “Natural Beauty ~ Head to Toe: A Holistic Guide to Looking Your Best,” on page 20. Here we see how to create a sustainable beauty plan by selecting effective products that are free of toxic ingredients. Please share this article as well as “Restorative Rubdowns: The Blissful Benefits of Massage” (page 25) with the women you know who will benefit from some tender loving self-care. Better yet, give them a gift certificate for a natural beauty treatment or a great massage from a Natural Awakenings-vetted

resource in our area. And yes, do it for yourself too. It couldn’t be Mother’s Day without gratitude to the

Mother Earth that sustains us. Urban gardening projects are taking root around Southeast Louisiana communities and Colleen Morgan explores nifty opportunities in “Community Gardens, Local Gardening Groups Offer Options,” on page 27. A local program with just the right level of involvement exists whatever your interest, from hands-on cultivating to simply purchasing luscious organic produce.

The benefits of local food production go far beyond supporting the health of ourselves and our planet. It’s another way we can invest in our local community while playing a vital role in a whole Earth.

In celebration and appreciation of good mothering,

Lolita Werhan, Publisher

Page 5: Natural Awakenings - S.E. Louisiana May 2011

5natural awakenings May 2011

advertising & submissions

HOW TO ADVERTISE To advertise with Natural Awakenings or request a media kit, please contact us at 504-330-2157 or email [email protected]. Deadline for ads: the 10th of the month.

EDITORIAL SUBMISSIONSEmail articles, news items and ideas to: [email protected]. Deadline for editorial: the 5th of the month.

CALENDAR SUBMISSIONSEmail Calendar Events to: [email protected] or call 504-330-2157. Deadline for calendar: the 10th of the month.

REGIONAL MARKETSAdvertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing fran-chised family of locally owned magazines serving com-munities since 1994. To place your ad in other markets call 1-239-449-8309. For franchising opportunities call 1-239-530-1377 or visit NaturalAwakeningsMag.com.

NaturalAwakeningsMag.com

contents

6 newsbriefs

10 healthbriefs

12 globalbriefs

18 naturalpet

25 healingways

30 consciousdining

31 calendarofevents

34 ongoingevents

35 classifieds

35 community resourceguide

Natural Awakenings is your guide to a healthier, more balanced life. In each issue readers find cutting-edge information on natural health, nutrition, fitness, personal growth, green living, creative expression and the products and services that support a healthy lifestyle.

6

7

9

16 GUMBO GREEN GAMES Meet the Participants

18 ALZHEIMER’S ALTERNATIVES Natural Therapies Can Help by Dr. Shawn Messonnier

20 NATURAL BEAUTY — HEAD TO TOE A Holistic Guide to Looking Your Best by Frances Lefkowitz

25 RESTORATIVE RUBDOWNS The Blissful Benefits of Massage by Linda Sechrist

27 COMMUNITY GARDENS Local Gardening Groups Offer Options by Colleen Morgan

20

27

18

Page 6: Natural Awakenings - S.E. Louisiana May 2011

6 New Orleans NOLANaturalAwakeningsMag.com

newsbriefs

New Spaces and Faces at Uptown Holistic

This spring the Uptown Holistic Center is budding with new

practitioners and services as well as new spaces for clients. The center has added two new treatment rooms and relocated its workshop to a separate building offering a more private and intimate setting for either small classes or massage therapy. “We create an informal but comfortable environment for our clients, inducing relaxation and rejuvenation,” said Ken Leavitt, Licensed Massage Therapist and Founder of the Center. “Our practitioners use a holistic, authentic and alternative approach while focusing on the physical and emotional well-being of our clients.” The Center offers a variety of services including massage, yoga, psychotherapy, acupuncture and more.

Visit the center’s website at UptownHolisticCenter.com or call Ken Leavitt at (504) 865-0966 for more information.

Community Gardens Tour On May 14 at 10 a.m., Parkway Partners will

hold a tour of three community gardens in the vicinity of the Parkway Partners Greenhouse in Central City. The tour will allow participants to meet and talk with the urban farmers who work the gardens and learn different methods and philosophies for urban farming. There will also be plants for sale at the Greenhouse. Future programs will cover seed and plant propagation on June 11, vegetables, fruits and

herbs for the home garden on July 11 and “Super Plants” for Louisiana in August. Check the calendar each month for the Parkway Partners Second Saturday programs.

All programs will be held at the Parkway Partners Greenhouse at 1137 Baronne Street. Gates are open from 9 a.m. to 12 p.m., with the program at 10 a.m.

Katrina Pets Inspired Reconnection Program

When The Reconnection team comes to New

Orleans in June, they will be offering a new program that was inspired by the pets who were victims of Hurricane Katrina. Introduction to Reconnective AnimalsTM will take place Thursday, June 2 from 5:30 p.m. to 7 p.m. at the Double Tree by Hilton, 300 canal St. in New Orleans. The program is free and open to the public. Renee Coltson will lead the Reconnective Animals program here. It was through the desire of Coltson and other Reconnective Healing practitioners to help the animals made homeless in the aftermath of Hurricane Katrina, that Reconnective Animals was born. This Introduction to Reconnective Animals will allow participants to explore the basics of Reconnective Healing and learn to help animals live happier and healthier lives. Coltson says the presentation will be filled with practical information and allow those attending to explore a powerful new spectrum of healing frequencies that have helped animals heal on all levels. Demonstrations with companion animals will offer valuable insights. The Reconnection team will be in New Orleans from June 2nd through June 5th. In addition to the Reconnective Animal program, Reconnective Yoga, another new program will be introduced. Level I and Level II Reconnective Healing will be taught by Eric Pearl himself.

For more information on programs or to register for the New Orleans events, visit TheReconnection.com or email [email protected]. Also check the ad on page 33.

Ken Leavitt, Founder

Page 7: Natural Awakenings - S.E. Louisiana May 2011

7natural awakenings May 2011

Eat Local ChallengeFor 30 days during the month of June, NOLA Locavores is challenging all New

Orleanians to eat all of their food from local sources – or at least more than they have in the past. The Eat Local Challenge is an effort to educate residents about the availability of local foods, ways to cook with them, and why they are an important part of a healthy lifestyle. Locally produced foods use less energy for transportation and refrigeration, while organically grown local foods have a tiny carbon footprint compared to that produced in agribusiness. Fresh local foods taste better and are healthier says Lee Stafford of NOLA Locavores. Participants can choose to be an Ultrastrict, eating only local food for 30 days, or to abide by The Bienville Rule, which is similar to that of the era of its namesake: in the 1700s, colonists had limited access to spices that were not local, but the rest of the food was from the region. Locavores following the Wild Card rule are “more forgiving” about non-local items that they cannot live without, such as coffee, sugar and chocolate. Some local restaurants will be offering “all local” dishes, and local food producers will be highlighted in a resource guide. NOLA Locavores hope to highlight that a key to eating local foods is to recognize that most food is seasonal, Stafford said. “We are also encouraging people to do processing and canning, so that they can have access to certain foods all year round. But that brings you back to the old days, when we connected with food when it is in season.” The Challenge will have a blog where participants can share information about recipes, local food sources, and tips. There will be a kick-off party or two and six contests: the 100% local sponsored by Rouses, the 100% local rum cocktail sponsored by New Orleans Rum, the Hollygrove Market box and Crescent City Farmers Market recipe contests, and recipe contests for wild game and Louisiana seafood.Anyone who registers pays a $20 fee and gets a t-shirt, a 10% discount at Hollygrove Market, a local food buyers guide, access to the blog and an invitation to the finale party on July 1. The last day to sign up is May 22 at the 3rd Annual Veggie Fest. See ad on page 24.

New Directions for Dr. Solomon Dr. Roy Solomon, Metaphysician and

Minister, has announced that he will close the Holistic Healing & Education Center, LLC, and the Holistic Center for Health & Healing, Inc. as of April 30. Dr. Solomon and his wife, Wendy, will move to the Raleigh, North Carolina area in May. Dr. Solomon and Wendy moved to the New Orleans area seven and a half years ago, being called to the area just prior to Hurricane Katrina. During his time here he was a positive force in pulling together the holistic community after the storm and in promoting holistic education to the community. Dr. Solomon is known for his work with Inner Child and The Reconnection healing. He recently completed a Ph.D. in Paranormal Phenomenon. Monthly meetings hosted by the Holistic Healing and Education Center, Inc. will continue under the direction of Suzanne Even in Metairie ([email protected]) and Bob Maurice in Covington ([email protected]). Dr. Solomon expressed his thankfulness to the community for the support he received while he practiced in New Orleans. Dr. Solomon may be reached at a new email address: [email protected]. Dr. Roy Solomon

Page 8: Natural Awakenings - S.E. Louisiana May 2011

8 New Orleans NOLANaturalAwakeningsMag.com

newsbriefsHealing Center Brings Revitilization to AreaThe former Universal Furniture building on St. Roch and St. Claude has been transformed

into a community center with a twist – 55,000 square feet of space dedicated to the ever-expanding variety of healing arts, from yoga, voodoo, and performance art to affordable banking, food access and educational facilities. The building, an architectural gem that was enveloped with a metal façade since its furniture days, will also include a green business hub, an ongoing arts and crafts bazaar, a women’s center and a cultural travel agency. Its redevelopment is to simultaneously provide space for small businesses to offer their services while creating a nexus that brings together the communities that have traditionally been divided by St. Claude Avenue. “This is a mission-driven organization,” said Administrative Director Mark Huber, referring to The Healing Center’s Credo that says, in part: “We believe our first responsibility is to our local and global community which includes the people and biosphere of New Orleans and the world at large, offering a holistic, safe, clean, sustainable center that provides services, products, and programs promoting physical, nutritional, emotional, intellectual, spiritual, economic, environmental, cultural, and civic well-being.” “This is an opportunity of a lifetime,” said Chuck Perkins, co-owner of performance theater Café Istanbul, explaining that the center has allowed him to escape the corporate world and pursue his dream. He expressed visible excitement about being part of a community dedicated to providing a culturally rich experience for the residents of the neighborhood and the city, and to be a part of its revitalization. “It has replaced an eyesore, and it is helping everything around it,” he said, noting the recent sale of an adjacent building for redevelopment. Tenants have begun moving in, and green business hub, The Building Block, which has been located at the Icehouse in Foubourg St. John since January 2010, is scheduled to open it second location May 1 on the third floor of The Healing Center. The Building Block offers office, warehouse, retail and manufacturing space for small businesses involved in green commerce, innovation and products. The purpose of co-locating such businesses is to decrease costs, increase productivity and promote professionalism. Two other such spaces will be opened by 2012.

The Grand Opening celebration for The Healing Center will be in July, when all of the tenants are moved in. For more information about the development and its plans, visit NewOrleansHealingCenter.org.

The colorful grand entry greets guests as they enter the building.

The answer to good health is Ionized Alkaline WaterFREE KANGEN WATER

& NEWSLETTERwww.healthquestph.com

Dave Kuhnau985-893-0925•985-502-4511

Why Drink Alkaline Water?

Your body is 70% water.

Most diets leave acid waste,which many experts agree is the founda-tion of disease. Ionized Alkaline

Water can increase your body’s PH and dramatically improve health

concerns like:Burning Feet•High Blood Pressure•Arthritis•

Diabetes•Obesity•Fatigue•

Keeping Cool with HerbsOn June 4th, the Baton Rouge Unit of The Herb

Society of New York will offer a workshop in Baton Rouge featuring nationally renowned cookbook author and herbal expert, Pat Crocker. In the workshop titled “Cool Ideas for Beating the Heat While Improving Your Health,” Crocker will offer hundreds of ideas for keeping cool during the summer including recipes for smoothies, yogurts and juices. She will demonstrate how to combine herbs, fruits and vegetables that will transform treats into treatments. In addition, during the luncheon, local herbalist Sharon Murphy will present how to transform iced tea into health drinks.

Registration is from 8:30 a.m. to 9 a.m., the workshop follows from 9 a.m. to 4:30 p.m. The fee is $75 pre-registered and $85 at the door ($65 for HSA and Burden Horticultural members). $10 off all registrations paid in full by May 1. Register at http://www.brherbs.com/Workshops.php.

Page 9: Natural Awakenings - S.E. Louisiana May 2011

9natural awakenings May 2011

“Out of the Shadows” “Out of the Shadows” will premiere Friday, May 20

as a benefit for the C. G. Jung Society of New Orleans. The play, produced by the Archetypal Theatre Company, opens in 1910, as Carl Jung is changing how people view the mind and human nature. Jung’s wife, Emma, aspires to help him develop the new science of psychology, but is thwarted by his new patient, 22-year-old Toni Wolff. The play tracks Toni and Emma’s rivalry for Jung’s heart and mind and their 40-year relationship, which parallels the development of the field of psychology.

The production will take place at 6330 St. Charles Avenue at Exposition Boulevard starting at 8 p.m., with food and spirits at 6:30 p.m. Tickets are $35 per person, $60 per couple, $100 for four. Donations are appreciated. All proceeds benefit educational programming of the C. G. Jung Society of New Orleans. Call 985-892-1534 to order tickets.

3rd Annual NOLA Veggie FestThe 2011 NOLA Veggie Fest promises to be the largest

vegan event offered in the area to date. The festival will be held from 10:30 a.m. to 6 p.m. on May 21 and 10:30 a.m. to 4 p.m. on May 22 at the Zeitgeist Multi-Disciplinary Arts Center at 1618 Oretha Castle Haley Boulevard in Central City. A fundraiser for the Humane Society of Louisiana, the event will feature speakers on a variety of topics, cooking demonstrations, vendors, belly dance performances and live music. Of course there will be the always popular samples of recipes and food products. For more information about the Veggie Fest and resources on vegetarian and vegan living, visit NOLAVeggieFest.org. See ad on page 2.

Boogalooing on the BayouFrom Friday evening until Sunday

at 7 pm, May 20-22, Mid-City will again be filled with locals and visitors interested in doing the Boogaloo. The music lineup is impressive, and lagniappe includes an art market, and health and wellness area, free massages, and yoga in the morning. The new disc a golf tournament is by reservation-only (email [email protected] to sign up). Saturday will feature the Zulu Anniversary Run to Ride and the Bicycle Pub Crawl (starting at 7am), and Sunday’s popular event is the second annual rubber duck derby, which will again benefit Second Harvest Food Bank. Both days there will be more than two dozen food vendors offering myriad choices of food.

The event will occur rain or shine. For a detailed schedule visit TheBayouBoogaloo.com. See ad on page 40.

Freret Street YogaGeoffrey Roniger opened Freret Street Yoga in 2010 bring-

ing a unique approach to yoga that has been described as emphasizing biomechanical alignment blended with intuitive movement and metaphor. While his teaching is grounded in Hatha yoga, students will find that he brings in other poses as he sees fit. He says he wants to keep it real for his students, so that they get the most out of their practice and, even more, are

able to experience the joy and sensuality of movement. A native New Orleanian, Roniger took his first yoga class the summer after start-ing college and knew immediately that this was something he wanted to explore to a much greater degree. After college he traveled to Europe where he studied yoga and helped to renovate a 19th century church into a yoga studio in Edinburgh Scotland. His experiences have included apprenticeships with Richard Rosen and Rodney Yee at the Piedmont Yoga Studio. For the past five years he has taught yoga on-site at a number of large corporations in San Francisco where he created Workplace Wellness, an effective and accessible program using modified yoga techniques to counteract the negative effects of sitting all day at a desk. Since 2006 he has served on the teacher training staff at The Yoga Loft in San Francisco.Group classes are offered 6 days a week. In addition, private sessions with Geoffrey Roniger, Workplace Wellness programs and retreats are available. Class schedules and fees are listed on-line. The studio is located at 4608 Freret St. For more information call 504-575-7128 or visit on-line at FreretStreetYoga.com.

Friday-Sunday May 20-22

Bayou St. JohnNew Orleans

TheBayouBoogaloo.com

PMS 300CMYK = C=100 M=43

ART FOOD MUSIC

Rockin’ Dopsie Jr, DJ Jubilee,Delfeayo Marsalis’

Sweet Thunder, Cyril Neville & Tribe 13,

Pinettes Brass Band, Grupo Fantasma, Los PoBoy Citos, Big Chief Alfred

Doucette and many more!

