Upload
others
View
2
Download
0
Embed Size (px)
Citation preview
1
CONTENTS
Bulgaria – Overview 2
Overview of the Machine Building Sector in Bulgaria 5
Overview of the the Electrical Engineering and Electronics Sector in Bulgaria 9
Bulgarian Branch Chamber - Machine Building 12
Bulgarian Association of Electrical Engineering and Electronics (BASSEL) 14
Bulgarian Small and Medium Enterprises Promotion Agency (BSMEPA) 16
List of the Bulgarian Participants 19
Companies’ Profiles 20
2 3
Bulgaria in Europe
Relief
Official name Republic of Bulgaria
Location South East Europe
Area 110,994 sq km
Border countriesRomania to the NorthSerbia and Macedonia to the WestGreece and Turkey to the South Black Sea to the East
Climate Moderate continental
Population 7.36 million
Form of Government Parliamentary Republic
Official language Bulgarian
Capital city Sofia
Time GTM +2
Country dialing code +359
Currency Bulgarian Lev ( BGN)
Exchange rate BGN 1,95583 per 1€
Taxation Flat income tax rate - 10% Standard corporate tax - 10%
National holidays March 3rd, May 6th, 24th May, September 6th, September 22nd, November 1st
General Information
GDP (€ in BGN): 10 069 million (Q 3 2013)
Exports (in BGN): 32 458 million (Q 3 2013)
Imports (in BGN) 38 493 million (Q 3 2013)
FDI 2 436.9 million BGN (September 2013)
GDP growth (%) 0.7 (till September 2013)
Unemployment (%) 12.0
Inflation rate (%) -0,2 (November 2013)
2013 Economic Snapshot – Preliminary data
4 5
Why Bulgaria?
Strategic Geographical Location - Southeastern Europe
Political and business stability
Low budget deficit and government debt
Currency board
Member of NATO – March 2004
Member of European Union – January 2007
Institutional support for foreign investment projects
More than 100 agreements promoting the investments and for avoiding the double taxation
10% corporate tax rate
Free market access
Highly educated workforce
A network of international motorways crosses the country and makes vital connections to Western Europe, Russia, Asia Minor, and to the Adriatic, the Aegean and the Black Sea.
Overview of the machine building sector in Bulgaria
The Bulgarian machine building is an export-oriented industry. In the Manufacture of machinery and equipment and in the automotive industry (units, accessories, spare parts, etc.), over 80% of the production is exported. Over 75% of the machines are exported to the EU. The value of the production in 2013 is around 8% more than in 2012, for all the subsectors of the machine building, except the Manufacture of other transport equipment, where there is a decrease of around 15%. The development of the European economy and machine building directly affects the Bulgarian machine building sector. A further positive development in the industry of the leading European countries will have a definite positive effect on the Bulgarian companies.
Since the beginning of the 2000s, the machine building companies began to gradually increase their sales revenue every year, to enter and develop new markets. Particularly favorable are the years 2006-2008, during which the exports follow a steady growth rate of around 20-30% per annum. After the accession to the EU, the possibilities for the companies to apply for investment projects with co-funding from the European funds, increased significantly. The companies focused on the implementation of new, modern equipment and technologies and on the development of new products. The Bulgarian machine building production became competitive on the international market, the former markets were restored and new ones were uncovered. There was also a stabilization in the number of qualified personnel – fewer and fewer experts and specialists were looking for work abroad.
The crisis of 2009, which began a few months later, than the crisis in the developed European countries, had a catastrophic effect on the companies in the sector. The number of the persons employed, from 143 000 in all subsectors of the machine building - Manufacture of machinery and equipment; Manufacture of fabricated metal products, except machinery and equipment; Manufacture of motor vehicles, trailers and semi-trailers; Manufacture of other transport equipment, decreased with more than 30 000 people. In 2009-2010, around 10% of the companies suspended their operations.
6 7
At the end of the first half of 2013, the number of persons employed in the machine building subsectors is 102 000. For the subsector “Manufacture of machinery and equipment”, the number is 33 000. The largest number of persons employed is in the subsector “Manufacture of fabricated metal products, except machinery and equipment” – 40 000. The total number of companies is over 3000, 2200 from which are with a total number of 8000 persons employed. Around 47% of all persons employed work in companies with more than 250 employees. Total output is over 3,5 billion Euro.
A number of machine building companies are with foreign participation in the ownership:Liebherr Ltd. – Plovdiv (Germany)Ideal Standart Vidima Jsc. – Sevlievo (USA)Berg Montana Fittings Jsc. – Montana (Spain)WATTS Industries Bulgaria Ltd. – Plovdiv (USA)Ceratizit Bulgaria Jsc. – Gabrovo (Austria)Pnevmatika – Serta Jsc. – Kardjali (France)Ixetic Ltd. (Germany);Palfinger Produktionstechnik Jsc. – Cherven Bryag (Austria)SKF Berrings Bulgaria Jsc. – Sopot (Sweden)Vipom Jsc. – Vidin (Russia)Montupet Ltd. Ruse (France)
Machine tools, metalworking and wood working machines and instruments:ZMM-Sliven Jsc. – SlivenArsenal Jsc. – KazanlakVaptsarov Holding Jsc. – PlevenRais Ltd. – PazardjikZMM Stomana Jsc. – SilistraCeratizit Bulgaria Jsc. – GabrovoVSK Kentavar – IZ Dinamika Ltd. – Dryanovo
Hydraulic elements and presses:M+S Hydraulic Jsc. – KazanlakCaproni Jsc. – KazanlakPnevmatika-Serta Jsc.- KardzhaliHES Jsc. – YambolGarant Jsc. – Byala Slatina
Material handling equipment:Balkancar Record Jsc. – PlovdivDimex Lift Ltd. – PlovdivPodemcrane Jsc. – GabrovoSkladova Tehnika Jsc. – Gorna Oryahovitsa
Machines and equipment for the food industry, refrigeration, air-conditioning and ventilation equipment:
Hraninvest-HMC Jsc. – Stara ZagoraBiomashinostroene Jsc. – PlovdivIndex – 6 Ltd. – PlovdivPIM Ltd. – HaskovoAtaro Clima Ltd. – PlovdivTangra-AV Ltd. – SofiaBrist XM Jsc. – BreznikFai BG Ltd. – Pazardjik
Automobile, trailers and semi-trailers:Litex Motors Jsc. – LovechMadara Jsc. – ShumenGrammer Jsc. – TrudovetsIxetic” Ltd. – StryamaMontupet Ltd. – RuseRemel Jsc. – ElenaRembi Jsc. - Elena
88 9
Heavy machine building, ship building:Himmash Jsc. – HaskovoHem Jsc. – PlevenKotlostroene Jsc. – SofiaNord Jsc. – DevnyaBulyard Shipbuilding Industry Jsc. – VarnaShip Machine Building” Jsc. - Varna
Agricultural machine building:Madara Jsc. – ShumenPerla Jsc. – Nova ZagoraRalomex Jsc. – ZavetMetal Agro Jsc. – Dobrich
Optics and optical equipment:Opticoelectron Jsc. – PanagyurishteOptix Jsc. – PanagyurishteOMZ Ltd. – Sofia
Foundry, forging and pressing production:Radomir Metal Industries Jsc. – RadomirProgress Jsc. – Stara Zagora Ossam Jsc. – LovechAlucom” Jsc. – PlevenVMV Metal Ltd. – IhtimanPreskov Jsc. – Stara ZagoraForging and Press Plant Jsc. – Russe
OVErViEW OF ThE ElECTriCal ENgiNEEriNg aND ElECTrONiCS SECTOr
iN Bulgaria
The Electrical Engineering and Electronics sector has been transformed relatively successful, after the economic changes during the nineties, based on its development up to 1990 and thanks to the powerful positions of the electrical engineering in Bulgaria.It is indicative, that the electrical engineering factories were the first ones to be privatized. The privatization of the electrical engineering industry was accomplished practically about the end of the nineties. Even though without significant investments, ABB, Schneider, Hyunday, Sparky and some other companies procured important manufacturing plants. As a follow up, FESTO, SCHNEIDER, ABB realized big “greenfield” production projects. The restructuring was facilitated by the availability of the necessary technical and economic cadres as well as the already established positions on the global market.Representative of the sector is its technological fragmentation. Historically, the enterprises were created with the aim of being subcontractors or sub suppliers of parts, components and modules. Only a few end products have their own brand.Technologically tied structures are being created gradually around the big foreign investors’ enterprises.
