Transcript
Page 1: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Gibbs sampling

Morten Nielsen,CBS, BioSys,

DTU

Page 2: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Class II MHC binding

• MHC class II binds peptides in the class II antigen presentation pathway• Binds peptides of length 9-18 (even whole proteins can bind!)• Binding cleft is open• Binding core is 9 aa

Page 3: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Gibbs samplerwww.cbs.dtu.dk/biotools/EasyGibbs

100 10mer peptides2100~1030 combinations

Monte Carlo simulations can do

it

Page 4: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Gibbs sampler. Monte Carlo simulations

RFFGGDRGAPKRGYLDPLIRGLLARPAKLQVKPGQPPRLLIYDASNRATGIPA GSLFVYNITTNKYKAFLDKQ SALLSSDITASVNCAK GFKGEQGPKGEPDVFKELKVHHANENI SRYWAIRTRSGGITYSTNEIDLQLSQEDGQTIE

RFFGGDRGAPKRGYLDPLIRGLLARPAKLQVKPGQPPRLLIYDASNRATGIPAGSLFVYNITTNKYKAFLDKQ SALLSSDITASVNCAK GFKGEQGPKGEPDVFKELKVHHANENI SRYWAIRTRSGGITYSTNEIDLQLSQEDGQTIE

E1 = 5.4 E2 = 5.7

E2 = 5.2

Paccept =1

0 < Paccept < 1

Page 5: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Monte Carlo Temperature

• What is the Monte Carlo temperature?

• Say dE=-0.2, T=1

• T=0.001

Page 6: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Shift alignment window

Gibbs sampler. Monte Carlo simulations

Getting stucked in local minima

Page 7: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

It works

High Temperature Low Temperature

Page 8: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Gibbs sampler. Prediction accuracy

Page 9: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Use of Gibbs sampling

• More than 1,000 papers in PubMed using Gibbs sampling methods• Transcription start-sites• Receptor binding sites• Acceptor:Donor sites• ...

Page 10: Gibbs sampling Morten Nielsen, CBS, BioSys, DTU. Class II MHC binding MHC class II binds peptides in the class II antigen presentation pathway Binds peptides

Summary

• Weight matrices can accurately describe a sequence motif like MHC class I• Use sequence weighting to remove data

redundancy• Use pseudo count to compensate for few

data points

• Gibbs sampling can detect MHC class II binding motif


Recommended