Page 10: Natural Awakenings - S.E. Louisiana May 2011

10 New Orleans NOLANaturalAwakeningsMag.com

Whole Grains Dispose of Body Fat

Here’s yet another reason to switch completely from refined flour products to whole grains. In a new study by the Jean Mayer USDA

Human Nutrition Research Center on Aging, at Tufts University, adults who ate three servings of whole grains a day while also eating less than one serving a day of commercially enriched flour products had less of a type of fat tissue that is thought to play a key role in triggering diseases. The fat is known as visceral adipose tissue, or VAT, which surrounds internal organs. The researchers examined 2,834 participants, ages 32 to 83, and VAT volume was approximately 10 percent lower in the healthy eating group. However, lead study author Nicola McKeown, Ph.D., explains that, “Whole grain consumption did not appear to improve VAT vol-ume if refined grain intake exceeded four or more servings per day. This result infers that it is important to make substitutions in the diet, rather than simply adding whole grain foods. For example, choosing to cook with brown rice instead of white, or making a sandwich with whole grain bread instead of white bread.”

healthbriefsnewsbriefsMORE REASONS TO SEE A DENTIST REGULARLYA study led by a University of California researcher gives

women an extra incentive to visit their dentist regularly. Data collected from nearly 7,000 participants suggests that women who receive regular dental care reduce their risk of heart attacks, strokes and other cardiovascular problems by at least one-third. The findings, published in the journal Health Economics, compared people who visited the dentist during the last two years with those who did not.

Hot Flashes Signal Good NewsWomen who have experienced hot flashes and

other menopausal symptoms may have as much as a 50 percent lower risk of developing the most common forms of breast cancer than postmenopausal women who have never had such symptoms, accord-ing to a new study by the Fred Hutchinson Cancer Research Center. Commenting on the study, breast cancer Oncolo-gist Dr. Stefan Gluck, of the University of Miami’s Syl-vester Comprehensive Cancer Center, observes that the reduction in risk evidently linked to a natural decrease in estrogen is substantial. “At age 50, a woman has on average, a 2 percent risk of getting breast cancer; so if she experiences menopausal symptoms, the risk is suddenly only 1 percent,” he says.

How Do Your Veggies Grow? Any home vegetable gardener

can enter the Home Vegetable Garden Contest to show off vegetables planted in the spring 2011 season. Sponsored by the LSU AgCenter and the German Coast Farmers’ Market (GCFM), this contest will take place at the Ormond Plantation, 13786 River Road in Destrehan. Contestants must sign up between May 4 and May 25 at the GCFM East Bank market (Ormond Plantation, Saturdays from 8 a.m. to 12 p.m.) or the GCFM West Bank market on Wednesday evenings from 3 p.m. to 6:30 p.m. (St. Charles Plaza, 12715 Highway 90, Luling).

On the contest day, participants must have at least three of each and no more than eight types of vegetables displayed in a basket or a tray, and have their entries ready for inspection, with a picture of the gardener in the garden, by 9 a.m. Each display will be judged and prizes will be awarded based on overall quality, appearance, and freshness. For more information, visit GermanCoastFarmersMarket.org.

Page 11: Natural Awakenings - S.E. Louisiana May 2011

11natural awakenings May 2011

WATERCRESS MAY HELP BUST CANCERWatercress not only adds unusual texture and tang to a salad, it may also contribute an unexpected health benefit. A short-term pilot study by the University of Southampton, UK, indicates that the plant compound phenylethyl isothiocyanate, found in unusually high concentrations in the peppery herb, may help suppress breast cancer by interfering with a protein function that spurs cancer cell development. The compound apparently works to block the signal that a tumor sends out, calling for surrounding normal tissues to grow new blood vessels to feed it, thus starving the tumor of oxygen and nutrients. More research is needed.

How Laser Heat Fights WrinklesLaser treatments have long been

widely used by beauticians and dermatologists to smooth wrinkles; now research reveals why the treatments work. Susanna Dams, Ph.D., describes the process in her biomedical engineering doctoral dissertation for Eindhoven University of Technology. The principle of laser therapy involves introducing heat under the skin with precision.

Dams first tested the effect of heat on cell cultures by giving them heat shocks of 113 degrees and 140 degrees Fahrenheit without a laser, to exclude possible effects generated by the laser light. Next, she conducted similar tests on pieces of excised human skin. Finally, she heated pieces of skin with a laser. The results showed that the heat shocks led to increased production of collagen—a crucial factor in natural skin rejuvenation that declines after the age of 25, causing wrinkles to form and skin to sag. The best rejuvenation effect in Dams’ research resulted from a heat shock of 113 degrees lasting eight to 10 seconds; her work further showed that just two seconds at the higher temperature damages skin cells.

Chemical AlertAccording to a new study from

the University of California–San Francisco, the bodies of virtually all U.S. pregnant women carry multiple manmade chemicals. Some of those counted are found in flame retardants now banned in many states; some were used in the DDT pesticide that was banned nationwide in 1972. Other chemicals of concern continue to be used in non-stick cookware, packaging of processed foods such as metal cans, and personal care products. Because chemicals can cross from the mother through the placenta and enter the fetus, exposure during fetal development is problematic. The researchers note that prior studies have shown that such exposure increases the risk of preterm birth, birth defects and childhood morbidity, as well as adult diseases and earlier mortality. The new study marks the first time that the number of chemicals that pregnant women are exposed to has been counted; it analyzed for a total of 163 possible chemicals.

Attention! Providers of Healthy& Green Products and Services:

Natural Awakenings invites you to join our discount network focusing on natural health,

well-being and a green lifestyle.

We are NOW building ourSoutheast LouisianaProvider Network. To become a NAN Provider, contact 504-330-2157.

Page 12: Natural Awakenings - S.E. Louisiana May 2011

12 New Orleans NOLANaturalAwakeningsMag.com

globalbriefs

Early Detection Simple and Pain FreeHow Infrared WorksMedical Infrared is the branch of medicine that derives important diagnostic information about your breast health through the objective analysis of naturally radiating infrared energy (heat) emitted from the human body. It is an especially sensitive screening technology capable of detecting early stage cancer growth 8 - 10 years before a lump is detected by mammogram or self-exam.

No Compression of Breast TissueNo RadiationFDA ApprovedResults Written For Patients and Their Doctors$199.00 when you mention this ad

In Metairie at 3117 22nd StSuite 3near Causeway and Veterans

(504) 460-9035

Bicycle EconomyMay is National Bike MonthBikeway networks are emerging along urban, low-traffic streets as residents employ increasing pedal power in cities like Cambridge, Massachusetts; New York City; Portland, Oregon; and San Francisco. Tourism and transportation trend watchers note that the amount of on-street bicycle parking provides a ready gauge to how rider-friendly a city is. Still, according to the findings of a National Household Travel Survey that 40 percent of all trips we make are two miles or less, the International Bicycle Fund (IBF) reports that Americans choose a bike over a car for only 11 percent of these trips. In Europe, which favors walkable cities, Amsterdam commuters lead the way by choosing their bikes 28 percent of the time, followed by 20 percent in Denmark, 10 percent in Germany, 8 percent in the United Kingdom and 5 percent in both France and Italy (versus 1 percent by U.S. city commuters). According to the U.S. Department of Transportation, at least a quarter of Americans age 16 and older will likely ride a bicycle sometime this summer. The National Survey of Pedestrian and Bicyclist Attitudes notes that 26 percent of American bicyclists ride for recreation, and 24 percent for health. Additional reasons include getting home (14 percent), errands (14 percent), visiting (10 percent), commuting to school or work (5 percent) and “other.”

BikeLeague.org, the official website for Bike-to-Work Week, May 16-20, hosts a searchable database of bike clubs and ride resources.

504-376-8518www.NoLaReiki.com

Elizabeth Ohmer PellegrinReiki Master Teacher & Practitioner• Monthly Classes• Private Classes

• After Class Support• Reiki Treatments

For over 20 years, I have brought this soothing and gentle, yet powerful, tool for healing and self-healing to others

through my private practice and classes.

Australian Bush Flower Essences

ReikiUSUI SHIKI RYOHO

Custom Blended Essences • Classes (Natl LMT CEUs avail)

Pets • Rescue • House/Office Clearing

News and resources to inspire concerned citizens to work together in building a healthier, stronger society that benefits all.

Page 13: Natural Awakenings - S.E. Louisiana May 2011

13natural awakenings May 2011

Bundled DeductiblesBreast-feeding Benefits Now Recognized by the IRS

Until its 2011 decision for the 2010 tax year, the Internal Revenue Service did not classify breast-feeding supplies as tax deductible because it viewed them as nutritional benefits, instead of medical care expenses. Now, under a new ruling, nursing mothers can write off breast-feeding equipment if they have flexible spending accounts or if their total medical expenses exceed 7.5 percent of their adjusted gross income. U.S. Surgeon General Regina M. Benjamin has issued a call to action to support breast-feeding, stating that it can protect babies from infections and illnesses, including pneumonia and diarrhea. Breast-fed babies are also less likely to develop asthma and to become obese, according to the report. First Lady Michelle Obama has declared her support for breast-feeding as part of her campaign against child obesity. The American Academy of Pediatrics has spent years trying to roll back the push for infant formula, trumpeting the benefits of breast-feeding exclusively for the first six months of life (the World Health Organization promotes breast-feeding for two years). A recent Harvard Medical School study published in the journal Pediatrics estimated that if 90 percent of American women breast-fed, 900 premature, infant deaths would be prevented and patients and hospitals would see savings of $13 billion in lost wages and saved health care costs.

Come Home to your HeartReconnect with your passion through PSYCH-K®

Marylou SmithAdvanced PSYCH-K® Facilitator

PHONE AND ON-SITE SESSIONS AVAILABLE

My Spa by the Park • 6312 Argonne Blvd, NOLA 70124 • 504.723.2899marylousmith.com • [email protected] • psych-k.com

The gentle process of PSYCH-K® realigns our mind with Source. United with this unlimited power, we release fears, unresolved resentments, unhealthy habits and are free to create a life of passion and purpose.

•Closedsystemcolonirrigation•Certifiedcolonhydrotherapist•I-Actmember•Privacyanddiscretionassured•Infraredsaunaincludedwithservice•$30offanypackages

2627 General Pershing | New Orleans LA 70115www.uptowncolonhydrotherapy.com

Not All Health Benefits are Easy to Talk About. Make an appointment today! Call 504-644-7376

Your First Consultation and Colonic is Only $125

Uptown Colon Hydrotherapy

ColoniC and Sauna PaCkageS offered!

A holistic approach to women’s gynecological and overall healthcare

A practice of preventative and wellness medicine KATHLEEN POSEY, M.D.

Diplomate American Board of Obstetrics and Gynecology,

Diplomate American Board of Anti-Aging and Regenerative Medicine

Healthy, Medically Supervised

985-845-4111377 Highway 21, Suite 101, Madisonville

WEIGHT LOSS PROGRAM

Page 14: Natural Awakenings - S.E. Louisiana May 2011

14 New Orleans NOLANaturalAwakeningsMag.com

Specializing in:Shiatsu • Swedish • Deep TissueEssential oils used for maximum results

Relax and Feel the Healing Benefits

of a Personalized In-Home Massage

Relax and Feel the Healing Benefits

of a Personalized In-Home Massage

CHANGE IN MOTION MASSAGE, LLCMel Borne, LMT #4158

Northshore AreaCall 985-869-2087 today for your appointment!

Life as an Art FormLive Art Studio

“Home of the Eco-Friendly Green Haircut”

www.liveartstudio.com

Patti Spring,Reiki Master, LMT#136930 yrs exp. Hair Stylist

Tues – Sat 10am to 6pm

Aromatherapy Massage

featuring: Warm Stone, Swedish, Reflexology,

Shiatsu & Reiki

Full Service Hair Salon

Arts & Healing Center

4207 DumaineMid-City

504.484.7245

If you want to be treated as the whole being you are, AVIVA Massage & Well-Being Center on The Northshore is for you. View our services & purchase gift cards at www.avivamassage.com.

Make an appointment at www.avivamassage.com

or call985-727-9665

601 Lafitte St, Mandeville

A Service of HeartLight Enterprises, LLC #E2445

BodyworkEnergy ModalitiesCert. Hypnotherapy Massage MeditationReiki Workshops

14 New Orleans NOLANaturalAwakeningsMag.com

Karen Boudreaux, LMTLA #5214

985-276-8119KarenBoudreauxLMT.com

[email protected]

Relaxation, Therapeutic & Structural Massage

NOW At LIFT Training Studios

in Mandeville!!CALL NOW or BOOK ONLINE

Massage &

Bodywork

Page 15: Natural Awakenings - S.E. Louisiana May 2011

15natural awakenings May 2011

• Learn through Practice to Teach theory, application, and philosophy of Hatha yoga and Raja yoga

• Study with a Master Level Teacher who has more than 25 years' experience. Teaching lineage of T. KRISHNAMACHARYA

www.yogaschoolcovingtonla.com

Yoga School LLC603 S. Tyler St. • Covington, LA • 985-893-8834

BECOME A CERTIFIED YOGA TEACHER A Registered Yoga Alliance Program in a State Licensed School

20 Years of Leadership in Yoga Training

BECKY GELATT ERYT 500 A.V.I. Certifi ed

Call today for an interview!

This client-centered yoga therapy honors your inner wisdom and welcomes the exploration of emotions, thoughts and spirit through the body. “It’s a work-in, not a workout...”

Phoenix Rising Yoga Therapy

for Individuals and Couples

Stress to Bliss Groups

Amy Archinal, RYTCertified Phoenix Rising

Yoga Therapist and Group Facilitator

www.neworleansyogatherapy.com

(504) 400-5203

15natural awakenings May 2011

Transform Your Life!Shanti Yoga Shala

by Nathalie CroixA Vinyasa Yoga Studio

Class Schedule at www.shantiyoganola.com

3528 Magazine Street New Orleans, LA, 70115 310-435-6098

yoga

Page 16: Natural Awakenings - S.E. Louisiana May 2011

16 New Orleans NOLANaturalAwakeningsMag.com

Gumbo Green Games – Meet The ParticipantsEVERY MONTH FOR THE NEXT 12 MONTHS WE WILL OFFER PROFILES OF THE BUSINESSES AND

ORGANIZATIONS WHO HAVE COMMITTED TO BECOME THE MODELS FOR SUSTAINABLE BUSINESS OPERATIONS IN SOUTHEAST LOUISIANA BY SIGNING UP. THE GAMES HAVE BEGUN!

FELDMEIER GALYEAN

FeldmeierGalyeanisaNewOrleans-

baseddesignfirmthatprimarilyenvisionsresortsbuthasalsodesignedmuseums,restaurants,andprivatehomes.Withaninterdisciplinaryteamalsorepresentinglandscapearchitects,interiordesigners,andartisans,thefirmconsiderstheprograms,operationsandfinancialsastheycreateavisionforaproject.Thefirm’sachievementsincludeTheBroadmoorHotelinColoradoSpringsandHotelHersheyinHershey,PA.Thecompanyhasintegratedenvironmentalconcernsintoitsdesignapproach,consideringtheclient’sinterestsandtheregioninwhichtheprojectisplannedtodevelopsystemsthatarebestsuitedforthatproject.TaylorGalyean,aprincipalofthefirm,saidtheenvironmentalaspectsofadesigndependontheclient,butthechoicesarealwayspresented.InthecaseoftheNationalOutdoorLeadershipSchool(NOLS)inBaja,Mexico,theclientswereextremelysupportiveofsustainablesystems,includingcompostabletoiletsandrenewableenergy.Thecompany’sofficeonOctaviaStreetisveryenvironmentallyfriendly,Galyeansaid,butLifeCitycouldoffergreaterinsightintomethodsforimprovement.“It’sfairlyeasytocomeupwiththethreethingstodothatsoundgreen,”hesaid,“butthereisadeeperbodyofknowledgethatwecouldbeimplementingthatwedon’tfullyunderstand.”TheGreenGamesgivesbusinessesanopportunitytoexploretheiroperationsandimprovetheirpracticesenvironmentallyandotherwise.“Thepotentialsavingsofthose

practicesfaroutweighcostofbecomingpartofTheGreenGames,”henoted.“Itisaboutwhatareyoudoingfortheworldaswellaswhatyouaredoingforyourownpocketbook.”