The substantial production directions and the respective important companies are as follows:
Cables, enameled wires, harnesses: ELKABEL, GAMAKABEL, EMKA, NSKF-Trade, YAZAKY, CE-BORDNETZE
Starter and traction batteries: ELHIM-ISKRA, MONBAT, ENERSYS
Electric motors, generators, alternators: HARMANLI, ELPROM-ZEM, DINAMO, MMOTORS, ELMATEH, AMK
Transformers: HYUNDAI-HEAVY INDUSTRIES, LEMY-TRAFO, ELPROM-TRAFO, ISOMATIC-LAB, AQ, SOKOLOVO, ELPROM-EMZ, SIEMENS
10 11
22%
Apparatuses & Switching devices: HV/MV/LV: ABB-AVANGARD, ABB-PWTRICH, ABB-RAKOVSKI, SCHNEIDER, EME, ISKRA-SILATRONIK, NIKDIM
Electrical distribution and control devices: FILKAB, ELEKTROGETZ, METIX, ANHATON, PAVEL&SONS, ELKOM, ELPROM-ET, PENON, ELIA, MEGAEL, OSKAR-EL, EL-TEST
Industrial electronics, controls and measurement: ELECTROINVENT, COMICON, EMSYST, KARAT-ELETRONICS, MPS, DELTA-INSTRUMENTS, SENSOR—NITE
Electronic modules, assembled PCBs: EPIQ, FESTO, TELETEK, HIC, MELEXIS, EME, CET
Electronic cash registers: DATECS, KARAT-ELECTRONICS, DAISY
Electric metering devices: KARAT ELECTRONICS, MPS, DAISY
Electric household appliances: LIEBHERR, ELDOMINVEST, TESY
Lighting fixtures and elements of building installations: TEHNOSVET, ATRA, SAMEL 90, DENIMA, KUBRAT
Lifts: TEHNOS, TOP LIFT, IZAMET, ALEX
Electric hand tools: SPARKY
The sector is characterized by an exuberance of qualified specialists. There are 5 technical universities and 65 vocational training schools in electrical engineering and electronics in Bulgaria. A positive tendency for the realization of highly qualified specialists is being observed in manufacturing companies of foreign investors.
12 13
The Bulgarian Branch Chamber - Machine Building is a non-profit association for rendering assistance, encouragement, representation and protection of the interests of its members. It was established in 1991 as an independent legal entity. It liaises with the relevant agencies and organizations for addressing issues of interest for the companies in the machine building sector. It maintains contacts with similar organizations from Germany, Austria, Switzerland, France, Serbia, Korea and other countries. In October 2012, the branch chamber was accepted as a member-observer in CEEMET.
Members of the branch chamber are more than 280 companies from all sectors of the machine building – heavy and investment equipment, machine tools, woodworking machinery and tools, hydraulics and pneumatics, machinery for the food industry, refrigeration, transport and lifting equipment, agricultural machinery, semi-finished products – casting, forging and pressing. The Branch Chamber member companies manufacture about 65-70 % of the Bulgarian machine building production.
As a voluntary organization, the branch chamber has mainly coordinating functions. It assists its members in the implementation of various activities of mutual interest: social partnership; establishment of direct contacts with foreign companies and organizations; organization of specialized visits of machine building companies abroad; participation in exhibitions and fairs; information and consultancy services; developing proposals for legislative acts; assistance in the solving of technological problems and other issues, related to the development of the companies and the sector and increasing their competitiveness.
BULGARIAN BRANCH CHAMBER &MACHINE BUILDING
BulgariaN BraNCh ChaMBEr &MaChiNE BuilDiNg
Bulgarian Branch Chamber Machine BuildingTel: +359 2 988 27 65, Fax: +359 2 989 28 06
[email protected] , [email protected]
Dimitar Kehayov – International Relations Associate
The branch chamber is constantly assisting the companies with the developing of projects, financed by the European funds. For this purpose there is a Consulting Centre for the Acquisition of the European Funds, established in the branch chamber.
Three unions have also been established as non-independent legal entities, attached to the branch chamber, namely: Truck Producers Industry Union, Refrigerating and Conditioning Machinery Union and Foundry Industry Union.
The branch chamber assists foreign companies and organizations, interested in cooperating and establishing direct contacs with Bulgarian ones.
14 15
To achieve its goals, BASSEL: • EstablishesusefulcollaborationandcontactswithEuropean,nationalandinternationalbranch
associations and companies and supports development of commercial and technological links between branch partners. Close relations have already been established with the most authoritative German organizations as VDE, VDI, ZVEI, ZVEH, well-known to international circles. Aiming elaboration of new market perspectives for its members, BASSEL has concluded agreements with the Italian National Association of Electrical Industry, the Italian Commercial Chamber in Bulgaria, the Serbian Chamber of Commerce, AENOR (Spain), the Trade and Industrial Chamber of China, the Czech and Moravian Electric & Electronic Association. Good contacts are maintained with the respective chambers in the Balkan region. BASSEL is an active member of the authoritative international organization INTERELECTRO with headquarters in Moscow.
• Organizes business visits of foreign experts and investors to this country and of Bulgarianspecialists abroad, organizes national and international meetings, workshops, conferences, training and professional courses.
• Takes part in consulting councils, committees andworking groupswith the state and publicauthorities and introduces to the state authorities proposals of new and amended legislative acts in the domain of control of the economy.
• Preparesannualanalysisesofthestateandthetendenciesinthebranch,publishesinformativeand advertising materials on technological, manufacturing opportunities and human resources of the companies. BASSEL keeps the Bulgarian electrical engineering society au courant on important branch issues, trends, tenders etc. and publishes two electronic bulletins weekly, respectively maintains a currently updated web-site.;
• Takespartinseveralprojectsforestablishmentofindependenttestinglaboratoriesforproductcertification, incl. in collaboration with VDE and assists the public and state authorities in implementing the European technical legislation.
• Organizes participation of companies and maintains own stands at international fairs andexhibitions, incl. HANNOVER MESSE, LIGHT & BUILDING (Frankfurt), INTEL (Milan) and at national exhibitions and fairs, as ELTECH (Sofia), PLOVDIV FAIR etc.
