Download pdf - delete

Transcript

Michelle Kim

Scavenger Hunt

4. Cytochrome C is involved with cell apoptosis. It is a mitochondrial protein.

MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGED

TLMEYLE

NPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

The letters represent amino acids.

M: Methionine

G: Glycine

D: Aspartic acid

V: Valine

E: Glutamic acid

K: Lysine

I: Isoleucine

F: Phenylalanine

C: Cysteine

S: Serine

Q: Glutamine

H: Histidine

T: Threonine

P: Proline

N: Asparagine

L: Leucine

R: Arginine

A: Alanine

Y: Tyrosine

W: Tryptophan

5. BLAST, or Basic Local Alignment Search Tool, compares primary structure sequences. For

example, it compares two amino acid sequences for protein or nucleotide sequences for DNA.

We learn the relative distance of the similarities and evolution of Cytochrome c found in other

animals. Primates’ Cytochrome c is closer to homo sapiens’ than rabbits or bats.

8.

The bee lands on a flower looking for food, mainly pollen and nectar. As they are moving around,

their feet slip into grooves filled with sacs of pollen. The sacs of pollen stick to the bee’s legs.

When the bee flies off and lands on another plant, while it is moving around looking for food

inside the flower, the pollen may rub off or fall of the bee’s legs onto the stigma (female part) of

the flower. This will pollinate the plant.

9. Pollinated by wind: Grass Pollinated by pollinator: Dandelion

10.

Palm trees grow on the beach. How long are its roots and why is the trunk thinner than a

deciduous tree?

13. Bryophyte gametophyte: moss 14. Vascular plant: pine (coniferous) tree

16.Reptile: turtle 17. Dog

19. Annelid: Earthworm 21. Arthropod: Ant

22. Chordate: Squirrel

23. Food web


Recommended