Online at FeldmeierGalyean.com

GREEN SERENE

GreenSereneisashoponMagazineStreetthatoffers

eco-friendly,sustainableandfairtradeclothing,accessoriesandgifts,manyofwhicharemadebyartisansinNewOrleans.TheshopispartoftheGreenLightDistrict,anassociationofgreenbusinessesintheLowerGardenDistrict.“Peopleare,ingeneral,becomingmoreconsciousoftheirpurchases,”saidownerJamieMenutis.“….Insteadofchoosingthatcheapt-shirtmadewithpesticidesthat’sgoingtofallapart,makeasmarter,moreresponsiblechoiceinstead.”Thestaffatthestore,whichopenedinlate2009,constantlyeducatesthepublicabouteco-friendlyfabricsanditems.“Manypeopleareunawareoftheeffectsofwhatthey’vebeenpurchasinginthepast,”Menutissaid.Therearemoresustainablealternativessuchasbamboo,soysilk,cupro,hempandorganiccotton.Notonlydothesefabricshavelittletonoeffectupontheenvironment,thecompaniesthatproducethemusefairlaborpractices.Supportingnewdesignerswhochoosetoworkwithsustainablefabricsalsoincreasestheirdemand.Menutiswantstohelpcreatetheworldherdaughterwillinherit,shesaid.Sincesheisalwayslookingforwaystoreducehercarbonfootprint,shesignedupfortheGreenGamestolearnmorewaystoimprove.

“Noneofusisperfect,butifwealldoabitandsay,‘nothanks’toplasticbags,orchoosetowalkratherthandrivetoday,wemakeadifferenceeachdayandthesedifferencesaddupinbothoureverydayandbusinesslives,”shesaid.

For more information visit GreenSerene.biz

EGAN CONSTRUCTION MANAGEMENT

EganConstruction

Management(ECM)providesstormwatermanagementsolutionsforcommercialandresidentialcustomers.Thecompanyutilizesperviousconcrete,cisterns,drainsandnativelandscapestoprovidesitespecificsolutionstostormwatercontainment.Startedin2007tohelpthecitywiththefloodinganddrainageissues,ECMfoundthatperviousconcretecombinedwith“performativelandscapes”canreducetheenvironmentalimpactofraininthecity,mostofwhichisbelowsealevel.“Werecognizedthatgreenbuildingisnotafadandit’sheretostay,”saidMarcoTepete,ECM’sfieldsupervisor.ECMisaleaderintheregioninstormwatermanagementstrategies,havingworkedwiththeMakeItRightFoundationintheNinthWardandinstallationsonmorethan70LEEDPlatinumprojects.LEEDisthecertificationsystemdevelopedbytheU.S.GreenBuildingCouncil.Thebenefitsofpervioussurfacesarenoteasilyrecognizabletomostpeople,however,

EganConstruCtionManagEMEnt

Look

Great

and

F

eel G

reat

!

New Patient Special

$75 off any wellness service

Offer Expires May 18, 2011• Nutritionalconsultswithpersonalizedplans

• Bioidenticalhormonebalancing

• DetoxificationwithEBCellularCleanseandFarInfraRedSauna

• Endermologie

• Zeronalaser-losefatwithlight…notliposuction

Enjoy A MorE VibrAnt LifE–ChoosE hEALth

Dr. Debbi Hannan

hAnnAnWELLnEss.CoM

ChiroprACtiC hEALth CEntEr & hoListiC hEALthCArE sErViCEs

Lose Weight the Healthy Way

Look Great and Feel Great!504-454-2000

101ClearviewPkwyatAirline

Page 17: Natural Awakenings - S.E. Louisiana May 2011

17natural awakenings May 2011

andeducationisthecompany’sgreatchallenge.Impervioussurfaces,bycontrast,forcerainwaterintostormdrainsthatendsupinthecity’spumpingsystem,accountingfor40percentofthecity’senergyuseandcarbonemissions.Themorewaterinfiltratesintothegroundthelessgoesintothestormdrainagesystem,whichreducestheloadonthepumpingsystemwhileitrechargesthegroundwater,reducingsubsidence.ECMsignedupforGreenGamestoeducatethepublicabouttheservicesECMprovidesandtofurtherestablishthecommitmenttogreenpracticesthroughoutthecompany,Topetesaid.“It’stheonlyway[toshow]thatourpromisetoourclientsistrue.”

Visit ECM at ECMNOLA.com THE GREEN PROJECT

TheGreenProjectsellssalvagedbuilding

materialsatawarehousestoreandlumberyardintheBywater.Thesematerials,whichtheorganizationactivelysolicitsfromthepublic,businesses,agenciesandindividuals,wouldotherwisegointolandfillsaroundNewOrleans.Theorganizationalsoholdsworkshopsonenvironmentaltopics,primarilyontheR’sofsustainability:reduce,reuse,reclaim,repair,recycle,repurpose,restore,rehabilitate.TheGreenProjectservesasaresourceforresidentswhowanttorepurposetheirdiscardedmaterialsandotherswhoarelookingformoreaffordablebuildingproducts.Nowtheorganizationacceptsavarietyofrecyclablematerials,includinge-waste,processesover35,000gallonsofpaint,anddivertsmorethan1.8millionpoundsofusablematerialsfromthewastestreameveryyear.OnSaturdays,itoffersworkshopson“greener”living.So,accordingtooutreachcoordinatorBethStelson,itmakessenseforTheGreenProjecttosignupforGreenGames.“Everyorganizationshouldstrivetobemoreenvironmentallyresponsible,”shesaid.“That’swhyweareparticipating,becausetherearealwayswaystoimprove.”Sheexplainedthatitisoftendifficultforpeopleimmersedinanorganizationtoseewaystoimproveit,soitisgoodtohaveanoutsidertakealookattheentireoperation.“Wearelookingforsomeinsight,”shesaid.

TheGreenProjectisalsoinvolvedasawaytolendsupporttothecompetition,withthehopesthatotherbusinesseswillmakethecommitmentandcompeteaswell.“Asmorepeoplecompete,themorethereisadrawtoit.”

To find out more visit TheGreenProject.org

YOUNG LEADERSHIP COUNCIL

TheYoungLeadershipCouncil(YLC)isacivicgroupofyoungprofessionalsthatperform

communityserviceprojectstoimprovethequalityoflifeinthecityanddevelopleadersthroughservice.TheYLCprovidesyoungadultsfromtheirtwentiestotheirearlyfortieswithopportunitiestoengageincommunityprojects,allofwhicharevolunteercreatedandoperated.Thereareusuallysevento12suchprojects,andtheyrangefromeducationtocivicpridetotheenvironment.Therearecurrentapproximately1,600membersoftheYLC,Collinssaid.WhilemostoftheYLC’smembersgetinvolvedin“breadandbutter”projectssuchasmentoringkids,everyfewyearstheorganizationtakesona“signatureproject,”thefirstofwhichwastoraise$500,000toilluminatetheCrescentCityConnectionbridgeafterthesecondspanwascompletedsoonaftertheorganizationwascreatedin1986.Inadditiontoartinstallationsallovertown,suchasthestreetcarsafterKatrina,itwasalsoresponsibleforthebumperstickerswiththeslogan“NewOrleans.ProudtoCallItHome.”“Youngprofessionalsareveryenvironmentallyconscious,andYLCneededanoutletforthatinterest,”Collinssaid,notingtheYLCprojectcalledGreenIt.“Thisisnewareaforus,but[TheGreenGames]fitsrightin.”TheotherenvironmentalprojectsYLCmembersareinvolvedinincludevolunteeringforthecity’srecyclingdays,maintaininganareaofCityParkYLChas“adopted,”andworkingattheLSUAgCenter’sWetlandPlantCenterinthepark.YLCmembershavealsoinstitutedrecyclingprogramsattwoschoolsandareworkingoninstallingbikeracksaroundthecitythroughtheWhereYaRackprogram.

Find them at YoungLeadershipCouncil.org

REFRESH ENVIRONMENTAL

RefreshEnvironmentalisabiofuelscompanythat

focusesonwaste-cookingoilandgreasecollection,processing,andmarketingtodevelopaliquidwasterecyclingecosystem.Thecompanypicksupwaste-cookingoilsfromrestaurantsandgrocerystoresthenprocessesitintomarketablecommoditiesandgeneratesrevenuesfromthesale.RefreshcreatesjobsandhelpscreateasustainablewastefuelecosysteminLouisiana,whilepartiallyreducingthenetimportsofforeigncrudeoil.Thecompany’sfounders,BrandonIglesias,LarrySpegele,andBobbyIglesias,decidedtoenterthewastegreasemarketlastyearbecausetheothercompaniesinthisindustrywerefromoutofstate.In2006,BrandonIglesiasbecameinterestedinbiofuelsandsustainableenergyproductionwhilelivinginVirginIslands,wherethepriceofelectricitysoaredduetohighenergypricesdrivenbythepriceofcrudeoilandotherfactors.WithachemicalengineeringdegreefromLSU,heisclosetofinishingadualMastersofBusinessandFinancefromTulaneUniversity,withanenergytradingconcentration.“Refreshcontinuallystrivestoimproveourenvironmentalperformancebyreusingandrecyclingallofourbyproducts,”BrandonIglesiassaid.“Wealsoworkwithotherbiofuelcompaniestocollectandreusetheirwastebyproducts.”Refreshrecommendsthatotherbusinessownersconsidertheeconomicandenvironmentalimpactoftheiroperationsandtakestepstoimprovethemiftheyarefinanciallysound.RefreshsignedupfortheGreenGamestosupportLifeCityandbecauseitpromotesenergyefficientinfrastructureaswellassocialactionstoimprovetheenvironment.Participatingallowsthecompanytoactivelyparticipateinthecity’ssustainabilitymovement.Online at RefreshEnvironmental.com

REFRESHENVIRONMENTAL

504-466-2266

Gina L. Orihuela, LCSW-BACS, ND, CTN Licensed Clinical Social WorkerBoard Approved Clinical SupervisorDoctor of NaturopathyCertified Traditional Naturopath

Individual, Family & Group CounselingChildren, Adolescents & AdultsClinical SupervisionNatural Health Consultation

3213 Florida Ave, Suite D, Kenner, LA 70065

Holistic Psychotherapy & Counseling Now accepting clients!

Helping You Find Your Inner ‘GLO’, Because You Deserve To Shine

Page 18: Natural Awakenings - S.E. Louisiana May 2011

18 New Orleans NOLANaturalAwakeningsMag.com

Canine and feline Alzheimer’s disease, also known as cognitive disorder, is the most common

chronic degenerative problem for older dogs and cats, especially past the age of 10. It affects millions of pets in the United States.

The cause of Alzheimer’s in animals is unknown. It appears, however, that inflammation may play a role. On the microscopic level, scientists have noted the presence of abnormal protein accumulations occurring within the brain’s blood vessels, similar to those

in people with Alzheimer’s. Ultimately, the brain lesions interfere with proper functioning of nerve transmissions.

Clinical Signs Several signs may indicate cognitive disorder in affected dogs, including:

n Staring at a wall

n Lack of awareness of surroundings

n Occasional lack of recognition of the owner

ALZHEIMER’SALTERNATIVES

Natural Therapies Can Help by Dr. Shawn Messonnier

naturalpet

Raw meat diets - free range meat & bones - Innova & Innova EVO Solid Gold - California Naturals - Herbal supplements & vitamins Large selection of natural treats, toys & pet accessories

natural pet care

Dr. Adriana Sagrera, DVM504-834-2023 • www.drsagrera.com

3825 Hessmer Ave, Metairie, LA 70002

Homeopathy • Herbal Medicines • Nutrition • Skeletal Manipulation

Acupuncture

Chinese Herbal Medicine

Food Therapy

Nutritional supplements

Trigger Point Therapy

VETERINARY HOLISTIC HEALING

I strive to heal your

beloved pet’s whole being, not just treat

the symptoms.

Janice E. Posey, DVM985-898-3623/504-466-9129

315 Lee Lane, #104Covington, LA 70433

Five-Session Love Shift Package Get One Session FreeSee website or email us for details

Is love not working out like you dream it could?Come access the tools to manifest soulmate love into your life or to shift romance with your mate to the way you wish it could be.

Extravagance of LoveFlora Radding, Certified Love Attraction Coach [email protected]

Manifest Great LoveMaster Emotional Technology

www.extravaganceoflove.com

Page 19: Natural Awakenings - S.E. Louisiana May 2011

19natural awakenings May 2011

n Lethargy/lack of energy

n Excess sleep (especially during the day)

n House-training problems (usually urinating inside the house)

n Deafness

Cats share the same clinical signs of cognitive disorder as dogs, plus the following:

n Poor coat (excessive shedding or thin, dry coat)

n Poor appetite

n Chronic constipation

n House-training problems (usually urinating outside the litter box when other problems related to anxiety behavior are not in evidence)

Note that other conditions, such as diabetes plus thyroid, kidney, heart or adrenal gland disease, can produce signs similar to those associated with cognitive disorder. A full diagnostic evaluation that includes blood and urine testing should be performed by a veterinarian before reaching such a possible diagnosis.

Conventional TreatmentThe drug Anipryl has been approved for treating cognitive disorder in dogs; no medication is available for cats. While effective in some patients, this drug is expensive and can have rare side effects. If the drug proves to be effective, Anipryl must be used for the rest of the life of the dog. Natural, drug-free therapies are less costly.

Natural TherapiesMany different natural therapies can help alleviate cognitive disorder, as recommended by a holistic vet. Changes in diet may include antioxidants, omega-3 fatty acids, herbs such as ginkgo biloba, targeted homeopathics and phosphatidylserine and acetyl-L-carnitine supplements.

While I may incorporate a combination of these in the treatment of a pet with cognitive disorder, one mainstay is supplementation with choline/phosphatidylcholine. Many pets in my practice have had beneficial results with the patented product Cholodin, made by MVP Laboratories. It contains choline, phosphatidylcholine, methionine and inositol.

Several years ago, I conducted a study funded by the manufacturer and found that Cholodin was effective as a sole therapy. Half of the dogs and cats treated with this supplement showed a moderate or significant response within 30 days; another 25 percent of dogs and 20 percent of cats in the study showed at least minimal improvement within a 30-day period. I now prescribe Cholodin for all of my dog and cat patients that are at least 5 years of age, as a preventive measure.

In addition to choline and other natural therapies, I believe that it’s important to minimize inflammation in

older pets, as well, because minimizing inflammation may also help prevent or decrease the incidence of other serious disorders. Because common commercial pet foods can have ingredients that can induce oxidative cell damage and inflammation, I recommend feeding pets natural foods devoid of byproducts and chemicals (feeding only wet food to cats).

Other ideas to reduce inflammation include minimizing vaccinations through the use of antibody titer testing, and minimizing or eliminating the use of chemical flea and tick products. In my experience, using natural therapies, beginning when a pet turns 5 years of age, can actually prevent, and at least minimize, the incidence of cognitive disorder.

Shawn Messonier, a doctor of veterinary medicine practicing in Plano, TX, is the award-winning author of The Natural Health Bible for Dogs & Cats; his latest book is Unexpected Miracles: Hope and Holistic Healing for Pets. Visit PetCareNaturally.com.

Many different natural therapies can help alleviate

cognitive disorder.

A

cupuncture

Georganna Ranglack, DVM, PhD Certified Veterinary Acupuncturist

Greater New Orleans Area, North Shore & West Bank

504.874.1189

Drug-free treatment for common conditions with acupuncture.

House calls or office visits by appointment.

Veterinary

engage into your space with awareness and implement solutions

to positively affect your life.

Page 20: Natural Awakenings - S.E. Louisiana May 2011

20 New Orleans NOLANaturalAwakeningsMag.com

Is it true that, You’re only as pretty as you feel? Yes, says Alan Dattner, a New York medical doctor and pioneer in

holistic dermatology. “The most important thing that people can do for beauty,” he says, “is to come from peace, joy, appreciation and happiness inside, and let that radiate out on their faces.” Many experts agree: The secret to true beauty is to work from the inside out, as well as the outside in, reducing exposure to toxins of all sorts, including stress, and watching what we put in the body, as well as what we put on it. Here’s how Natural Awakenings’ panel of beauty professionals answered when asked how we can take good care of skin, hair and nails, and look our best, naturally.