Bulgarian Association of Electrical Engineering and Electronics (BASSEL)Tel: + 359 2 963 35 32; 963 34 37,
Fax: + 359 2 963 07 [email protected]
The Bulgarian Association of Electrical Engineering and Electronics (BASSEL) is a nation-wide representative of the main part of the Bulgarian electrical engineering industry and was founded in 1994 as an officially registered national non-profit organization with members – state enterprises. Only just after the privatization of the industry, the Chamber started gradually to function and the number of its members from around 30 in 1999 increased to more than 150 companies from the electrical branch with manufacturing, engineering, commercial, consultant and R&D activities.
They join the Chamber on a voluntary basis, incl. all leading foreign branch investors as FESTO, ABB, SCHNEIDER, HYUNDAI, SPARKY, BOSCH etc. with a staff total of about 13 000 employees in the following sectors: HV/MV-electric power equipment, switchgear; LV-switchgear, electric utilities, lighting fixtures, luminaries; Cables and wires; Electric motors, hand tools, hoisting & haulage and transport technique; Batteries; Automation, control & measurement appliances; Subcontractors of elements, parts, materials; Electric thermal equipment; Engineering, complete projects, consultancy; Trade companies.
For its entire service work, BASSEL has been selected and awarded as one of the best and most successful chambers and associations in Bulgaria for 2002/2003 by GTZ – the German Society for Technical Co-operation at the Federal Ministry for Economic Development and Collaboration (BMZ).
BULGARIAN ASSoCIATIoN oF ELECTRICAL ENGINEERING AND ELECTRoNICS (BASSEL)
16 17
Bulgarian Small and Medium Enterprises Promotion Agency (BSMEPA)2-4, Lege str., Sofia 1000, Bulgaria
Phone: + 359 2 940 7940; Fax: + 359 2 940 7993E-mail: [email protected]
www.sme.government.bg; www.export.government.bg
- Analyses of the competitive industrial sectors and product groups- Trainings and seminars for capacity building and development of skills in foreign trade- B2B forums and trade missions abroad- National participation of SMEs in international exhibitions, fairs and other promotional events.
Projects:• Project „Promotion of the Internationalization of Bulgarian Enterprises”, financed by the
European fund for regional development through an Operational programme “Development of the competitiveness of the Bulgarian economy” 2007 – 2013 on which BSMEPA is an Institutional Beneficiary.
• Intermediary Body and Beneficiary of Priority Axis 3“Private Sector” of the Bulgarian-SwissCooperation Programme to Reduce the Economic and Social Disparities within the Enlarged European Union.
• Project“SmarterClusterPoliciesforSouthEastEurope”(ClusterPoliSEE)fundedbytheSouthEastEurope Transnational Cooperation Programme in which BSMEPA is a partner.
• InternationalProject“VocationalInternationalTradeTrainingImplementation”(VITTI)financedby the Programme "Lifelong Learning" of EU in which BSMEPA is a partner.
17
The Bulgarian Small and Medium Enterprises Promotion Agency (BSMEPA) was established in 2004 as a government institution to the Ministry of Economy and Energy of Republic of Bulgaria. Its main functions are focused on the implementation of the Bulgarian government’s policy for small and medium enterprises (SME).
BSMEPA Mission:• SMEspartnerforbusinesssuccessandcompetitiveness• Coordinatingauthoritybetweenthebusiness,administrationandNGOs
Activities:• ProvidinginformationandconsultingservicestotheBulgarianSMEs.• OrganizingtrainingcoursesandpromotionactivitiessupportingtheincreasementoftheSMEs’
competitiveness and strengthening their international positions.• Administrationandmonitoringofprogrammes,projectsandinitiativesrelatedtotheinnovative
activity and technological development of Bulgarian companies – National Innovation Fund, EUREKA, joint programme Eurostars.
• Supporting the Internationalization of the Bulgarian SMEs through providing services andimplementing instruments for strengthening the International positions of the SMEs:
- National Export Internet Portal www.export.government.bg
BULGARIAN SMALL AND MEDIUM ENTERPRISES PROMOTION AGENCY
BULGARIAN SMALL AND MEDIUM ENTERPRISES PROMOTION AGENCY (BSMEPA)
18 19
liST OF ThE BulgariaN ParTiCiPaNTS
10X LTD.ADP-SMOLYAN LTD.AFETECH LTD.ANSA BORIMA LTD.ARTEH LTD.ASTROIDA LTD.BALKANCAR ZPDEA “G. KOSTOV” JSCBLIK 99 LTD.BULTRAF LTD.BUSSAN LTD.DAMVENT LTD.DIMITAR CAROVSKY COMPANYEKITA LTD.ELINDUSTRY LTD.EME ADEUROMET LTD.FINCOM-2 LTD.GEORGI SIMEONOV- ELEC TRICAL ENGINERING AND AUTOMATION ETHIDROPNE VMOTEHNIKA ADHYDROSYSTEM LTD.ITS-IVONA LTD.KIRKOVO LTD.KRES-D LTD.METAKOM SC W INVEST JSCMETAL TECHNOLOGY GROUP AD NAKMASH-97 LTD.NEARSOFT LTD.NIKO M 66 LTD.PROMEL SE VLIE VO LTD.ROSOF LTD.SINTER-M JSC.SPARTAK JSCTOPLOMASHINEX BG LTD.VANIKO LTD.VARIANTI LTD.VMV METAL LTD.WEGAS ELEC TRIC LTD.
BulgariaN NaTiONal ParTiCiPaTiON
haNNOVEr MESSE 2014
7 – 11 aPril 2014haNNOVEr, gErMaNy
20 21
Company name: ADP-SMOLyAN LTD.Address: 1 Rada Kazalieva str., Smolyan 4700, BulgariaPhone: +359 887 74 40 17E-mail: [email protected]: www.adpsm.comManager: Kiril Mitov (Director)Representative: Todor MitovPosition: Managing Partner – Marketing and SalesPhone: +359 887 74 40 17
Company Activity:„ADP-Smolyan”Ltd.wasfounded1989inSmolyan,Bulgaria,whichmadeitthefirstprivatelyheldcompany in the region. In the beginning, its specialization was in the production of elements and technological projects for industrial equipment. Today, its main fields of operation are Automation of industrial equipment and Production of custom andstandardmachineswithComputerNumericalControl(CNC).Forthesepurposes,„ADP-Smolyan”Ltd. has developed two unique modules for linear and rotary movement with zero backlash. The con-struction of these two modules allows for achieving an exceptionally low price of the final product compared to the industry average, while ensuring high speed and high precision of work. In addition, the modules provide easy and inexpensive after-sale service, and long operational life of the machine. The modules are particularly suitable for building assembly robots and handlers, aggregate modular machinery (e.g. plasma cutters, laser cutters, woodworking machines, etc.).Thanks to the unique modules and its know-how, today “ADP-Smolyan” Ltd. manufactures great variety of CNC machines for the metal working, wood working, marble working industry and also customized solutions. Thecompany’smissionistoprovide„Greatproductivityataffordableprices!”toitsnationalandinter-national partners. Thus, its solutions are affordable, reliable, easy to use with proven high quality and high speed of work, in order to suit the needs not only of medium/large size companies, but also of smallsizecompanies.Inordertoachievebusinessexcellence„ADP-Smolyan”Ltd.hasbeenintegrat-ing parts and software supplied by world leaders like Bosch Rexroth, Item GmbH, Hiwin, Mitsubishi, HSD, MecSoft Corporation, etc.