SKINHow do I keep my skin resilient, clear and looking youthful?“Lifestyle issues, including stress, have a huge impact on skin,” advises Allison Tannis, a registered holistic nutritionist and author of Feed Your Skin, Starve Your Wrinkles. Before spending money on creams and treatments, look at your eating, sleeping, working, playing and exercising habits. “Stress, whether environmental or internal, increases the body’s production of free radicals, which leads to damage of cells, including skin cells,” Tannis explains. So, anti-stress activities, and just relaxing, boost your appearance. Adequate sleep is also crucial for cellular rejuvenation, which is why

signs of sleep deprivation show up in the face immediately, ranging from pimples and puffiness to creases and dark, under-eye circles. A healthy skin diet is high in anti-inflammatory foods and antioxidants that fight free radicals. Tannis notes that, “Inflammation disorganizes the skin’s complex infrastructure that keeps it tight

and strong.” Basically, a diet that’s good for the body is great for the skin, as well, and comprises vegetables, fruits, whole grains, lean proteins and healthy fats, such as olive oil. As for key foods, helpful antioxidants are found in berries and brightly colored fruits; Tannis especially likes kiwis and raspberries. Seeds and nuts have well-known anti-inflammatory properties, as well as minerals that form the building blocks of healthy skin and hair. Studies in the British Journal of Nutrition and elsewhere indicate that omega-3 oil, from borage, flaxseed, or fatty, saltwater fish like salmon can help hydrate the skin and reduce puffiness. According to research from the University of Brussels, silica—present in cucumbers, rhubarb, bean sprouts and other veggies—seems to play a role in skin hydration, as well as the formation of healthy nails and hair. Because skin, nails and hair all need a range of nutrients to grow, repair, and rejuvenate, Tannis also suggests a good multivitamin supplement. Finally, drinking plenty of water is vital to keeping skin hydrated from the inside out.

HAIRLabels on my hair care products show a long list of unpronounceable ingredients. Is it possible to get great hair without dumping all these chemicals on it?

Natural Beauty — HEAD TO TOE

A Holistic Guide to Looking Your Bestby Frances Lefkowitz

Page 21: Natural Awakenings - S.E. Louisiana May 2011

21natural awakenings May 2011

It’s smart to be concerned about the ingredients in hair care and skincare products, because they are subject to little official regulation and may include ingredients that are not only ineffective, but harmful to health and damaging to hair and skin. That’s why green living expert Renée Loux, author of Easy Green Living, makes environmentally friendly choices. “If it’s toxic for the Earth, it’s probably toxic for our bodies, too,” she believes.

Complex ingredient lists often make it hard to know what we’re applying. Fortunately, consumer advocates like Loux (ReneeLoux.com) and the Environmental Working Group (ewg.org) have done our homework for us. When choosing products, Loux’s rule of thumb is, “plants over petroleum.” In other words, if the primary ingredients—listed in descending order by percentage in a shampoo, conditioner, gel, serum or mousse—are botanical or plant-derived ingredients, you and the planet are probably safe. Petroleum and petrochemicals—which are commonly

used in many hair care products and are derived from a non-renewable resource—don’t break down well into natural components in the environment and may be harmful to human health. Loux also pays special attention to the, last few ingredients listed on the label because this is where innocuous-sounding toxins often hide, perhaps as a fragrance or colorant. In the shampoo category, Loux likes low-sudsing versions, because suds are typically created by synthetic-foaming agents called sulfates (sodium lauryl sulfate is common) that may irritate skin and poison the environment. With hair color, look for a stylist that uses low-ammonia dyes, or buy them yourself in health food stores and natural pharmacies; temporary colorants are safer than permanent dyes. “The deeper the color, the more important it is to look at the ingredients,” counsels Loux.

FACE With so many products and spa treatments to choose from, I’m confused about what my skin really needs to look its best. What are the basic necessities for a natural skincare routine? Cleansing (morning and night for oily skin, just at bedtime for dry skin) and moisturizing (all skin types) are the basics of daily skincare, according to dermatology physician Jeanette Jacknin, author of Smart Medicine for Your Skin and founder of the J.J.M.D. Botanical Dermatology skincare line. She says that soaps are generally too harsh and drying for facial skin, so use a non-soap cleanser instead, preferably one

that is pH balanced. Oily skin will need a toner after washing to control oil secretion, and then a moisturizer, while dry skin can go straight to the moisturizer. “Men’s skin is actually thicker, rougher, and more oily and sweaty than women’s skin,” notes Jacknin. “Also, men have the special challenges of a beard. So, while a man may borrow his wife’s or girlfriend’s lotion, he may also want to find a skincare line made especially for him.” The next two steps in Jacknin’s natural skincare routine are exfoliation, to remove dead skin cells from the skin surface, and facial masks, which deep-clean, nourish and revitalize skin. These steps should be done once or twice a week, depending on skin type and the strength of the exfoliator or mask. Exfoliates come in two forms: abrasives, which physically rub off the dead skin cells; and chemical, which dissolve or peel away the surface skin layer. Natural abrasives include oatmeal and sugar granules, while fruit sugars and fruit acids, from pumpkin, apple or papaya, for example, provide natural

While the European Union has banned 1,100 chemicals from cosmetics, the United States has banned just 10. Only 11 percent of chemi-cals used in cosmetics in the United States have been assessed for health and safety.

~ The Campaign for Safe Cosmetics (SafeCosmetics.org)

Men, Women, Children Haircuts

Menu of Services at www.salon-alphonse.com

Salon Alphonse

Over 36 years experience

504-957-18638725 Oak St., New Orleans, 70118

· Detailed Consultation · Preliminary Exam · X-rays, if necessary

Lakeview Regional Chiropractic Clinic 141 W. Harrison Ave

New Orleans, LA 70124

Is pain affecting the quality of your life? With our help you can alleviate pain and move on

to a happy productive life.

P: 504-324-9920F: [email protected]

Dr. Ryan K. Russo, D.C.A $250 valueCall today!

$99 Start-Up

Page 22: Natural Awakenings - S.E. Louisiana May 2011

22 New Orleans NOLANaturalAwakeningsMag.com

chemical peels. Look for products with fruit-derived exfoliates or make your own (Jacknin recommends Skin-Care-Recipes-and-Remedies.com). Take advantage of professional exfoliation and facial treatments by estheticians and spas that use professional product lines with plant-based ingredients.

The final step in any skincare routine is sun protection. Wearing essential clothing, including hats, sunglasses and long sleeves, and staying out of the midday sun are dermatologist Dattner’s first choices for protecting skin from rays that can age and damage it. When in the sun, wear a mineral-based sun block such as zinc oxide, which stays on top of the skin, rather than getting absorbed, and forms a physical barrier to both UVA and UVB ultraviolet rays. Also, watch out for nano-minerals; these have been broken into particles small enough to be absorbed by the skin during the manufacturing process, with possibly harmful results, according to Dattner, Loux and other experts. Unfortunately, the U.S. government does not require that nano-minerals be listed on labels, so consumers must do their own research. What about makeup? As Loux points out, the skin absorbs 60 percent of what goes on it, and many cosmetics are full of unregulated, untested petrochemicals. Does that mean you shouldn’t wear any makeup? Not at all. Makeup artist Jessa Blades, of Blades Natural Beauty (BladesNaturalBeauty.com), says that switching over to natural, safe, mineral- and plant-based cosmetics is easy, as long as you are realistic. In general, the fewer ingredients used, the safer the product. “Give natural products a bit of time, and don’t be so hard on them,” she suggests. Her natural eyeliner requires reapplying a few times a day, she says.

“But I’m willing to do that for my health.” Her tips for making the transition: 1) Switch slowly; don’t dump all your old favorites all at once; 2) Go natural on the products you use every day, such as concealer and lipstick, which gets absorbed directly into the bloodstream when you eat or lick your lips; 3) Change your expectations, as natural makeup is not as long-lasting, inexpensive or easy-to-find as the more common, but toxic, stuff. The good news is when it comes time to remove it, all you need is raw coconut or sweet almond oil and a cotton ball. “Natural makeup just slides right off,” says Blades.

HANDSThe smell at the nail salon is noxious; should I be worried about what’s going onto my fingernails?“If your eyes are watering, your nose is twitching and your lungs are seizing up, you should listen to your body,” says Loux. It is hard to get colors—especially bright, deep, rich, shimmering ones—to stick to nails; consequently, of all cosmetics, nail polishes tend to contain the most toxins. “Nail polish is one of the tougher products to find for someone who’s looking to go natural,” says Loux. But

Each day, the average woman uses a dozen products containing 160 chemicals, while men apply about 80 chemicals to their bodies. However, 64 percent of beauty product users say they use at least some “natural” items.

~ Not Just a Pretty Face: The Ugly Side of the Beauty Industry, by Stacy Malkan

Page 23: Natural Awakenings - S.E. Louisiana May 2011

23natural awakenings May 2011

she points out that some brands are eliminating toluene, a petroleum-based solvent that the Environmental Protection Agency has linked to mild to severe problems with respiratory and nervous systems as well as kidney and liver functions. These less toxic polishes require more benign removers than conventional noxious-smelling acetones. Always apply them outside or near an open window. Even better, achieve a smooth, clear shine without any polish using a nail buffer. It’s a quick, inexpensive way for men and women to sustain a natural, finished look.

FEET What can I do to get my winter-weary feet ready for sandals?In a word, exfoliate. Rub away calluses and thickened, cracked skin with an emery board, and then relax while soaking feet in Epsom salts to soften skin, and rub gently with a luffa or pumice stone. Foot scrubs containing salt or sugar granules invigorate and increase circulation, especially if they include peppermint, rosemary or tea tree oil within a moisturizing Shea butter or organic foot oil. Exfoliating creams, similar to facial exfoliates, but stronger, also help peel away withered winter skin. Always be sure to apply a moisturizer to protect the newly exposed skin. Remember to soften elbows and knees, too.

Frances Lefkowitz’s new book, To Have Not, was named one of five Best Memoirs of 2010 by SheKnows.com. Connect at FrancesLefkowitz.net.

New Orleans Medical Acupuncture

Joseph M. Matta, M.D.4836 Wabash Street

Metairie LA 70001Phone: 504.780.2766

www.neworleansmedicalacupuncture.com

get to the point.

Acupuncture is a medical tradition which helps promote health and well-being. It is used to treat a broad range of medical conditions:

Addiction • Detox • Smoking Cessation • Weight Loss • FertilityPain • Fibromyalgia • Headaches • Neuropathy • Chronic Fatigue

Page 24: Natural Awakenings - S.E. Louisiana May 2011

24 New Orleans NOLANaturalAwakeningsMag.com

Page 25: Natural Awakenings - S.E. Louisiana May 2011

25natural awakenings May 2011

healingways

Once considered primarily a pampering experience for the wealthy, massage and

its counterpart, bodywork, is today acknowledged by the larger medical community for its therapeutic value. The U.S. Library of Medicine at the National Institutes of Health provides the largest source of published up-to-date research on the subject, including substantiation for claims citing the many positive effects of massage.

Among the reported improvements

is an individual’s ability to relax and sleep better following therapeutic massage treatment. Recipients also tend to enjoy a better immune system response, fostering the relief of fatigue, pain, anxiety and nausea. On this basis, some large U.S. cancer centers, such as the University of Texas MD Anderson Cancer Center, in Houston, now integrate massage therapy into conventional settings.

Judy Stahl, past president of the American Massage Therapy Association, is a strong, longtime advocate for

acceptance of the therapeutic benefits, including some that haven’t yet made it into the annals of conventional medicine. She became a professional massage therapist in 1987, and today continues the research she initiated for her master’s thesis in counseling and psychology: Touch Therapy in Enhancing Psychological Outcomes. It’s become her life’s work.

“I regularly see practical evidence that supports research on the powerful and critical role that touch plays in the

RESTORATIVE RUBDOWNS

The Blissful Benefits of Massageby Linda Sechrist

Other than a silent retreat or a loving and comforting embrace of a friend, child or another family member, few actions are as multi-beneficial to body, mind and spirit as massage.

Amazing ReikiTianne D. Lastra, Reiki Master

504-909-3723 [email protected]

www.amazingreiki.comA portion of all funds donated to animal welfare.

Experience the Sense of Well-being and Relaxation That Reiki Can Bring into Your Life.

ServicesClasses & Sessions (Usui, Karuna, Rainbow)Crystals • DrummingAnimal Reiki • Healing Touch

• Vibroacoustic table – FDA approved

• Compassionate & motivational sessions for cancer patients

Page 26: Natural Awakenings - S.E. Louisiana May 2011

26 New Orleans NOLANaturalAwakeningsMag.com

state of a person’s mind-body health,” Stahl says. Her years of patient/client sessions also provide her with a wealth of evidence that combining touch and talk therapy is far more effective than talk therapy alone.

Beyond the Massage TableWhat a difference 60 minutes on a massage table can make. The first rule of massage—to feel, rather than think—transforms the therapeutic stroking, rubbing, wringing, tapping, kneading and squeezing of muscles into deeply satisfying human contact. Concentrating on the practitioner’s touch, while listening to relaxing music playing in the background and breathing in soothing aromatherapy scents, helps turn the mind off and focus attention

on the moment. Such a restful state of mindfulness is key to successful meditation.

A Natural Sleep AidIt makes sense that a good night’s sleep is essential to health. A study published in the American Journal of Critical Care showed that patients receiving a six-minute massage slept better than those in the control group, which participated in a teaching session on relaxation followed by a bedtime audiotape comprising muscle-relaxation supported by imagery and music.

Easing Pain and AnxietyWhile massage isn’t meant as a replacement for regular medical care, it is being increasingly used in the allopathic

community to help manage chronic pain. The results of a study by the Royal College of Nursing Research Institute, at the University of Warwick, in the UK, demonstrated that massage provides effective short-term relief for moderate to severe chronic pain. Patients receiving massage therapy reported significantly less pain immediately as well as one hour after treatment. They also experienced a significantly reduced level of anxiety.

Six years ago, when integrative family physician Fred Morgan discovered that massage helped to alleviate the back pain he had suffered from for 11 years, he began recommending it to his patients. “The first time I went to a massage therapist, the pain went away for a week,” says the co-owner of Pleasanton Family Wellness Center, in California, which combines allopathic, complementary and alternative medicine.

Stroking Blood Pressure in the Right DirectionNot only does massage help to lower blood pressure, it also helps ease stress levels. One study published in Heart and Lung: the Journal of Acute and Critical Care noted that patients that had massage after heart surgery showed a lower level of postoperative blood pressure. Another study of patients that underwent twice weekly, 30-minute massage sessions demonstrated decreases in blood pressure and cortisol (a stress hormone), as well as depression, anxiety and hostility.

More is BetterWho wouldn’t want to have a massage twice a week? The ongoing research of Dr. Maria Hernandez-Reif, of the Touch Research Institute at the University of Miami, and Tiffany Field, Ph.D., the institute’s director, demonstrates that while an individual can benefit from even small doses of massage (15 minutes of chair massage or a half-hour table session), longer bodywork, performed two to three times a week, compounds the positive effects.

Linda Sechrist is a senior writer and editor for Natural Awakenings.

Page 27: Natural Awakenings - S.E. Louisiana May 2011

27natural awakenings May 2011

More New Orleans residents are engaging in growing their own food or supporting local

farmers – and the growing number of opportunities to do so serve as proof of the demand. Some seek greater control over what is in the foods they eat and how it is produced, while for others it is one of the most substantial methods for every person to reduce their environmental footprint.

Backyard gardensThe New Orleans Food and Farm Network (NOFFN) offers resources for new gardeners, but one of their specialties is building and supporting backyard gardens. The gardens are usually raised beds, so that residents don’t have to worry about the conditions of the soil and are guaranteed a good mixture of soil, manure and compost, as well as plants, at the very beginning. Volunteers do the bulk of the

garden build, although the homeowner is welcome to assist. Long term success is in the owner’s hands, but NOFFN staff is available for questions, concerns, tips, seeds and other resources. A new organization, the Backyard Gardeners Network, is another resource for budding farmers. Jenga Mwendo, a former computer animation specialist, started the nonprofit after she returned home to the Ninth Ward after Katrina. After re-establishing Laurentine Ernst Community Garden on Chartres and Forstall, a Parkway Partners garden, Mwendo went further by educating, engaging and supporting residents interested in backyard gardens. “The elderly in this neighborhood, they remember,” she said. “When they were kids, people had gardens. It is important to have that connection with the land.”