Company name: 10x LTD.Address: : 31, Petar Protich str., 1750 Sofia, BulgariaPhone: +359 2 807 68 60Fax: +359 2 807 68 66E-mail: [email protected]: www.10x.bgManager: Vladimir AtanasovRepresentative: Vladimir AtanasovPosition: OwnerPhone: +359 888 52 12 52
Company Activity:NAME TAGS, PRODUCT PLATES, FRONT PANELS, ACRYLIC ENCLOSURESFor the last 12 years, 10x LTD. became one of the biggest signs, name plates, tags and front panels producer on Bulgarian market. Wide range of equipment, purchased from leading European, USA and Canadian companies ensures high quality production. Our cutting, engraving and marking la-sers, routers, waterjet cutter, etching machines in connection with direct-to-aluminium printer and trained staff delivers all kind of signs up to 2000 x 3000 mm (depending of material) for industrial, architectural and advertising markets.Materials to be processed are anodized aluminium, stainless steel, mild steel, brass, acrylic, foamed or solid PVC as well as all other kinds of plastics.Among our customers are ABB, AQ Group, Vipom, Stimex, HELI Bulgaria, Walltopia etc.Starting from 1 piece per order, we are capable to produce thousands items per month. Short production terms and reasonable prices are our advantage.
22 23
Company name: ANSA BORIMA LTD.Address: 120, 9th September Str., Borima village 5276, Troyan Municipality, BulgariaPhone: + 359 670 62 995Fax: +359 670 62 995E-mail: [email protected] Web: www.ansaborima.com Manager: Malina PetkovaRepresentative: Martin GanevPosition: PartnerPhone: +359 894 388 177
Company Activity:ANSA BORIMA - Specialist in thermosets, plastic injection moulding, metal bending and shearing, assembling, moulds production and maintenancePRODUCTS AND SERVICES:• Integratedfiberopticpassivetelecomsolution• Integratedpassivecoppercommunicationsolution• Junctionboxforphotovoltaicmodule• Thermosetsinjectionandcompressionmoulding• Thermoplasticsinjectionmoulding• Metalcomponentsbendingandshearing• Assembling• Mouldsdesign,productionandmaintenance
COPPER CONNECTIVITy PRODUCTS• Quickconnectiontechniquesandaccessories• Mainandintermediatedistributionframes• Crossconnectioncabinets• Distributionendboxes• Jointclosuresfortelephonenetworks• Heat-shrinkableclosuresforcoppercables• Plastictelecommunicationcablechute
FIBER CONNECTIVITy PRODUCTS• Fiberopticclosures• GPONBoxes• Terminalfiberopticboxes• ODFsofvarioussizesandmodifications• Telecommunicationcabinetsfrom6Uto42U
Company name: AFETECH LTD. Address: 252, Mladost 2, Sofia 1729, BulgariaPhone: + 359 2 975 3991Fax: + 359 2 490 1619E-mail: [email protected]: www.afetech.euManager: Alexander SofronievRepresentative: Marina SofronievaPosition: Project ManagerPhone: +359 898 475756
Company Activity:The main activity of our company is research in the field of fire suppression technologies and systems. The company will present at the exhibition innovative models of condensed aerosol generators. The generators are designed for use in fixed fire extinguishing systems and for fire protection of all kinds of vehicles. Our aerosol generators are highly efficient, resistant to heavy workloads typical for vehi-cles and vessels, environmentally friendly and have a long service life.
24 25
Company name: ASTROIDA LTD.Address: 46, Ivan Komitata str., Panagyurishte 4500, BulgariaPhone: + 359 357 66079Fax: + 359 357 63067E-mail: [email protected]; [email protected]: www.astroida-bg.comManager: Kosta TersievRepresentative: Kosta TersievPosition: ManagerPhone: +359 35766079
Company Activity:hydraulic parts and mechanical parts for optic
Company name: ARTEH LTD.Address: 11, Svetlina str., Sliven 8800, BulgariaPhone: + 359 44 687533Fax: + 359 44 687533E-mail: [email protected]: arteh-bg.comManager: Radostin OgnyanovRepresentative: Avram Avramov Position: Sales ManagerPhone: +359 44687533
Company Activity:ARTEH produces Synchronous Servo Motors and Servo Drives up to 100Nm, DC Servo Drives up to 100Nm, DC Spindle Drives up to 300kW, Machine Presses for cutting of motor laminations, Plasma and Oxy fuel metal cutting machines.ARTEH also makes retrofit of metal cutting machines like horizontal and vertical lathes, milling ma-chines, machining centers.
26 27
Company name: BLIk 99 LTD. Address: Pokrovnishko shose str. , Sheitanica area, Blagoevgrad 2700, BulgariaPhone: + 359 73 881627Fax: + 359 73 593349E-mail: [email protected]: www.blik99-bg.comManager: Borislav KadrekovRepresentative: Borislav KadrekovPosition: owner Phone: +359 73 881627
Company Activity:Blik 99 LTD. produces a wide variety of items, units and spare parts of metal and polyurethane elasto-mers for almost all branches of modern industry, such as:
• Polyurethaneshaftsandrollersforprintingandvarnishingonpaper,foil,sheetironandcarton.• Plastic shafts, printing rollers, turbines and blades for vacuumpumps and air-vibrators from
polyurethane.• Polyurethanedrive shafts and rollers for paper, polypropylene, carton, cardboard, textile and
filament.• Polyurethane leading, guiding and bearing rollers for Woodworking Machines, In-plant
Transport, Lift rollers, Packing and Conveyor Machines.• Polyurethanewashingandseparatingscreens,polyurethanepartsforhydroandturbocyclones,
rotors and stators for slime pumps, polyurethane scraper blades. • Polyurethaneflexiblecouplingsfortransmittingrotation,vibratingconveyorbumpers,rubber-
metal sleeves.
Company name: BALkANCAR ZPDEA “G. kOSTOV” JSCAddress: 15, Ilientsi blvd., Sofia 1220, BulgariaPhone: + 359 2 9360303Fax: + 359 2 9360303E-mail: [email protected]: www.kostov-motors.comManager: Plamen NakevRepresentative: Plamen NakevPosition: CEOPhone: +359 2 9360303
Company Activity:Balkancar "G. Kostov" JSC is specialized in the production of electric motors with applications in the electric vehicle and materials handling (traction), hydraulic and pleasure marine industries.The company has over 50 years of experience and currently exports more than 90% of its production to Germany, France, Denmark, Norway, Italy, Sweden, the Netherlands, South Africa, Australia and the US.The motors have traditionally been designed for use in electric fork lift trucks, electric and utility ve-hicles, golf cars, special driving units with marine application (bow thrusters), pump/hydraulic power pack motors and other machinery.In hydraulics the focus is on bigger motors (2kW and up) made to specific customer requirements.Other products include IEC frame 56 to 100 ACIM motors and hobby grinders.
28 29
Company name: BUSSAN LTD.Address: 20, Vratza str., Pernik 2300, BulgariaPhone: + 359 76 589030Fax: + 359 76 583042E-mail: [email protected]: www.bussan-bg.comManager: Efrem GrigorovRepresentative: Efrem GrigorovPosition: ManagerPhone: +359 887 524389
Company Activity:BUSSAN Ltd.- Bulgaria is specialized in design and manufacturing of power electronics devices, for ex-ample:• Inverterweldingpowersourcesformanualmetal
arc and gas shielded welding• Inverters and phase controlled rectifiers for
charging traction and stationary batteries• Thyristorandtransistorvoltagestabilizers• Thyristor and transistor converters for controlof
DC motors• Inverters and phase controlled rectifiers for
gal¬vanic electrolysis and electroplating• Inverters and phase controlled rectifiers for ca-
thodic protection• Galvanic isolated AC/DC and DC/DC switching
power supplies with feature of parallel and series connection
• Electricalcabinetsandcontrolpanels• Excitingsystemsforsynchronousgeneratorsand
motors• Resistancestartersforasynchronousmotors• Neutral Ground resistors for electric generators
and transformers• Powersuppliestomeetcustomerneeds
Company name: BULTRAF LTD.Address: 56A, Tsar Osvoboditel str., Gorna Oryahovitsa 5100, BulgariaPhone: + 359 618 64950Fax: + 359 618 64951E-mail: [email protected]: www.bultraf.comManager: Dimitar PetkovRepresentative: Dimitar PetkovPosition: General ManagerPhone: +359 879 000807
Company Activity:The company specializes in the manufacture and supply of chokes and small to middle-sized trans-formers. The transformers production conforms to the international tendencies and meets the re-quirements of European standards as well as the Customers’ technical specification: number of turns, creapage distances, isolation and method of winding. Due to the experience in the field of the manag-ing team, the investment in modern appliance and the excellent quality of the production, in a few years the company is now well-established on the Bulgarian market as major and preferred trans-former manufacturer. • Pulsetransformersover2,000,000pcs• TransformersforPrintedBoardsover200,000pcs• TransformersforElectricPanelsover100,000pcs• Single-PhaseTransformersover10,000pcs• Three-PhaseTransformersover5,000pcs
30 31
Company name: DIMITAR CAROVSky COMPANyAddress: 24, Priaspa Str., Troyan 5600, BulgariaPhone: +359 889 90 61 09E-mail: [email protected]: Dimitar TsarovskiRepresentative: Dimitar TsarovskiPosition: ManagerPhone: 359 889 90 61 09
Company Activity:We produce machine parts by technical plans from the clients.We produce spare parts for metal cutting machines, wood cutting machines and agricultural machinery, those are: gear wheel, shafts, lead screws and nuts, worms, screws and bolts and many other parts.
Company name: DAMVENT LTD.Address: Todor Grudov bld., Burgas 8009, BulgariaPhone: + 359 56878400Fax: + 359 56878444E-mail: [email protected]: www.damvent.comManager: Velcho Damyanov Representative: Deyan DamyanovPosition: Manager ProductionPhone: +359 56 878 400
Company Activity:Manufacturing, start-up, sales and aftersales service of air-conditioning, refrigeration and ventilation equipment.
32 33
Company name: EL INDUSTRy LTD.Address: 5, Lyulin str., Gorna Oryahovitsa 5100, BulgariaPhone: + 359 618 60878E-mail: [email protected] Web: www.el-industry.com Manager: Mihail ChenkovRepresentative: Mihail ChenkovPosition: General ManagerPhone: + 359 618 60878
Company Activity:The Company is involved in the sphere of electronics and energy efficiency.We are proud to present our innovative Product – a Smart Inverter – an inverter controller to control to regulate energy-efficiently circulator pumps up to 100W.
Company name: EkITA LTD.Address: 10, Dunav str., Petrich 2850, BulgariaPhone: + 359 745 67128Fax: + 359 745 60190E-mail: [email protected]: ekita.bgManager: Kiril GeorgievRepresentative: Kiril GeorgievPosition: Executive DirectorPhone: +359 745 67128
Company Activity:EKITA Ltd. is a company, specialized in designing, production and trade of DC motors according to EN 60034 and EN 1175-1 standards.EKITA Ltd. offers a wide range of DC motors with rated power from 0,5 kW up to 20 kW for use on:mobile hydraulic packs and installations driving units for electric cars, golf-cars and electromobiles mechanical drives for various executive devices subsidiary drives for vessels winches and similar de-vices servodrives.The standard production range includes DC motors with the following technical characteristics:• Overalldimensions:Ф112,ф125,ф150,ф178andф200mm• Ratedvoltage:12V,24V,36V,48V,80V,110V• Operationmode:S1,S2,S3The company disposes of highly skilled and ambitious development-team and large production possi-bilities, which guaran-tees the high quality of the products and the meeting of the varied customer's require-ments.
34 35
Company name: EUROMET LTD.Address: 67, Blagoy Gebrev str., office 4, Pernik 2304, BulgariaPhone: + 359 76670097Fax: + 359 76670097E-mail: [email protected]: www.eurometbg.comManager: Vasil PetrovRepresentative: Tsvetanka NedkovaPosition: Sales ManagerPhone: +359 885937579
Company Activity:Euromet LTD. is Bulgarian company, dealing mainly with manufacturing and trading of weldments, component for metal constructions, parts and assembly units for elevators and conveyors, steel spare parts for metallurgy, power generation, mining industry, machine building and cement industry. We manufacture according to customers' specification and guarantee good quality and reliable delivery times. The company is certified under ISO 3834-2 and EN1090-2 exc.2 Some of our best and well rec-ognized products are welding constructions up to 12 tones, buckets, casings, shaft assembly units and segmental traction wheels for elevators and conveyors, disc shafts for steel mills, welded rollers and drums, etc. Our production facility is 1700 sq.m. covered area and 4000 sq.m. open area and has very convenient transport connection by road and rail. It is located 50 km from Sofia, the capital city of Bulgaria, 250 km from Thessa-loniki port, 195 km from Danube river ports.
Company name: EME ADAddress: : 4, Dimitar Makedonski str., Smolyan 4702, BulgariaPhone: + 359 301 64044Fax: + 359 301 64125E-mail: [email protected]: www.eme-ad.comManager: Petar MilevRepresentative: Dimitar GrigorovPosition: Sales directorPhone: +49 78 3464827
Company Activity:In EME AD - Smolyan using CAD - CAM system for 3D design we construct and make very complex tool equipment with high quality such as:• multistageandcompoundeddies• mould,includingwithwarm-chanelsystemWe have at our disposal all machines we need to produce tools - Wire - Cut machines and Wire - Ero-sion machines, CNC - machines and also here work great experts in this field with a lot of expirience. We use normal packets and elements of companies like HASCO.ЕМЕ AD is producing connectors M8 and M12, electric fitting elements, electro mechanical parts. Con-tacts, switches, connection blocks, plugs, buttons tc.EME AD is producing plastic parts up to 300gr., turned parts up to 25mm diameter. , stamping parts. EME AD has own galvanic for selective plating and galvanic baths. We offer also assembly.We have the possibility to build almost every-thing inhouse.