In addition to consulting with residents, helping test soil and design gardens, the organization has transformed an abandoned building next to the community garden into a gardening resource center, with the help of the neighborhood association, a $5,000 Environmental Heroes grant, and volunteers from across the country coordinated by Hands On New Orleans and Historic Green. The building, to be used as storage for tools, seeds and educational materials, shelter and a bathroom, will be a “neighborhood hub” for gardeners in the community.

LATINO FARMERS COOPERATIVE OF LOUISIANA

GET A 3’X6’ RAISED-BED VEGETABLE GARDEN IN YOUR BACK-YARD FOR $350. THIS INCLUDES CONSTRUCTION

AND INSTALLATION TILLING AND INSTALLATION OF FERTILE SOIL MINI GREENHOUSE PLANTING OF BABY

VEGETABLES/HERBS EDUCATIONAL CONSULTATION

THE GIVING GARDEN FUNDRAISER

All proceeds go towards supporting the "Daily Bread Food Pantry," which helps feed people in need.

GIFT

CERTIFICATES

ARE

AVAILABLE!

FOR MORE INFORMATION CONTACT (504) 333-3611 or [email protected]

Est.1991

504-322-7551

Increase efficiency, reclaim space from your filing cabinets, retrieve your documents electronically, and facilitate

disaster recovery through document scanning.

Parkway Partners community gardens, Gathering Tree Garden on Telemachus St.

by Colleen Morgan

Community GardensLocal Gardening Groups Offer Options

Page 28: Natural Awakenings - S.E. Louisiana May 2011

28 New Orleans NOLANaturalAwakeningsMag.com

Raul Llanos, M.D.

Diplomate American Board Obstetrics and Gynecology • Diplomate American Board of Urgent Care Medicine Diplomate American Academy of Pain Management • Diplomate American Board Medical Hypnosis

Diplomate American Board Holistic Medicine • Diplomate American Board Anti-Aging Regenerative Medicine

CLINICAL MEDICAL SPA 3749 N. Causeway Boulevard Suite C ~ Metairie, Louisiana 70002 ~ 504-834-1050

Visit Us At www.nutraceuticalsmd.com

WELLNESS CLINIC Traditional and Complementary

Medicine

Hormone Replacement Therapy and Other

Services

Regardless o f one’s level o f experience in gardening, there are various opportunities to get involved and there are also educational programs, including the Grow Mo Betta workshops held by NOFFN and the Parkway Partners Second Saturday programs at their Greenhouse on Baronne Street.

Community GardeningIn addition to the Ninth Ward community garden, Parkway Partners has 30 other active community gardens all over the city. And each one is different, said Renee Allie, the Urban Gardens Coordinator, some with tiny plots in a small corner lot and others have large expanses for prospective farmers to ponder. There is a garden leader at each site who serves as the coordinator as well as mentor for new gardeners. Parkway Partners, which was created by the city in 1982 to put tax delinquent properties to good use, is now a resource for residents across the city who need soil test kits or seeds or who want to set up a backyard garden or a community garden. The organization does not have funding to build gardens as in the past, Allie said. If residents have gathered the funding necessary (at least $6,000) and a minimum of 10 committed gardeners, then Parkway Partners may assist by providing technical assistance. Engaging a critical mass in the project is necessary so the garden doesn’t become a blighted property like so many in the past. “The

community comes first, and then we go forward,” she said.

Gardening LightJoseph Brock, the director of NOLA Green Roots, has created and replicated a model that marries communal farming with online shopping. Residents purchase memberships for $10 or $20 a month, depending on the garden, and they then become part of a crew of gardeners who are assigned tasks at the garden depending on their schedule and capabilities. For those, such as the elderly, who find the physical gardening tasks difficult, there are office tasks available. Members are then entitled to a regular flow of produce, and notices about free items that are available, as payment for their services.NOLA Green Roots has utilized volunteer groups to help build out and do big projects at its jam-packed and colorful gardens, but most of the maintenance work is done by members, with staff supervision and coordination. For those who are interested in reaping the fruits and vegetables available at a garden but are not inclined to help tend it, they can choose to be a stakeholder – they pay a little more but are not required to work at the garden. Others can also support the gardens, if only by purchasing some beans online when they are advertised.

Supporting Local and Urban AgricultureIn addition to the model where a monthly fee pays for a certain quantity of fruits and

Growing Desire Garden on Clouet St.

Resurrection Garden on Jackson Avenue

Teche Garden on Teche St.

Page 29: Natural Awakenings - S.E. Louisiana May 2011

29natural awakenings May 2011

Maintain or Regain Your Health with a Holistic Life

(504) 885-8800www.holisticlife.us • email: [email protected] 24/7 availability

4401 Veterans Boulevard, Suite 200 Metairie, LA 70006

Advanced Certification

through I-ACT (I-act.org)

HOLISTIClife

SERVICESColon IrrigationActivated Oxygen Steam SaunaCellular DetoxingWeight Management

PRODUCTS

A full line of integrated homeopathic and herbal products

Alkaline water systems (www.lifeionizer.com/holisticlife)

Many other Holistic products SALES with FREE TRIALS

Chi Machine • E-Power • ERE Device

Spring Time Specials

3 Free Cellular Detox Foot Baths & 1 Free Sauna Session

with 15 Sessions

3 SESSION $199/15 SESSION $900

Ready for swim suit season? We can help get you there.

Tai Chi Chuan is a moving meditation done in slow flowing rhythmic motions. These are vital energy exercises to rejuvenate body energy and to help you achieve better mind, body and spirit.

Tamashii Karate & Tai Chi Center

Improve Health, Fitness, Personal Safety

[email protected]

8132 Willow Street • New Orleans

• All Ages • Morning , Evening, Group & Private Classes • Rejuvenate Energy • Reduce Stress • Lose Weight • Lower Cholesterol • Discover Qi Gong • Energy Methods • Build Self Confidence

Master King Lam, Over 38 years Martial Arts Experience

504-866-2241

vegetables, folks interested in healthy, fresh food without the commitment can just go buy a box of produce in season from Hollygrove Market and Farm. This market, which has been a popular stop on the Saturday shopping circuit for several years, offers a box of seasonal fruits and vegetables twice a week (now also on Tuesdays) for $25. Hollygrove buys from dozens of local farms, mostly from small independent farms in the countryside, but also from urban farmers, depending on availability and demand. Volunteers get a box for their work. The other choice, which in many ways is the most traditional, is to shop at farmers markets and buy directly from the grower. There are numerous such markets in the area, including Crescent City Farmers Market in New Orleans, Gretna Farmer’s Market on the Westbank, German Coast Farmer’s Market in Destrehan, Covington Farmer’s Market in Covington, Camellia City Farmer’s Market in Slidell and Sankofa in the Ninth Ward, as well as many more all around (see Ongoing Calendar for complete listing).

For the foodies who are clamoring for fresher food in their diet, there is no shortage of opportunities to get it.

Find more details on opportunities on-line at:www.parkwaypartnersnola.comwww.facebook.com/backyardgardenerswww.nolagreenroots.comwww.hollygrovemarket.comwww.noffn.org

Colleen Morgan is a freelance writer, NA environmental editor, and founder of the non-profit Bayou Rebirth. She may be reached at [email protected]

Page 30: Natural Awakenings - S.E. Louisiana May 2011

30 New Orleans NOLANaturalAwakeningsMag.com

northshoreGOOD EARTH MARKET & CAFÉ 821 Girod St.Old Mandeville985-674-4329

Offer ing del ic iousorganicfareatbreakfast,lunch and dinner.Alsotryourjuices,smoothies,

bakedgoods,andorganicbeersandfinewines.Ourmarket

hasgluten&wheatfreeproducts,naturalandorganicproducts,vitaminsandsupplements.Open8-8Mon-Satand9-3Sun.

RUBY’S NATURAL FOODS1030 Hwy 190 WestSlidell985-641-1620Market offering natural& organic products andsupplements. Fresh soups daily.Veggie burgers,burritos, enchiladas, veggie pockets, fresh salads,chicken and turkey salads. $8 soup& salad lunchspecialdaily.Lunchserved10:30-3.Seatingavailable.

TOAD HOLLOW CAFÉ207 N. New Hampshire, Covington985-893-8711

Offering soups, salads,burgers, sandwiches &house-madedessertswithwho l e s ome , mo s t l yorganic ingred ien ts .

Somethingforeveryoneincludingvegetarianandveganselections.Dine inor take-out.BreakfastSat&Sun8-2;LunchTues-Sun11-2;DinnerFri&Sat5:30-9.

southshoreECO CAFÉ & BISTRO3903 Canal St., N.O. 70119504-561-6585EcoCafeNO.com

and Bistro

Cateringand togoordersavailable. Sustainablyoperated.Salads, Soups, Panini’s,HotPlates,andmorewith

fresh all natural ingredients.Vegetarian/veganoptions,organicwines,organicCoffeeBar,FullJuiceBar.TapasFri&Sat6-10pm.BreakfastMon-Fri8-11:30and8-2:30Sat/Sun.LunchMon-Fri11:30-3andSat/Sunnoon-2:30pm.

GOTT GOURMET CAFÉ3100 Magazine St. (8th),New Orleans504-373-6579GottGourmetCafe.com

Casual food prepared to agourmet’s standards.Thefreshestingredientsinmadefrom scratch food.Salads,soups, paninis, wraps,burgers,gumboandChicagostyleViennahotdogs.Take-ou t in b iodegradab lecontainers .Order your

favoritemenuitemsinpartysizequantities.OpenTues-Fri11-9,Sat&Sun8-5.

THE VINTAGE GARDEN KITCHEN925 S. Labarre Rd,MetairieSoup order line: 504-620-2495VintageGardenKitchen.org

Healthyanddelicioussoupscreatedbyourchefusingfresh,wholesomeingredientswithout preservativesandhormone-freedairyandmeats.Localproductsusedasmuchasisavailable and some ingredientsfromourownorganicallygrowng a r d en .Th r e e s oup s /weekprepared.Askaboutspecialdiets.

OrderbyTuesnoonforpick-upordeliverythatweek.Orderon-lineorbyphone.See ad on page 7.

THE ULTIMATE KITCHEN COMMANDOJodi Brown504-616-7171UltimateKitchenCommando.com

TiredofyourdoctorandnutritionistTELLING youwhat to do andwishsomeonewouldjustcometoyourhouseandSHOWyouhowtomakeitallwork?HereIam.Iofferfull-dayfoodmakeovers&healthycookingclasses.Takebackyourlife!FeelALIVEagain.

consciousdining

Audubon Spray Foam Insulation

Why consider installing spray foam insulation?• Save up to 50% off your heating/

cooling bills• Live in a more comfortable home• Improve sound control• Reduce unplanned moisture movement• Reduce your carbon footprint

Call Today for a Free Estimate

“Reducing energy need is our greatest alternative energy source.

Roland (Rusty) Cutrer Jr., OwnerLocally Owned and Operated

504-432-7359 [email protected]

How can you be sure you are buying safe, non-toxic, high-quality products for you, your baby, your family and the environment?

ww

w.ZukaBaby.com

- Locally

made items

- Gift registry

- Free classes

- Cloth diapers

& accessories

- Nursing bras

& apparel

- Baby carriers

- Natural toys

- Organic

clothing

Locally

mom-owned

child-friendly

atmosphere

Shop at ZukaBaby!

504-596-6540 2124 Magazine St. (Near Jackson)Open Mon-Sat, 10am – 5:30pm

Page 31: Natural Awakenings - S.E. Louisiana May 2011

31natural awakenings May 2011

SUNDAY, MAY 1Registration for First Degree Reiki Class-North-shore – 11am-7pm (5/14&5/15)w/ReikiMasterElizabethOhmer Pellegrin. Reiki promotes andaccelerateshealingandbalanceofthebody,mindandspirit.LearntodoReikifortheselfandothers.Noexperienceneeded.Privateclassesandretreatson request. Pre-registration required. $250. Info/registration:504-388-2356.

Healing on the Spiritual Path–3pm.BrunoGroen-ingCircleofFriendspresentsW.Arends,MDfromGermanyandM.Galante,MDfromNewYorkwhowillspeakonmedicallydocumentedspiritualheal-ings.Freeandopentopublic.TulaneUniv.,Lavin-BernickCenter,6823St.CharlesAve,Ste218.Info:[email protected].

MONDAY, MAY 2Chair Massage at Monday Madness/The Nutri-tion Co.–9am-2pm.Takeabreakfromtheday;relaxandfeelthehealingbenefitsofmassage.OfferedbyMelBorne,LMT (#4158). 4350Hwy22,Ste.H,Mandeville.985-869-2087.

WEDNESDAY, MAY 4Swedish Massage Clinic – 9:15-10:45am. (Also5/11, 5/14, 5/18, 5/21).Help a studentwith theireducationatthestudentmassageclinic.Swedishisgoodforoverallrelaxation&increasingflexibility.$30.BlueCliffCollegeMassageDept,newlocation:ClearviewMallby foodcourt,Metairie.Appoint-mentonly.504-456-3141,x2248.

Deep Tissue Massage Clinic–1:15-2:45pm.(Also5/11,5/18,5/20).Helpastudentwiththeireducationatthestudentmassageclinic.DeepTissueismusclespecificandreallyworksoutthekinks.$30.BlueCliffCollege,MassageDept.,newlocation:Clear-viewMall by food court.Metairie.Appointmentonly.504-456-3141,x2248.

FRIDAY, MAY 6National Public Gardens Day – 10am-5pm.AnationaldayofcelebrationthroughthesupportofBetterHomes andGardens to raise awareness ofAmerica’spublicgardensandtheir importantroleinpromotingenvironmentalstewardshipandaware-ness,plantandwaterconservation,andeducationincommunitiesnationwide.AdmissiontoLongueVue’sgardensisfreeonthisdaywithacouponfromNationalPublicGardensDay.org/.

SUNDAY, MAY 8 Happy Mother’s Day

TUESDAY, MAY 10One Free Tai Chi Class–10:30-11:30am.Reducestress,relievepainandimprovequalityofyourlife.Free.TamashiiTaiChiCenter,8132WillowSt,Up-townN.O.Toregistercall:504-866-2241.

WEDNESDAY, MAY 11Holistic Education Monthly Meeting/Metairie–6:45pm.SponsoredbyHolisticCenterforHealthandHealing,Inc.,networktimefollowedbyprogram.Speakers:TBA.OldMetairieLibrary,2350MetairieRd,Metairie.Free.504-838-4350;504-841-0188.

FRIDAY, MAY 13Shihan Koss Yokota Karate Seminar – 6-8pm.TamashiiKarateCenter,8132willowSt,UptownN.O.Formoreinfoortoregistercall:504-866-2241.Drumming/Dancing/Kirtan Performance with The Mayapruis–8pm.Becomingthemosttalked-aboutgroupinthisgrowingsceneofexoticworldmusic,TheMayapuristraveltheworldover.WildLotusYoga4842PerrierSt.,NOLA,504-899-0047.Free Intro to Yoga Class – 6:30-7:30pm.Builda strong foundation for a life longyogapractice.Thisclassisdesignedforstudentswhohaveneverpracticedyogabeforeintheirlivesorforstudentswhohavetakenveryfewclasses.ShantiYogaShala,3528MagazineSt.,NewOrleans.310-435-6098.Playmakers Theatre “The Tavern”–(5/13-5/29)8pmFri/Sa;2pm,Sun.Enjoyanoldfashioned,turnof the centurymystery romantic comedydirectedbyMarkLeonard.PlaymakersTheater,19106Play-makersRd.,Covington.Adults/$15, students/$10.Reservations:985-893-1671.