36 37
Company name: GEORGI SIMEONOV- ELECTRICAL ENGINERING AND AUTOMATION ETAddress:j.k.Dianabad,bl.23,Entr.A,4.floor,Аpp.10,Sofia1172,BulgariaPhone: + 359 2 962 52 29, + 359 888 963 924Fax: + 359 2 962 52 29E-mail: [email protected]: www.gsea.bizManager: eng. Stanka KrumovaRepresentative: Galya LinevaPosition: Marketing specialistPhone: +359 889 359 890 , +359 888 963 924
Company Activity:Engineering, PLC / SPS programming, design and production of industrial machines and control cabi-nets, import and export of industrial machines, conveyors and robotics, import and export of indus-trial spare parts and components, consulting services, system integration, service of industrial ma-chinery, service of industrial electronics, SCADA systems, mechanics, pneumatics, hydraulic systems, power supplies, trading with LV/MV/HV equipment, airport equipment, servo drives, variable speed drives for AC and DC motors, delivery and installation of oil and cast resin power transformers MV from 50 KVA up to 5 MVA, delivery and mounting of UPS, BMS, tools, connectors, production of electronic SMT, retrofit of old machines, modernization, production of LV control cabinets, logistic solutions, rep-resentation of leading industrial companies in Bulgaria – B&R Automation Austria, WEG GmbH Ger-many, KUKA AG Germany, transnorm GmbH Germany, microSYST GmbH Germany, RICKMEIER GmbH Germany, MFTrasfomatory Italy, MEGABARRE Italy, Gefran Italy, MORETTO Italy, Baumer Switzerland.
Company name: FINCOM-2 LTD.Address: 1, Shipka str., Yagodovo 4113, reg. Plovdiv, BulgariaPhone: + 359 3104 2006Fax: + 359 3104 2006E-mail: [email protected]: www.fincom2.comManager: Rumyana VasilevaRepresentative: Rumyana VasilevaPosition: ManagerPhone: +359 878636022
Company Activity:Producer of LED Lighting: Fincom-2 develops, design and manufacture products with latest genera-tion LEDs. LED lighting has proven its qualities as most economy, long lasting, shock –proof etc.Besides interior and exterior lighting the company produces products for other purposes:• LEDmodulesforintegrationinindustries,retrofitmodules,Roadsignalization• DevelopmentwithPVsupply,microcontroller,Solarlighting.
38 3938 3939
Company name: HyDROSySTEM LTD.Address: 15, Yambolen str., Yambol 8600, BulgariaPhone: +359 46 66 16 52 Fax: + 359 46 66 16 53E-mail: [email protected]: www.hydrosystem.netManager: Georgi KomitovRepresentative: Georgi KomitovPosition: ManagerPhone: +359 888959530
Company Activity:Production of hydraulic and pneumatic cylinders.
H Y D R A U L I C D E V I S E S
Æ
Company name: HIDROPNEVMOTEHNIkA ADAddress: 3, Vojeli str., Kazanlak 6100, BulgariaPhone: + 359 431 62228Fax: + 359 431 62019E-mail: [email protected]: www.hpt-bg.comManager: Dipl. Eng. Stoyo IvanovRepresentative: Stanislav KovachevPosition: Sales ManagerPhone: +359 431 68434
Company Activity:HIDROPNEVMOTEHNIKA AD is a private joint stock company, established in 1963 in one of the ma-chine building centers of Bulgaria.The main activities of the company include development, production and sales of hydraulic compo-nents and system – relief valves, over-center valves, safety valves, check valves, valves for marine environment, solenoiddirectional control valves,2-wayand3-wayflowcontrol regulators,blocksfor hydraulic motors of M+S HYDRAULIC and DANFOSS, power packs and hydraulic systems. Well accepted by the customers are the development and production of hydraulic items based on their requirements and samples.Almost 90% of the finished items are sold abroad. For the domestic customers the company offers also
repairment and testing of hydraulic items and systems.The customers of HIDROPNEVMOTEHNIKA AD are from Greece, Turkey, Italy, Spain, Portugal, United Kingdom. France, Germany, Sweden, Norway, Poland, Russia, Ukraine, Brazil, Argentina, Uruguay and other coun-tries.
40 4141
Company name: kIRkOVO LTD.Address: Kirkovo 6884, Bulgaria6884Phone: + 359 3679 2233Fax: + 359 3679 2783E-mail: [email protected]: www.kirkovo-ltd.comManager: Nikolay TopalovRepresentative: Anita ArabadjievaPosition: sales departmentPhone: +359 3679 2018
Company Activity:At present "KIRKOVO"Ltd. is specialized in the production of:• hydrauliccylinders:standart,specialandtelescopictoØ160mm,L=3000mm;• mainbrakecylindersandamplifiers,drivingcylinderforinchvalve(DCIV);• hydraulichandpump;• vacuumpump;• oil filters for high
pressure from 63 to 320 Bar;
• Pneumaticsupportpostures for the mining industry;
• jackhummer.
Company name: ITS-IVONA LTD.Address: 26, Kolyo Ganchev str., Stara Zagora 6000, BulgariaPhone: + 359 888 261 883Fax: + 359 42 604 739E-mail: [email protected]: www.itsivona.comManager: Genko KalyashevRepresentative: Ivona KalyashevaPosition: Assistant managerPhone: +359 889 907 433
Company Activity:ITS- Ivona LTD. is a small company located in Stara Zagora, Bulgaria. It’s main activity is mechanical processing of ferrous metals and manufacturing mechanical parts and elements including mechanical construc-tions and units for machines. In its produc-tion process ITS-Ivona has implemented the following production technologies:• Precisecuttingofalltypesofsheetferrousmetals-includinggascut-
ting, laser cutting, guillotine cutting and plasma cutting- with maxi-mum optimization of the material and high quality of the cut.
• Sheetbendingwithexceptionallyhighprecisionandquality.• AlltypesofmechanicalprocessingwithuniversalmachinesandCNC
machines. • Weldingforalltypesofferrousandmetalsbyusingonlyqualityconsumablesandequipment.• Galvanicfinishesforprotectionofreadyproduction.• Preciseanddetailedassembling.Since 2002 when the company was founded it has been constantly developing by еxpanding its manufacturing and improving the equipment it needs. The end products of the company respond entirely to the costumers’ needs and requirements. ITS- Ivona follows clear marketing strategy which isfocusedonstableandcompetitiveprioritybasedonhighqualityproductsandservice,flexibilityand adequacy when responding to the outside market environment. This particular strategy allows ITS- Ivona LTD. to maintain and insist on upholding the following fundamental principles: • Providingofqualitativeproductsandservice• Maintenanceofoptimalprices• Completemeetingofthecostumers’needsandrequirements
42 43
Company name: METAkOM SCW INVEST JSCAddress: Grivishko shousse str., Pleven 5800, BulgariaPhone: + 359 64 802156Fax: + 359 65 833023E-mail: [email protected]: www.metakom-scw.com Manager: Dipl.Eng. Petar NaydenovRepresentative: Dipl.Eng. Milena GerakovaPosition: Commercial department ChiefPhone: +359 888 565153
Company Activity:METAKOM SCW INVEST JCS has long-term experience in production of castings from steel and cast iron. The Steel Casting Work in Pleven was created in 1965. Castings are produced by use of stationary sand moulding process. The major of the production is for external market mainly for customers from Finland, Germany, Aus-tria, England and France.
Capacity:Number of personnel: 195Total area of company: 105 000 sq.m.Certificate: ISO 9001:2008, BS OHSAS 18001:2007The company is able to cast parts from 5.00 kg up to 8000 kg. single weight
Company name: kRES-D LTD.Address: 74 quarter Letishteto, Kazanlak 6100, BulgariaPhone: + 359 43162041Fax: + 359 43162041E-mail: [email protected]: www.kres-d.comManager: Dipl.eng. Dimitar KrachevRepresentative: Georgi KilovPosition: Sales ManagerPhone: +359 879962041
Company Activity:Kres-D Ltd. is a Bulgarian company experienced in designing industrial hydraulics, non-standard ma-chines and equipment, and repair activity. The manufacturing range of the company is very broad and includes the following activities: manufacture of presses for hydraulic hoses, stands for testing of hydraulic hoses, machines for cutting, tools for peeling and equipment; manufacture of hydraulic stations and equipment (blocks, hoses etc.); manufacture of hydraulic cylinders; repair of hydraulic cylinders and hydraulics for ships; construction and setting of non-standard equipment, according specific requirements of the client.
44 45
Company name: NAkMASH-97 LTD.Address: Industrial Zone Mikroelektronika, P.Box 107, Botevgrad 2140, BulgariaPhone: + 359 723 66 129Fax: + 359 723 66 752E-mail: [email protected]: www.nakmash97.bgManager: Alexander AtanasovRepresentative: Ivaylo DanovPosition: Senior Project ManagerPhone: +359 723 66 129
Company Activity:NAKMASH -97 is a Bulgarian company recognized in the world market for 15 years.It offers processing of metals and metal constructions.Manufacturer of details made of rolled and welded steel, the company is located 60 km to the north-east of the capital Sofia. It mainly specializes in manufacturing large welded constructions for the automobile industry, sepa-rate parts or limited series of de-tails with high complexity.Nakmash has a production area of 1500sq.m. It is supplied with 15 new CNC machines equipped with CAD and CAM systems.
Company name: METAL TECHNOLOGy GROUP ADAddress: 18, Bulgaria Blvd., Bokar, Sofia 1404, BulgariaPhone: + 359 2 818 5959Fax: + 359 2 818 5949E-mail: [email protected]: www.mtgbg.com Manager: Rossana Dacheva – Executive DirectorRepresentative: Maria Georgieva Position: Business Development Manager Phone: + 359 2 818 5921
Company Activity:Metal Technology Group incorporates Bulgarian companies in the metal processing industry special-ized in: • Machinecastingofaluminiumpartsunderlowpressureandcounterpressurecastingmethodsof
all AlSi based alloys in accordance with EN 1706; single weight of the parts from 1 to 150 kg.• MachinesandcastingofgreyandductilecastironandADI;singleweightofthepartsfrom1to
50 kg.• Shellcasting,sandcastingandhandmouldingofsteelandcastiron;singlewightoftheparts
from 1 to 500 kg.• Centrifugalcastingofsteelandcast ironinmetalmouldswithhorizontalandverticalturning
axisThe foundries of MTG – AUCOM in Pleven, OSSAM in Lovech and CENTROMET in Vratsa are all export oriented and more than 80% of their production is exported mainly to the Euro-pean markets and also Algeria, Brazil, Turkey, Russia, Canada, Australia. The production of the companies is focused on the following industrial markets: energy, water supply and sew-age, metal processing machinery, shipbuilding, ceramic and food industry, industrial vehicles, chemical industry, railway. All the companies are ISO 9001: 2008 and ISO 14001:2004
certified. Additional certificates, specific for each company and its production are also available – ISO/TS 16949:2004 (Alucom), BS OHSAS 18001:2007 (Cen-tromet). The head office of MTG is located in Sofia and is in charge of the business development and market-ing strategy of the companies, working closely with the commercial team of each foundry.
46 47
Company name: NIkO M 66 LTD.Address: 182, Marica bul., Plovdiv 4006, BulgariaAddress for correspondence: 45 B, Parchevich str., app.5, Karlovo 4300, BulgariaPhone: + 359 33593232Fax: + 359 33594366E-mail: [email protected]: www. nikom66.comManager: Dimitar MirchevRepresentative: Dimitar MirchevPosition: ManagerPhone: +359 88 7 561 527
Company Activity:NikoM-66 Ltd. is a company that split off from the parent company in 2004 with the following objec-tives to:• exploreanddesign;• conveyorcomponents;• create and commission innovative
solutions for:• beltconveyorrollers,• backpulley,• drivingpulley,• tensionpulley,• alignmentrollersupports,• self-aligningidlers,• conveyorbeltscrapers,• newlabyrinthsealsforbearingas-
semblies.All these are remarkable for their com-petitiveness, non-traditional solutions, and easy maintainability.
Company name: NEARSOFTAddress: 5A, Triadiza, Sofia 1000, BulgariaPhone: +359 889 66 24 46Fax: +359 2 980 43 72E-mail: [email protected]: www.nearsoft.euManager: Vladimir FilipovRepresentative: Vladimir FilipovPosition: Managing DirectorPhone:+359 889 66 24 46
Company Activity:The MOM4 supports intra-manufacturing operations management information. MOM4 is an inte-grated Manufacturing Operation Management solution that integrates finite factory scheduling and Advance Planning and Scheduling (APS) (MOM4Scheduling), manufacturing execution systems (MES) and real-time performance management (MOM4Production), quality (MOM4Quality), mainte-nance(MOM4Maintenance)andinventory(MOM4Inventory)soallusers-fromshopflooroperatorsto executive management - can make real-time actionable decisions throughout the plant and across the enterprise. With the help of those configurable products, NearSoft is able to offer solutions in the following management areas:• Production(APS,MES,MOM,etc),• Maintenance(EAM,CMMS,etc),• Quality(LIMS,QMS,etc)and• Inventory(StorageManagement,WMS,etc.)
The products are build according to ISA95 (ISO 62264) standards and support standard inter-faces to ERP (B2MML) and PLC/SCADA (OPC).
48 49
Company name: ROSOF LTD.Address: 86, Nikola Petkov bul., room 211, Sofia 1618, BulgariaPhone: + 359 2 955 61 59Fax: + 359 2 955 61 59E-mail: [email protected]: www.rosof.netManager: Dr. Nedyalko TenevRepresentative:Dipl.Eng. Nikolai TenevPosition: Executive directorPhone: +359 2 955 61 59
Company Activity:Silicone post and tension insulators 10-170kV.
Company name: PROMEL SEVLIEVO LTD.Address: 30, Nikola Petkov str, Sevlievo 5400, BulgariaPhone: + 359 675 89 031, +359 675 89 032E-mail: [email protected]: www.promel-bg.comManager: Todorka DimitrovaRepresentative: Todorka DimitrovaPosition: General managerPhone: +359 887 256 467
Company Activity:Promel Sevlievo ltd has a longtime experience of the production of assemblies, units and components from ferrous and non-ferrous metals for energetics and engineering. The company specializes in the manufacture of parts and assemblies for electrical equipment - switches, circuit breakers for high and medium voltage and others. We also produce assemblies and parts based on drawings and specifica-tionsofthecustomer,cuttingsheetmetalandflamecutting,aswellasmilling,drilling,pressingandgear-milling operations. We can also offer additional processing of the details such as oxidation, hot-dip and electrochemical galvanizing, anodizing, tinning, tempering, silver plating, coating, painting and more.