SATURDAY, MAY 14Central City Community Gardens Tour–9am-12noon.See three successful community gardenswithina1blockradiusofParkwayPartners.Meetand talkwith the urban farmerswhowork them,and learn differentmethods and philosophies ofurbanfarming.ParkwayPartnersGreenhouse,1137BaronneSt.,70113,cornerofClioandBaronneSts.Shihan Koss Yokota Karate Seminar–9:30am-4:30pm.OfferedbyTamashiiKarateCenter.Seminarheld atTravelBest Inn, 2240VeteransBlvd.Formoreinfoortoregistercall:504-866-2241.Broad Flea Paint and E-waste Drop–11am-4pm.Takeadvantageofanopportunitytodropoffoldpaintandelectronicwaste(computersonly)totheBroadFleaattheoldRobertssupermarket,NorthBroadandBienville.SecondSaturdayofeverymonth.First Degree Reiki Class–11am-7pm(5/14&5/15)w/ReikiMasterElizabethOhmerPellegrin.Reikipromotesandaccelerateshealingandbalanceofthebody,mindandspirit.LearntodoReikifortheselfandothers.Noexperienceneeded.Privateclassesand retreats on request. Pre-registration required.$250.Info/registration:504-388-2356.Stress to Bliss–1-3pm. In this8-weekprogram,experience yoga,mindfulnessmeditation, groupprocess,homepracticeandanall-daysilentretreat.BalanceYoga&Wellness,120S.CortezSt.,NOLA.Info:504-309-9618.Theosophical Society Covington Lodge–2-4pm.2101N.Hwy.190,Rm.200,Covington.Free.Con-tact:[email protected] Orchards & Urban Beekeeping – 3pm.GroMoBetter series.Water-wise irrigation andurbanrainwatercatchmentofferedbyNewOrleansFoodandFarmNetwork,coversvegetable,herbandflowergardens.HollygroveMarket&Farm,8301OliveSt,NOLA.$5.504-864-2009.

SUNDAY, MAY 15FORESTival–Artdisplays,botanicaltours,localmusic and author readings in a forest setting be-sidetheMississippiRiver.AStudiointheWoods,13401PattersonRd.NewOrleans.$5.Moreinfo:504-392-5359.Healing With The Elements–12-5pm.Learnhowtousethebeautiful,primalenergiesoftheearthtohealtheselfandothers.Becomemorealignedwiththeearthandwatchhoweasilylifeflows.$60.Mid-City.CallJoshat504-275-6377.

985-641-8058 www.mikerobichauxdds.com

1101 RobeRt blvd.Ste A Slidell, lA 70458

The Gateway To HealthA H O L I S T I C A P P R O A C H T O D E N T I S T R Y

How does one choose a dentist that is right for them?4. At some point the dental team should describe the characteristics of a healthy mouth so that you will be able to compare your own present condition with the health model. This gives you

and the dental team a starting point in planning your oral health care.

Mike Robichaux, DDS

calendarofevents

Page 32: Natural Awakenings - S.E. Louisiana May 2011

32 New Orleans NOLANaturalAwakeningsMag.com

Yoga & Writing For The Heart Workshop–2-5pmw/ACLambeth&visitingteacherJenVioli.Experi-enceaplayful afternoon, inviting students to jointhesetwoformsofcreativeexpression.WildLotusYoga4842PerrierSt.,NOLA.504-899-0047.New Orleans Group-Sierra Club Monthly Pro-gram–7-8:30pm,6:30pm3rdSundayofthemonth.Refreshments.Speakers:LizzyShephardofLifeCityLLCandHarveySternonhistriptoPanama.Free.AudubonZoo,DominionAuditorium.EntereducationgatebehindthestatueofAudubon.Parkingplentifulandsafe.Contact:[email protected], MAY 18Registration for Summer Tai Chi & Karate Class-es with Master King Lam–Reducestress,relievepain,improvethequalityofyourlife.TamashiiTaiChi andKarateCenter, 8132WillowSt,UptownN.O.Formoreinfoortoregistercall:504-866-2241.Holistic Education Monthly Meeting/Covington–7pm.SponsoredbytheHolisticCenterforHealthandHealing,Inc.,networktimefollowedbyprogram.Speaker:TBACovingtonCouncilChambers, 222KirklandSt.985-898-0016.THURSDAY, MAY 19The Green Screen–7pm.ThescreeningofAVil-lageCalledVersaillesforthismonthlyenvironmentalfilmseries.RefreshmentsprovidedbyElizabeth’sRestaurant.TheGreenProject, 2831Marais St.,NOLA.Free.504-945-0240.FRIDAY, MAY 20Mid-City Bayou Boogaloo–5-9pm..Enjoymusicon threeoutdoorstages,art, food,kids’activities,games, community resource booths. Bayou St.John,betweenOrleansAvenueandLafitteSt.504-488-3865.Sunset at the Landing Concert – 6-9pm. FreeconcertattheColumbiaStreetLanding,Covington.C. G. Jung Society Benefit Performance–6:30pmfood& spirits/8pm, play. Premiere of “Out of theShadows,”aplayabouttherelationshipofEmmaJungandToniWolff.ProducedbytheArchetypalTheatreCompanytobenefittheJungSociety.6330St.CharlesatExpositionBlvd.Ordertickets:985-892-1534.Open Mic Night–7pm.TGITF(ThankGodit’stheThirdFriday).Sharecomedy,singing,music,poetry,andtalentsatUnityChurchinMetairie,3939Vets.Blvd(2blockswestofCleary,entrance/parkinglotinrearofbldg).SATURDAY, MAY 21NOLA Veggie Fest–10am-6pm.(5/21and5/22)Thearea’slargestveganevent.Nationallyrenownedspeak-ers,cookingdemos,food,vendorbooths,films,rafflesand auction plus livemusic and entertainment. $10adults/$5under12yrs/under12free.ZeitgiestMulti-CulturalCenter,1618OrethaCastleHaleyBlvd,NOLA.

Paint and E-waste Drop-Off at Hollygrove Mar-ket–10am-2pm.Dropoffoldpaintandelectronicwaste(computersonly)totheHollygroveMarket&Farm,8301OliveSt.,NOLA.s.Pickupa$25boxfilledwithlocally-grown,freshproducewhilethere.Mid-City Bayou Boogaloo – 11am-9pm.Enjoymusiconthreeoutdoorstages,art, food,kids’ac-tivities,games,communityresourcebooths.BayouSt. John, betweenOrleansAvenue andLafitteSt.504-488-3865.

Sacred Journey Part I – 2-3:30pm&4-5:45pmw/NathalieCroix.Asanapractice (2-3:30pm) fol-lowedbymeditation,lectureandgroupdiscussion(4-5:45pm).Discoveryoga in relationship toself,communityandtheworld.ShantiYogaShala,3528Magazine St.,NewOrleans. $30. Formore infocontact:[email protected] Yoga Workshop – 2-5pm (5/21&5/22)w/Bill Savage. Increase energy and aware-ness.ConsciousnessoftheChakras(Sat.,5/21)andReleaseandRenew(Sun.,5/22).$40/eachor$60/both.BalanceYoga&Wellness,120S.CortezSt.,NOLA.504-309-9618.SUNDAY, MAY 22 Louisiana Tour de Cure – 7:30am-4pm.Part ofcyclingeventheldin40statesnationwidetobenefittheAmericanDiabetesAssociation.TheTour isaride,notarace,withroutesdesignedforeveryonefromtheoccasionalridertotheexperiencedcyclist,comprisedofa25,50,and100mileroutefeaturingsomeofSouthLouisiana’smostbeautiful terrain.Info:504-889-0278x6072.

Bicycle Second Line–10am.HostedbyN.O.MetroBicycleCoalition.RidedepartsJeffDavisPkwyatBienvilleStandwindsthru11milesofN.O.Citystreets.Refreshmentsbeforeandafterrideandanafter party.Registration and information at 504-565-6624.NOLA Veggie Fest–10am-6pm.(5/21and5/22)Thearea’slargestveganevent.Nationallyrenownedspeakers,cookingdemos,food,vendorbooths,films,rafflesandauctionpluslivemusicandentertainment.$10adults/$5under12yrs/under12free.ZeitgiestMulti-CulturalCenter, 1618OrethaCastleHaleyBlvd,NOLA.Mid-City Bayou Boogaloo – 11am-7pm.Enjoymusiconthreeoutdoorstages,art, food,kids’ac-tivities,games,communityresourcebooths.BayouSt. John, betweenOrleansAvenue andLafitteSt.504-488-3865.WEDNESDAY, MAY 25Registration for Summer Tai Chi & Karate classes with Master King Lam–Teachingyoubetterfit-ness,stressreduction,andpersonalsafety.TamashiiTaiChiandKarateCenter,8132WillowSt,UptownN.O.Formoreinfoortoregistercall:504-866-2241.AVIVA Well-Being Wednesdays–noon.Monthlylunch time gatheringwithMay’s topic:Essentialoilbasics&safetyissues.AVIVAMassage&Well-BeingCtr, 601Lafitte St,OldMandeville. Free.Spacelimited,RSVP:985-727-9665.THURSDAY, MAY 26Sustainable Design Series–5:30-7:30pm.Monthlypaneldiscussionoftopicsfromsustainabledesigntocommunityaction.HostedbyAIANewOrleans,GlobalGreen&USGBC-Louisiana.Free.AIABldg,1000St.Charles,NewOrleans.504-525-8320.FRIDAY, MAY 27The Big Soak – (5/27-5/30).Annual soul-soakedweekendofyoga,music,dancing,andcelebrationwithDanaFlynnofLaughingLotus,andteachersAliCramer,SheriCelentano,andFaithHunter.WildLotusYoga4842PerrierSt.,NOLA.504-899-0047.Columbia Street Block Party/Street Festival –6:30-9:30pm.ClassicCardisplayat200through500blockofColumbiaSt.Afreefamilyevent.Candelight Yoga–7:30-8:45pm.Comefinishtheweekwith a little yoga,music, chai and sweets.Relax,breathe,moveandenjoyliveclassicalguitarbyGipsonBlanchard.$15.BalanceYoga&Well-ness,120S.CortezSt.,NOLA.$15.504-309-9618.

SATURDAY, MAY 28Doubleheader Kirtan Extravaganza – 8-11pmw/Sean Johnson and theWildLotusBand (AlvinYoungandGwendolynColman)andvisitingartistSistaShreeclosing theweekendofTheBigSoakcelebration.Wild LotusYoga 4842 Perrier St.,NOLA.504-899-0047.

Home Vegetable Garden Contest – Sponsoredby LSUAgCenter andGermanCoast Farmers’Market.Open to all home vegetable gardeners.Prizesawardedbasedonoverallquality,appearanceandfreshness.Signupfrom5/4to5/25atEastorWestbankmarkets.EventtakesplaceatDestrehanatOrmondPlantation.SeeOngoingCalendarsectionformarketdetails.MONDAY, MAY 30Holistic Medicine Education Meeting – 7-9pm.Potluck and network time 6:30-7pm.Differentspeaker eachmonth.House of Broel, 2220 St.CharlesAve.,[email protected], MAY 31Build It Back Green–6-8pm.Monthlyseriesondo-it-yourselfgreenbuildingandenergyefficiency.Thismonth:CoolingYourHomeEfficiently-HVACMaintenance,RadiantBarrier andSolar Screens.Freeandopen topublic.841CarondeletSt,NewOrleans.Info:[email protected].

markyourcalendarThe Reconnection

Coming to New OrleansLevel I/II Reconnective Healing Seminar

With Eric PearlJune 3-5

Level III The Reconnection SeminarThe Reconnection Teaching Team

June 6 & 7Reconnective AnimalsWith Renee Coltson

June 2 , 5:30-7pm.Reconnective Yoga Workshop-Free

With Elizabeth PolitoJune 2 at 7pm.

Double Tree Hotel, 300 Canal St, NOLAwww.TheReconnection.com

markyourcalendarThe Silva Method®

Enriching The Planet ByEmpowering The Individual

A Better You. . . A Better World

Silva Life System andSilva Intuition Training

May 14, 15, & May 21, 22June 11,12 & June 18, 19623 Magazine St., New Orleans

(340) 690-6900www.SilvaMethodSeminars.com

calendarofevents

Page 33: Natural Awakenings - S.E. Louisiana May 2011

33natural awakenings May 2011

Page 34: Natural Awakenings - S.E. Louisiana May 2011

34 New Orleans NOLANaturalAwakeningsMag.com

Note: All Calendar events must be received via email by May 10 for the June issue.$10/EventCalendar orOngoingCalendar listing.Freecommunitywideeventsarelistedforfreeasspaceisavailable.Itemsmaybeupto50wordsinlength.Emailcalendar@nolahealthyliving.comforguidelines and to submit entries.No phone callsplease.

sundaySpiritual, but not religious?–11am. Ifyou likewhatWayneDyerandMaryannWilliamsonhavetosay,youwillloveUnityChurchofPracticalChristi-anityinMetairie.Weencouragethetransformationof your life throughpractical spiritual principles.Spiritualdiscussiongroup12:30pm.PleasejoinusformoviematineeonlastSaturdayofthemonthat1:00pm.3939–2A,VeteransBlvd,Metairie(2blockswestofCleary,rearofbuilding).Formoreinfocall504-885-7575.Community Yoga–4-5:15pm.All levels.TaughtbyNathalieCroix. $8. ShantiYoga Shala, 3528MagazineSt,NewOrleans,[email protected] Deeply- Yoga Restoratives–5:30-6:30pm.TaughtbyDaria-AllLevels-Checkourwebsiteinad for prices. ShantiYogaShala, 3528MagazineStreet,NewOrleans,LA,[email protected] Yoga–5:30-6:45pm.Donationbased.SwanRiverCommunityCenter, 7011StClaudeAve,#213,Arabi.Contact:[email protected] Meditation–6:30pm.Wanttohelptheworldandbuildastrongerconnectionwithyourown spiritual nature?TransmissionMeditation isthesimplestwaytodobothatthesametimesaysBenjaminCreme.Nofee.Uptown,NOLA.Forinfo:callAlan504-606-8512.

mondayYoga Basics – 6:15-7:45pm. Level I taught byKatherine.ShantiYogaShala,3528MagazineSt,NewOrleans,LA,[email protected].

tuesdayCrescent City Farmers Market –9am-1pm.Openairmarketwithfreshlocallygrownfruits,vegetables,seafood,bakedbreadsandpies,beddingplants,dairyproducts,freshlycutflowers.LocatedintheparkinglotofUptownSquare.Morning Flow Yoga-Level II–9:15-10:30am.(alsoThurs)taughtbyLindsay.ShantiYogaShala,3528MagazineSt,[email protected] Massage at Columbia Natural Food–10am-2pm.Take15minutesforyourself.Byusingacu-pressuretechniquesinaprecisesequence,thebodyisencouragedtoreleasetension.ColumbiaNaturalFoodMarket,415NColumbiaSt,Covington.Tom-mieMain,LMT#5627.Contact:985-515-7218.Hollygrove Market & Farm–noon-6pm.NOLA’sonlyCSA-stylemarketsellingeachweekassortedfresh local andorganic fruit andvegetables fromLA,MS&AL.8301OliveSt,NOLA(acrossfromCarrolltonBoosters).Vinyasa Yoga–6:30-7:45pm.(alsoThurs)TaughtbyNathalie.ShantiYogaShala,3528MagazineSt,NewOrleans, 70115. [email protected].

Weekly Insight Meditation Group – 6:30-9pm.2134MagazineSt.,3rdfl.,[email protected] Wisdom – 8-9pm.Donation based. SwanRiverCommunityCenterArabi 7011 StClaudeAve,#213,Arabi.Contact:[email protected] Vintage Garden Soups –Order by noonTuesdayfordeliveryonWednesday.Freshdelicioussavorysoupsdevelopedbyourchef.Optionsforspe-cialdiets.Freedeliverywith$15minor$3deliveryfee.Alsopickupattwolocations.Visitwebsiteonadforsoupsoftheweekorcall504-620-2495.

wednesday“Dog Day at the Spa”–allday.ThePeacefulBud-dhaDaySpadonates10%ofallprofitstotheASPCAeachWednesday.Spaoffersspecialtyfacials,mani-cures, pedicures and customizedmassages. 4303CanalSt,NewOrleans.504-322-2482.LASPCA Wellness Wednesdays – Ensure yourpet’s healthwith annual vaccinations and awell-nesscheck-up.BasicWellnessExam$20,low-costspayingandneuteringavailable.Byappt.only.1700MardiGrasBlvd,NewOrleans.Call504-368-5191.Covington Farmers Market–10am-2pm.Offeringfreshproduce,freshbakedbreads,preparedfoodsandplants.LocatedatTheCovingtonTrailhead,419N.NewHampshire,Covington.Intro to Mystical Meditation – 10:30am- noon.Strengthen your entire being through a guidedmeditation.Experiencethepositive,upliftingtrans-formationofyourenergy.Donationsonly.UptownHolisticCenter,723Hillary,NewOrleans.Contact:[email protected] Coast Farmers Market–WestBank–3-6:30pm.Open-airmarketofferingfreshproduce,rotisserie& freshmeats, fresh pastries/breads,sausage,kettlecorn,cracklins,preparedfoods,soycandles,goatmilksoapandlotions.Artsandcrafts4thWed.Locatedat12715Highway90,St.CharlesPlazaShoppingCenter,SiteoftheoldK-martbuild-ingLuling,LA.Rockin’ at the Rails – 5-7:30pm.A free concertserieseveryWednesdayinMay.Opentothepublic.AtCovingtonTrailhead,Covintton.Meditation/Deeksha Blessing–6:15pm.Rev.Da-vidFlorencewillfacilitateameditationfollowedbytheblessingandclassonEricButterworth’sdiscoverthePowerWithinat7p.m.3939-2AVeteransBlvd.(2blockswestofCleary,entrance/parkinglotatrearofbldg.)Metairie.504-885-7575.Meditation & Study Group–7-8:30pm.45minmeditation,refreshments,then45min.bookdiscus-siongroup.Donations.621OpelousasAve,AlgiersPoint(gatelocked7pmsharp!).Info:[email protected].

thursdayCrescent City Farmers Market–3-7pm.FarmersMarket at 3700OrleansAve,AmericanCanCo.building,NewOrleans,rainorshine.Course in Miracles–6:30-8pm.Taughtfor22yrs.byGaryArnold,UnityChurch inMetairie, 3939Vets.Blvd.(twoblocksWestofCleary,largeparkinglotandentranceatrearofbuilding).LoveOfferingswelcome.Call504-885-7575.Intro to Meditation–6:30-8pm.Strengthenyourentirebeing throughaguidedmeditation.Experi-encethepositive,upliftingtransformationofyourenergy.Donations only.UptownHolisticCenter,723Hillary,NewOrleans.Contact [email protected].

fridayDaily Kundalini yoga–9am.Kundaliniyogaclassoffereddailybydonation.DevineKundaliniYoga,1223BaronneSt.,NewOrleans.866-989-3626.Yoga Level II – noon-12:50pm.Donationbased.SwanRiver Community CenterArabi, 7011 StClaudeAve,#21,Arabi.Contact:[email protected].

saturdayVietnamese Farmers Market – 6-9am.Over 20vendorssetupshoponblanketsspreadwithproduce,beyondthecourtyardsareshopssellingVietnamesebakedgoodsandimportedgroceries.14401AlceeFortierBlvd,NewOrleansEast.Crescent City Farmers Market–8am-noon.Open-airmarketwithgreatselectionoffreshlocallygrownfruits,vegetables,seafood,bakedbreadsandfreshlymade pies, bedding plants, dairy products, freshflowers.Cookingdemosbysomeofthecity’smostacclaimedchefs.Locatedat700Magazine,cornerofGirod,NewOrleans.German Coast Farmers Market - East Bank –8am-noon.Open-airmarketofferingfreshproduce,rotisseriemeats,freshmeats,freshpastries/breads,sausages, kettle corn, cracklins, prepared foods,soycandles,goatmilk soapand lotions.Arts andcrafts2ndSat.OrmondPlantation,13786RiverRd.,Destrehan.Forinfocall985-359-0190.Camellia City Farmers Market – 8am.-1pm.Featuring yard eggs,Mediterranean foods, herbs,produce, baked goods, coffee and iced tea, localmusicians,tastingsandcookingdemos.GriffithPark,333ErlangerandSecondSt,OldeTowne,Slidell.Info:985-640-8291.Gretna Farmers Market – 8:30am-12:30pm.Featuringfreshfruitsandvegetables,meats,bakedgoods,dairy,nativefruitwinesandgardenplants.Located in theold traindepot,300HueyP.LongAve, between 3rd and 4th streets,Gretna. Info:504-362-8661.Westwego Farmers & Fisheries Market–8:30am-12:30pm.Open year round, rain or shine. Freeparking.Featuring freshproduce, seafood,bakeryitems,dairy,plants,preparedfoods&hand-crafteditems.Plus livemusic&kidsactivities.484SalaAve,cornerof4thSt.,Westwego.Contact504-341-3424,x209.Cloth Diapering 101–9am.Learnaboutmodernclothdiapers,howtocareforthem,theprosandcons,handsondemosandhandoutstotakehome.Fee:$20andyoumaybringupto2familymembers.Receivea$20couponoffapurchaseof$100forattending.Reg.required,Zukababy,2124MagazineSt,NewOrleans,[email protected] Farmers Market–9am-1pm.Offeringfreshproduce,freshbakedbreads,preparedfoodsandplants.LocatedatCovingtonCityHall,609NColumbiaSt.,Covington.Mandeville Trailhead Community Market–9am-1pm.Fifty-plusvendorsweekly:Gourmetfoods,art,produceandplants.TaiChiat9:30am.ParkinglotoftheMandevilleTrailheadontheSt.TammanyTraceoffLA59. For vendor/entertainment info:DonnaBeakley985-845-4515.Hollygrove Market & Farm–10am-2pm.NOLA’sonlyCSA-stylemarketsellingeachweekassortedfresh local andorganic fruit andvegetables fromLA,MS&AL.8301OliveSt,NOLA(acrossfromCarrolltonBoosters).Sankofa Farmers Market – 10am-2pm.Weeklymarket offering fresh produce and seafood fromlocalfarmersandfishermen.5500St.ClaudeAve,cornerofCaffinAve.

ongoingevents

Page 35: Natural Awakenings - S.E. Louisiana May 2011

35natural awakenings May 2011

Vinyasa Yoga Class – 10:45-12:15.Taught byCherylGolichandAmandaBennett.BalanceYoga&Wellness,120SCortezSt,NOLA504-309-9618.Friends of the New Orleans Public Library Book Sale–10am-2pm.Lotsoffiction,non-fiction,local&rarebooks,CDs,DVDs,videos&recordspluschildren’s books.Help rebuild theNewOrleansPublicLibraries.Bookdonationsappreciated!AttheCarriageHousebehindtheLatterBranchLibrary,5120St.CharlesAve,NewOrleans.Meditation Group–2:30-3:30pm.FairgrindsCof-feeHouse.SponsoredbyArtofLivingFoundation.3133PoncedeLeon,NewOrleans.ForinfocontactAllen504-247-6692.

communityresourceguide

Connecting you to the leaders in natural healthcare and green living in our community. To find out how you can be included in the Community Resource Guide email [email protected] to request our media kit.

ACUPUNCTURE

KELLY KIVIKO, ACALouisiana Lic.# ACA.200012530 E. Rutland St., Covington985-869-3299

AcupunctureWorks!Itisasafe,drug-freeapproachtomanagingmanycommonhealthconcerns.Specializinginherbalmedicine,pain,stress,women’shealth,andmore.

TONYA TIGART, ACALouisiana Lic.# ACA.2000324710 Canal St & 3618 Magazine St504-224-1069AcupunctureInNOLA.com

Acupunctureisgentleandeffective.TonyaoffersAcupunc-tureandOrientalmedicineinarelaxingenvironment.Sheisexperiencedinthetreatmentofpain,stressandallergies,plusmanymoreconditions.Callto

scheduleanappointment.

ANIMAL HOLISTIC MEDICINE

JANICE E. POSEY, DVM985-898-3623/504-466-9129 315 Lee Lane, #104Covington, LA 70433

Offeringaholistic,integrativeapproachtohealingyourbelovedpetthroughacupuncture,herbalmedicine/nutritionalsupplements,andfoodtherapy.Wetreatthepatient,notthesymptoms.See ad page 19.

BODYWORK

AVIVA MASSAGE & BODYWORK SPALinda L. Strickland, BA, CHt, RM, LMT601 Lafitte St., Mandeville985-727-9665

AVIVA Massage & Bodywork SpaLogo design #2

Once again for this logo design, we used a circular motif. Circles are reminicent of the body and it's many curves. The AVIVA name stabilizes the central 'flora' figure, by means of the letter "i" as the stem or trunk of the 'flora'. The 'flora' invokes a natural sensation,earthy and calm. The circluar text brings all the elements together and reiterates the AVIVA name as a total massage & bodywork spa.

Discoverthedifference&feelthepeacethroughmassage/bodywork,selectspaservices&energywork.Integrative,intuitive,customizedapproach.Aromatherapyatallsessions.LA1479;E2445.See ad page 14.

BODY SUGARING USA DAY SPADora Ochoa, L.M.T. 1800 W. Causeway Approach., Ste. 122Mandeville, 985-626-5538BodySugaringUSA.com

Unique,painless&permanenthairremoval,specializinginBrazilianbikinilines.Homeofthe“SlimmerYou”bodywrapandcellulitemassage.Instantgiftcertificatesonourwebsite.

CHANGE IN MOTION MASSAGE,LLCMel Borne, LMT #4158Northshore Area985-869-2087Relaxwithpersonalizedin-homesessions.SpecializinginShiatsu,SwedishandDeeptissue.Customizedblendingoftechniquesareincor-poratedintosessions.Essentialoilsareusedtomaximizethehealingbenefitsofyourmassage.See ad page 14.

THE PEACEFUL BUDDHA DAY SPACarey Mischler, LMT4303 Canal St., New Orleans504-322-2482

OfferinguniqueservicesthatcombinetherapeuticmassageandaestheticsinMid-City.Discountsavailabletofirstresponders.10%ofprofitsdonatedtoASPCAeveryWednesday.See ad page 14.

BREATHING

JACK ANTHONY FONTANABreathing Coach 3200 Lake Villa Dr., Metairie 504-453-9161JackFontana.com

Letmeguideyouthroughabreathingexperiencethatcanreleasestress,fear,suppression,anxietyandcreateaspaceofhealing,acceptance

andphysicalandemotionalwellbeing.ComeBreathe,RelaxandLetGo!

CHI MACHINE

JOFFRION MITTS, M.ED.Alternative Health Consultant504-897-9670ChiMachineForYourHealth.com

Exercisewithnoeffort!Loseweight!Relievestress!Eliminatepain!Improvecirculation!Lowerbloodsugar!Breathedeeper!Sleepbetter!Increaseenergy!Feelhappier!Freeoneweekin-hometrial!

LIST FOR RENT, ITEMS FOR SALE, HELP WANTED, OPPORTUNITIES, PRODUCTS OR SERVICES HERE. To P lace a Classified Listing Email to [email protected]. Must be received by the 10th of the month prior to publication. $1 per word. $20 minimum. Must be prepaid.

CURRENTLY PUBLISHING NATURAL AWAKENINGS MAGAZINES–ForsaleinBirmingham,AL;Cincinnati,OH;Lexington,KY;Manhattan,NY;NorthCentral,FL;Tulsa,OK;SouthwestVAandVolusia/Flagler,FL.Callfordetails239-530-1377.

FOR RENT - COMMERCIALOffice Space Available.Mid-CityandMarigny.Virtual,Private,orSharefloorspaceinatriplebottomlineatmosphere.Competitive/belowmarketrentforyourgrowingbusiness.FullamenitiesincludingWiFi/Conferenceroom/officeequipplusvalueaddedservicesprovided!The-BuildingBlock.comorcall504-561-7525.

Perfect space for licensed massage therapist or other quiet holistic provider.462sfincludeslarge14x17treatmentroom,closet,office/kitch-enandwaitingroom.$600/mo(includesutilities)withannuallease.3200LakeVillaAve,Ste208,Metairie.504-535-9771.

Northshore Space/Treatment Room. 10x12includesuseofwaitingarea,etc.$500(utilities,wf-fiincludedw/lease)inwell-beingcenter.601LafitteSt.,OldMandeville985-727-9665.

VOLUNTEER OPPORTUNITIES

The Humane Society of Louisiana needs volunteers.TofindouthowyoucanhelpcontactJeffDorsonat901-268-4432orStopCruelty11@gmail.com.

St. Tammany Humane Society – Help fosterpets,manytasksforfundraising,helpwithanimalsocializing,manymore.Callforwishlist.Contact:985-892-7387,x106.

The LatinoFarmersCoop.orgAnurbanagriculturenonprofitcommittedtopromoteresponsestofood,farmandnutritionneedsgardeningandfoodpantryvolunteers.Call504-333-3611or [email protected].

classifieds

BUSINESS OPPORTUNITIES

Page 36: Natural Awakenings - S.E. Louisiana May 2011

36 New Orleans NOLANaturalAwakeningsMag.com

CHIROPRACTIC/WELLNESS

CHIROPRACTIC HEALTH CENTER & HOLISTIC HEALTHCARE SERVICESDr. Debbi Hannan101 Clearview Pkwy at Airline, Metairie504-454-2000HannanWellness.com

Experiencethedifference!Weoffertotalwellnesscare:Chiropractic,detoxification,nutrition,endermolo-gie,DRX-9000non-surgicalspinaldecompression,coldlaser,EB-Cellu-larCleanser,FarInfraRedSauna.See ad page 16.

COLON HYDROTHERAPY

ALORACLEANSE1131 S. Tyler St, Covington 985-809-3133AloraCleanse.com

ColonHydrotherapyremovesstagnantfecalmatterandtoxicbacteriaalongwithcellulardebris.Getreliefofunhealthydigestivesymptomsand

achievegreaterimmunity,enhancedenergy,clearerskin,improvedmentalclarity,andageneralelevationinmood.

HOLISTIC LIFE4401 Veterans Blvd, Ste 200504-885-8800HolisticLife.us

AColonics,Wellness,WeightLossDaySpa,ColonHydrotherapy,massagetherapy,activatedoxygen

sauna,ionfootbath,reflexology,integratedmedicine,andothernatural/spaofferings.AcrossfromClearviewMallinthemajorbusinessareaofMetairie.See ad page 29.

UPTOWN COLON HYDROTHERAPY2627 General Pershing, NOLA504-644-7376UptownColonHydrotherapy.com

PTOWN

CHYDROTHERAPY

OLONUCOnlyclosedsystemcolonicinNewOrleans.Weoffera60minuteappointment,becauseweknowyoucannotrushacleanse.Weprovideahighly

trainedtherapistfocusedexclusivelyonyourneedatalltimes.See ad page 13.

VIVACITY WELLNESS SPA3333 Kingman St, Ste 102, Metairie504-885-8355VivaCityNOLA.com

Reclaimhealthandvitalitybyeliminatingtoxinsinthebody.WeofferOpenSystemColonHydrotherapy,FarInfraredSaunawithOzone,IonFootDetoxand

HyperbaricOxygenChamberTherapy.CertifiedColonHydrotherapistandmemberofI-ACT.See ad page 25.

CONSTRUCTION

SOUTHERN HOMES, LLC Certified Green Builder1-888-660-0123SouthernHomes.com

Customconstructionandrenovationspecializinginenergyefficiencyandindoorairquality.CertifiedbyNationalAssoc.ofHomebuildersasaGreenBuilder.

Locallyowned,20yearsexperience,over3000homesbuilt.

COUNSELING AND PSYCHOTHERAPY

ANDREA SCHEELE, LCSW, LMFTATTACHMENT PSYCHOTHERAPY1303 Amelia St., New Orleans504-899-2686

Attachment Psychotherapy / EMDR

“You too can move away from the past and towards a life of vitality, wholeness and fulfilling relationships.”

Individual, Couples& Family Therapy

Andrea Scheele, LCSW, LMFT1303 Amelia Street

New Orleans, LA 70115(504) 899-2686

Whenyouexperienceloss,illness,depression,stressoraregoingthroughmajorlifetransitionsAttachmentPsychotherapywillbenefityou.Individual,couples,family,parent/childandsmallgroup

therapy.See ad on page 3.

GINA L. ORIHUELA, LCSW-BACS, ND, CTN Holistic Psychotherapy & Counseling3213 Florida Ave, Ste D, Kenner 504-466-2266

PsychotherapistandNaturopath.Auniqueholisticapproachtoassistyouincopingwithloss,illness,stress,depression,orotherlifetransitions.Individual,familyand/orgrouptherapyclients.Children,adolescents,andadults.See ad page 17.

JENNIFER ENGEL, M.ED LPC5002 Prytania, NOLA, 70115504-813-9130

LicensedProfessionalCounselor.HolisticPsychotherapyforpersonalgrowth,stress,transition,etc.IndividualandGroupMind-BodySkillsTraining(guidedimagery,meditation,breathing,relaxation,

tapping,etc).EveningandSaturdayappointmentsavailable.

MANDALA THERAPY CENTER 638 Seguin St., NOLA 70114 504-251-7820/504-722-0877

therapy center

mandala

I am not what happened to me, I am what I choose to become.