50 51
Company name: SPARTAk JSCAddress: 3, Odrin str., Bourgas 8000, BulgariaPhone: + 359 56 880 080 Fax: + 359 56 831 533E-mail: [email protected]: www.spartak.bgManager: Kiril YakovRepresentative: Stefan KalchevPosition: Marketing specialistPhone: +359 56 878 744
Company Activity:Spartak JSC is the biggest producer of industrial fans in Bulgaria. The fans are own product, purposed to meet the requirements of our clients. We offer centrifugal, ducted, roof, axial and fans for the ceramic industry. Along side with the industrial fans, Spartak produces burning equipment such as diesel burners, fuel oil burners, gas burners, burners with composite construction, dual fuel burners and diesel-fired air heaters. Other products of Spartak are metal racks for special and general use, gun cabinets, metal boxes and excavator buckets. Spartak produces welded constructions and metal solutions according to client’s drawing and require-ments.The processes, executed within Spartak are: welding, CNC turning, CNC bending, CNC grinding,CNC Laser cutting, Milling, Powder coating and Wet coating.
Company name: SINTER-M JSCAddress: 77 Yambolen Str., 8600 Yambol ,BulgariaPhone: + 359 46/66-16-75 Fax: + 359 46/66-16-72E-mail: [email protected]: http://www.geogroup.orgManager: Dimitar MitevRepresentative: Dimitar Mitev Position: Procurator Phone: +359 888471150
Company Activity: Production of powder metallurgy parts and tooling.
52 53
Company name: VANIkO LTD.Address: 44, Georgi Popov str., Blagoevgrad 2700, BulgariaPhone: + 359 73882002Fax: + 359 73833412E-mail: [email protected]: www.vaniko.comManager: Sasho VazharovRepresentative: Sasho VazharovPosition: General ManagerPhone: +359 896693060
Company Activity:Vaniko LTD. is 100% private company which was founded on the 7th July 1992 by three mechanical engineers who have been managing the company till this moment.Vaniko ltd has been developing on the basis of universal equipment, specialists and 100% refinancing of the profit till 1998. After this year was set the goal to reach leading companies in metal working in Europe and in the whole world, to introduce and keep introducing always new technologies and machines.Vaniko LTD. is one of the leading companies in the area of metal working, not only in Bulgaria but also in Europe. At Vaniko LTD. are incorporated and used the newest technologies and machines in design and manufacture of details, tools (pressforms, injection moulds, dies), machine units and whole ma-chines made to order.The technical control in Vaniko LTD. is conducted on every stage of phase of manufacture. It is organ-ized and carried out by highly professional and experienced stuff. For the purpose of control is used a great variety of universal means for measurement of linear and angular quantities implemented on flatandrotarydetails.Systematiccontroliscarriedoutovertheprocessesofdetailsthermaltreat-ment.
For the completing of more special and precise measure-ments the company has measurement laboratory for the measuring of linear and angular quantities. The laboratory is equipped with modern measuring devices from compa-nies, leaders in the field of measurement – Projector, 3-D measuring machine. The company has also at disposal properly gauged references for length. At the laboratory is carried out periodical control over the employability of all company's means of measurement.
Company name: TOPLOMASHINEx BG LTD.Address: 178, Tsar Boris ІІІ blv., Sofia, BulgariaPhone: + 35928572102 Fax: + 35928572102 E-mail: [email protected] Web: www.toplomashinex.com Manager: Borislav GeorgievRepresentative: Borislav GeorgievPosition: Owner Phone: +359888710966
Company Activity:“Toplomashinex” company, incorporated in 1990, is the only bulgarian producer that makes designer radiators and aluminium towel radiators.
54 55
Company name: WEGAS ELECTRIC LTD.Address: j.k. Dianabad, bl.23, Entr. A/B/V, Sofia 1172, BulgariaPhone: + 359 888 963 924Fax: + 359 2 862 0246E-mail: [email protected]: www.wegaselectric.gsea.bizManager: eng. Vladimir ShumanskiRepresentative: eng. Vladimir ShumanskiPosition: Owner, ManagerPhone: +359 2 862 0246, + 359 887 713 257
Company Activity:PLC / SPS programming, design and production of industrial machines and control cabinets, electrical drives, frequency inverters, servo drives, servo motors, HMI, SCADA tools, PC software, Database, for-eign trade, diagnostics for industrial machines, power transformers, mechanics, pneumatics, design works, trainings in automation, mechatronics, mechanical assembly, solutions for the automotive industries, safety solutions, extruder technology, production of plastic parts, production of electronic PCBs
Company name: VARIANTI LTD.Address: Industrial Zone, 6, Pruzina str., Stara Zagora 6000, BulgariaPhone: + 359 42 600 381Fax: + 359 42 600 381E-mail: [email protected]: www.varianti-springs.comManager: Deko KolevRepresentative: Deko KolevPosition: ManagerPhone: +359 42 600 381
Company Activity:Company Varianti Ltd. was established in year 1990 by two partners - Mr. Kircho Dimitrov and Mr. Deko Kolev. Our main activity is production of technical springs. We develop five basic directions:• compressionsprings• tensionsprings• torsionsprings• wireforms–springwireinrange0.2÷10.0• air copper coils and chokes – round copper wire 0.4 ÷ 3.5; rectangular copper wire –
up to 12 mm2
The materials that we work with are of carbon, stainless and chrome-silicon steel.We work for:• Automotiveindustry• Electricalindustry• Machine-building and instrument-
building industry• Defensiveindustry• Agriculturalindustry• Lockingsystems• Textileindustry• Food,wineandtobaccoindustries• Pneumaticsandhydraulicsindustry• ElectricandmotortrucksThe company is certificated according to ISO 9001:2008 by Lloyd's Register Quality Assurance Ltd. We have over 1000 customers in Bulgaria. We deliver also to 10 countries in Europe and Asia.
56
Company name: VMV METAL LTD. – THE FOUNDRyAddress: 3B – 4B, Industrialen put str., Ihtiman 2050, BulgariaPhone: + 359 724 810 10Fax: + 359 724 810 60E-mail: [email protected]; [email protected]: www.tchugunoleene.com Manager: Dipl. Eng. Emil Sharankov - CEORepresentative: Evgeni DrakaliyskyPosition: Sales ManagerPhone: +359 789 911 811; + 359 724 810 10
Company Activity:Situated on 440 000 square meters area, of which 130 000 m2 is cov-ered area.Weights of a casting from 8 to 25 000 kg (from 17 to 55 125 Lbs./Pounds). Foundry’s Capacity – 48 000 ton/year. Electro Induction melting furnaces – 8 pieces x 10 ton, each.Two lines for Hand molding – on Furan resin. Seven mixers, made by Omega, England.Two lines for Automatic Moulding – Green Sand – made by Kunkel Wagner, Germany.Preparation of cores – by self-hardening mixtures and crowning processes – Cold-Box, Hot-Box.Own Pattern shop - for wooden and aluminium patterns. No limitation of dimensions. 6 400 m2 .Machining shop for rough and final machine treatment of castings. Covered area -10 300 m2 .Own Laboratory-in house, with many apparatus for chemical and spectral analyses, mechanical prop-erties, tensile strength, Hardness – Brinell & Rockwell, specific elongation- % , etc.
Heat treatment furnaces – 2 pieces. Sizes -2,40x2,60x4,10 m. Temperature scope-up to 8500C.Products range – castings for machine parts, housings and parts for gear reducers, counterweights for cranes &forklifts,lathebeds,flywheelsandV-beltpulleysforcrushers, Ingot moulds, Slag pots etc. for the Metallurgy, man-hole covers and grids, continuous cast Iron bars :– rounds-diameters 30 to 250 mm, - squares, rectangles 50 x 120 mm etc., etc.