C.J. Jung

therapy center

mandala

I am not what happened to me, I am what I choose to become.

C.J. Jung

therapy center

mandala

I am not what happened to me, I am what I choose to become.

C.J. Jung

therapy center

mandala

I am not what happened to me, I am what I choose to become.

C.J. Jung

MandalaTherapyCenterprovidescounselingforstress,anxiety,depression,grief,trauma,angermanagement,relationshipissues,career

decisions,personalgrowthandcreativeblocks.Ourtherapistsserveadolescents,adultsandcouplesonanaffordableslidingscalebasis.

DENTIST

MIKE ROBICHAUX, DDS1101 Robert Blvd, Ste A, Slidell, LA 70458985-641-8058MikeRobichauxDDS.com

Offeringaholisticandpatient-cen-teredapproachtodentistry,becausewebelievethehealthofthemouthandoverallhealthcannotbeseparated.Wehelpthoseweservemakedecisionsthatareintheirbest

interests,basedontheirvaluesandgoals,byprovidingstateoftheartinformationwithinatrustingrelationship.See ad page 31.

EDUCATIONAL KINESIOLOGY

BRAIN GYMTanya Simmons BA Ed. Licensed Brain Gym Practitioner/Consultant.New Orleans 504 309 0002/710 [email protected]. BrainGymNOLA.com

TeachingBrainGyminEducation,In-serviceandindividuallytohelpanylearningdifficulties,AD(H)D,reading,writing,attention,memory,performance,successforgoals,andthejoyandeaseoflearning.

Availableforteachers,parents,childrenandadults.Seewebsiteforupcomingtrainings/seminars.

ENERGY PSYCHOLOGY

MARYLOU SMITHUptown Holistic Center723 Hillary Street, New Orleans504-723-2899

Set Yourself Freewith the transformational power of PSYCH-KTM

Experience your unlimited power through the gentle processof PSYCH-KTM. Free yourself from traumatic memories,limiting thoughts and addictive behavior. Support what ismost meaningful in the journey of living your life’s purpose.

Marylou SmithAdvanced PSYCH-KTM Facilitator

Private Sessions

Uptown Holistic Center • 723 Hillary St, NOLA • 504.723.2899marylousmith.com • [email protected] • psych-k.com

PSYCH-Kisaprocessthatfreesyourmindoflimitingandself-sabo-tagingbeliefsandreplacesthemwithlifeenhancingbeliefsthatleadtogreatjoy,fulfillmentandgrowth.See ad page 13.

FENG SHUI

LIVE, LOVE AND FENG SHUIEveline Hoffmann Feng Shui practitioner504-861-3370boehlen747@gmail.comOfferingFengshuiconsultationsforhomesandbusinessesFindbalanceandserenitywithinyourhome.Makeintentionalchangesinyourdwellingsandyouwillalteryourlifeinpositivewiderangingways.Yourenvironmentwillbegintoassistyouandyouwilluncoversolutionstoyourdaytodayissuesandlifewillimprove.See ad page 19.

Page 37: Natural Awakenings - S.E. Louisiana May 2011

37natural awakenings May 2011

COMING IN JUNE

NEXT MONTH

MEN’SWELLNESS

Our doctors’ advice?

Eat, drink, be merry, and get moving.

Learn why.

HERBAL MEDICINE

JEN STOVALLCommunity [email protected]

Providingholisticconsultationstofosterwell-beingandsupporthealingusingherbalmedicine,nutrition,andlifestylechoices.Addressacuteissuesandconstitu-tionalimbalancesbycreatinga

personalwellnessplanthatincorporatesmedicinalherbsintoyourlife.

HOLISTIC/ENERGY HEALING

JESSICA TREGLEHolistic Energy Healing504-352-6418EnergyHealing-NewOrleans.com

EnergyHealingisaneffectivetherapyofalternativemedicineandholistichealth.Onereleasesnegativityandgainspositiveenergy!Becomemorehealthy,andthriveatanacceleratedpace!Healingoccurs

physically,mentally,emotionally,andspiritually!

HYPNOTHERAPY

DEEP PEACE HYPNOSIS LLCRev. David G. Harrison, CCHt.504-228-9004DeepPeaceHypnosis.net

DeepPeaceHypnosisoffershypnotherapyservicestohelppeopleImproveTestScores,QuitSmoking,LoseWeightandmuchmore.Weconductindividualand

grouptherapysessionsandwealsohaveCustom-MadeHypnosisCD’sforsale.

INTEGRATIVE MEDICINE

IRENE SEBASTIAN, M.D., PH.D401 Veterans Blvd, Suite 203Metairie, LA 70005504-838-9804IreneSebastianMD.com

Offeringaholisticapproachtohealthcare:IntegrativeMedicine,Homeopathy,FunctionalMedicine,HerbalTherapy,andNutrition.See ad page 23.

DR. KATHLEEN POSEY, M.D.377 Hwy 21, Ste 101, Madisonville985-845-4111

Ourmissionistoimprovehealthandreversechronicdiseasethroughhormonalandenergeticbalancingandnutrition.Apracticeofpreventivemedicineandwellnesswithaholisticapproachtowomen’sgynecological

andoverallhealth.Weofferahealthymedicallysupervisedweightlossprogram.See ad on page 13.

RAUL LLANOS, M.D.Wellness Clinic3749 N. Causeway, Metairie, LA 70002504-834-1050

Integrativewellnessclinicofferingayurvedaconsultation,cosmeticLASERprocedures,hormonetherapy,non-surgicaltreatmentforurinaryincontinence,bestnaturalsupple-mentsonthemarket,othermedical

spaservices.See ad page 28.

THOR AGUSTSSON, D.O.232 Barry Ave, New Orleans, 70121 H 504-861-3011 * C 815-520-2891 Osteopathic.org

Withaholisticapproach,Osteo-pathicMedicineeffectivelytreatspainwithouttheuseofdrugs.Wetreatfibromyalgia,cancerpain,birthtrauma,arthritis,chronichead,neck,back,pelvic,andabdominalpain.

Othermodalities:Reiki,Bodytalk,SupplementConsultation.

LIFE COACH

CHARLY BORENSTEIN-REGUEIRACertified Professional Life CoachCorporate & Life Coaching Services7121 Walmsley Ave, Ste D, NOLA 70125504-259-7726 [email protected]

Eliteathletesandexecutiveshavecoaches.ImaginehowmuchmoreproductiveandfulfillingyourlifewouldbeifyouhadyourownLifeCoach.Youdon’thavetoimagineanymore,contactCharlytoday.

MARTIAL ARTS

TAI CHI-QI GONGShifu King Lam8132 Willow St, [email protected]

AsianArtstoimprovehealth,fitness,personalsafety,rejuvenateenergy.Achieveabettermind,bodyandspirit.ServingNewOrleanscommunityfor35years.KingLam-

taichi-karate.com.See ad page 29 and calendar for classes.

For more information about advertising and how you

can participate, call

504-330-2157

Page 38: Natural Awakenings - S.E. Louisiana May 2011

38 New Orleans NOLANaturalAwakeningsMag.com

MASSAGE SCHOOLSBLUE CLIFF COLLEGEClearview MallMetairie, LA. 70006504-456-3141

Trainforanexciting,newcareerasaLicensedMassageTherapist.EarnanAssociatesdegreeuponcompletionofadvancedmassagetraining.Inquireaboutfinancialaid.See

calendarforinformationaboutour$30-studentmassageclinic.

MINISTRY/SPIRITUALITY

REV. BONNIE POIRIER 985-373-2321PeacefulPlanetPets.comHolisticTherapyCenter.comHolistic,metaphysicalChristianminister,ordained1994.Ministeringtopeopleandpetsincludingpetgriefandmemorials,Reiki,petblessingsandnaming,labyrinthwalksandpetsitting.Alsoforpeople:weddings,funerals,divorceceremonies,baptisms,communion,andblessings.

UNITY CHURCH OF METAIRIE3939-B Veterans Blvd, Metairie 504-885-7575 Daily Prayer Line 504-885-7056

Breakingboundariesthroughtransformativethought.AChristianchurchcelebratingtheLoveofSpiritwhilehonoringallpaths.(2blocks

westofCleary,entrance/parkinginrearofbldg)Sundayservice11am.

NATURAL BABY & CHILD

ZUKABABY2124 Magazine St., NOLA 504-596-6540ZukaBaby.com

ZukaBabyisanewshopspecializinginclothdiapering,babywearingandhandmadechildren’sitems.ClothdiaperingclasseseverySaturday.Seecalendarforotherevents.See ad page 30.

NATUROPATHIC DOCTOR

DR. LISA MARIE CHAMBERS, NDCenter For Functional Medicine723 N. Causeway Blvd, Mandeville 985-237-0277Accurate Clinic2401 Vets Blvd, Ste 16, Kenner504-472-6130DrLisaMarieChambers.com

Dr.Chambersworksinpartnershipwithherpatientstodiscover,understandandaddresstherootcauseoftheirillness.Bytreatingthewholeperson,shealsooffers

preventivecarebeforeseriousillnessoccurs.

NUTRITIONIST

DANIELLE PACIERA, LDN, RD, CCN3618 Magazine St, New Orleans [email protected]

Cuttingedgeholisticnutritionservices.Specializingincomplementaryandalternativemedicine,therapeuticusesoffoods,supplementation,vegetariannutrition,women’shealth,sportsperformance,eatingdisorders,

depression,addiction,andmore.See ad page 7.

REALTOR

CHERYL GAUTIER, REALTOR, GREEN Dorian Bennett Sotheby’s Int. Realty2340 Dauphine St, NOLA 70117(c) 504-638-7441 (o) [email protected].

UpbeatcreativeproblemsolverwithaneasygoingNewOrleanianstylehelpingindividualstofindtheirdreamhome!

REIKI

ELIZABETH OHMER PELLEGRIN, R.M.T.Reiki Master Teacher & Practitioner504-388-2356NOLAReiki@gmail.comNOLAReiki.comOffering20yearsexperienceinUsuiShikiRyoho,upholdingthehigheststandardsinReikiclassesandReikisessions.PractitionerandTeacherofAustralianBushFlowerEssence.AlsoprovidingAstra-Litemassage&Reikitables–lightweightandeasytotransport.See ad page 12 and calendar for classes.

TIANNE D. LASTRAUSUI, KARUNA & RAINBOW REIKI MASTER504-909-3723AmazingReiki.com

Certified&experiencedMasterTeacherofferingsessions&classestotheGreaterN.O.Area.HealingTouch,PranicHealing,CrystalHealing,ReikiDrummingand

AnimalReikipractitioner.Visitourwebsiteforfullinformation.See ad page 25.

SOLAR

SOUTH COAST SOLAR, LLC 2605 Ridgelake Dr.Metairie, LA 70002504.529.SUN9SouthCoastSolar.com

100%locallyownedandoperated,SouthCoastSolarisLouisiana’slargestsolarenergycompany.Callorvisitourwebsitetosetupafreeestimate.See ad page 17.

YOGA

DIVINE YOGA1223 Baronne [email protected] YogaNOLA.com

KundaliniYogaisconsideredtobethemostcomprehensiveofyogas,combiningmeditation,physicalpracticeandbreathingexercises.Alllevelsofexperiencearewelcometoallclasses.

See ad page 15 and calendar for events/classes.

WILD LOTUS YOGA4842 Perrier St.New Orleans, LA 70115504-899-0047WildLotusYoga.com

Gambit’s”BestPlacetoTakeaYogaClass”fiveyearsinarow.Over40ongoingclassesperweekforbeginnersandexperiencedtaughtby

skilledteachersinapeaceful,positiveatmosphere.Offeringcourses,workshops,retreatsandconcerts.See ad page 15 and calendar for events/classes.

YOGA TEACHER TRAINING

YOGA SCHOOL, L.L.C.603 S. Tyler St., Covington, LA 70433985-893-8834YogaSchoolCovingtonLA.com

AstatelicensedschoolandYogaAllianceregisteredteachertrainingcertificationprogramatthe200hourand500hourlevels.Visitwebsiteformoreinformation.See ad page 15.

YOGA THERAPY

AMY ARCHINAL, RYT, PRYTPhoenix Rising Yoga Therapy504-899-6167NewOrleansYogaTherapy.com

PhoenixRisingYogaTherapycombinesmeditation,assistedyogapostures,breathworkandclient-centereddialoguetopromoteself-awareness.Discoverthe

wisdomofyourbody.See ad page 15.

Page 39: Natural Awakenings - S.E. Louisiana May 2011

39natural awakenings May 2011

For information about how to publish a Natural Awakenings in your community call

239-530-1377NaturalAwakeningsMag.com

turn your passion into a business...

As a Natural Awakenings publisher, you can enjoy learning about healthy and joyous living while working from your home and earn a good income doing something you love!

Your magazine will help thousands of readers to make positive changes in their lives, while promoting local practitioners and providers of natural, earth-friendly lifestyles. You will be creating a healthier community while building your own financial security.

No publishing experience is necessary. You’ll work for yourself but not by yourself. We offer a complete training and support system that allows you to successfully publish your own magazine.

Be part of a dynamic franchised publishing network that is helping to transform the way we live and care for ourselves. Now available in Spanish as well.

To determine if owning a Natural Awakenings is right for you and your target community, call us for a free consultation at 239-530-1377.

• Low Investment

• Work at Home

• Great Support Team

• Marketing Tools

• Meaningful New Career

• Birmingham,AL*• Huntsville,AL• Mobile/Baldwin,AL• LittleRock/ HotSprings,AR• Phoenix,AZ• Tucson,AZ• EastBayArea,CA• LosAngeles,CA• SanDiego,CA• SantaBarbara/ Ventura,CA• Denver/Boulder,CO• Hartford,CT• FairfieldCounty,CT• NewHaven/ Middlesex,CT• Daytona/Volusia/ Flagler,FL*• NWFLEmeraldCoast*• Ft.Lauderdale,FL• Jacksonville/ St.Augustine,FL• Melbourne/ VeroBeach,FL• Miami&FloridaKeys• Naples/Ft.Myers,FL• NorthCentralFlorida*• Orlando,FL• PalmBeach,FL• PeaceRiver,FL• Sarasota,FL• Tallahassee,FL• Tampa/ St.Petersburg,FL• Florida’sTreasure Coast• Atlanta,GA• Augusta,GA• ChicagoNorth Shore,IL• Indianapolis,IN• Lexington,KY*• Louisville-Metro,KY• Lafayette,LA• NewOrleans,LA• MiddlesexCo.,MA• AnnArbor,MI• GrandRapids,MI• EastMichigan• Lansing,MI

• WayneCounty,MI• Asheville,NC• Charlotte,NC• Raleigh/Durham/ ChapelHill,NC• Wilmington,NC• Monmouth/ Ocean,NJ• NorthNJ• NorthCentralNJ• Somerset/Middlesex Counties,NJ• SouthNJ• SantaFe/ Albuquerque,NM• LongIsland,NY• NewYorkCity,NY*• Rockland/ OrangeCounties,NY• Westchester/ PutnamCo’s.,NY• Cincinnati,OH• OklahomaCity,OK• Tulsa,OK*• Portland,OR• BucksCounty,PA• Harrisburg,PA• LehighValley,PA• Northeastern,PA• RhodeIsland• Charleston,SC• Columbia,SC• GrandStrand,SC• Greenville,SC• Chattanooga,TN• Knoxville,TN• Memphis,TN• Nashville,TN• Austin,TX• Dallas,TX• Houston,TX• NorthTexas• SanAntonio,TX• Tyler/Longview,TX• Richmond,VA• SouthwesternVA*• Seattle,WA• Madison,WI• Milwaukee,WI• PuertoRico

*Existingmagazinesforsale

Phenomenal Monthly Circulation Growth Since 1994. Now With 3.3 Million Monthly Readers In:

own a Natural Awakenings magazine!

Page 40: Natural Awakenings - S.E. Louisiana May 2011

40 New Orleans NOLANaturalAwakeningsMag.com

Friday-Sunday

May 20-22

Bayou St. John

New Orleans

TheBayouBoogaloo.com

PMS 300

CMYK = C=100 M=43

ART

FOOD

MUSIC

Rockin’ Dopsie Jr, DJ Jubilee,

Delfeayo Marsalis’ Sweet Thunder, Cyril Neville & Tribe 13,

Pinettes Brass Band, Grupo Fantasma, Los PoBoy Citos, Big Chief Alfred

Doucette and many more!