· Web viewYou may use the T-chart activity sheet. ... Do you like mountain music or ... The cow got into the briar patch and there were cuts and scratches on her

GUIDED READING ACTIVITIES FOR Mary Ann’s MountainWritten by Mary Ann Rose Hart

(Teacher Pages)

Pages Activity When to Introduce Activityand Reading Skill Addressed

Materials Needed and Notes

1-7 Elementsof

Literatureand

Author Notes

- Teacher can decide when to draw attention to elements as reading takes place and as worksheets that apply are completed.

-Students can head one piece of notebook paper for each element of literature. They can begin recording their responses as discussions take place and as reading takes place. This serves for a good review and as preparation for tests.

-Skill: to understand the elements of different genres of literature and to use that knowledge to improve reading Before, during and after reading the book.

-handout, ”Elements of Literature”, pages 6-7, that should be kept in student folder along with notebook paper for additional responses

8-9 Using the Genre

to Predict and

Prediction Chart

for Entire Book

-Before reading the book and after reading the book

-Have the whole reading group work on this with the teacher recording the sentences on the board.

-Skill: to stimulate interest in a particular piece of writing and to facilitate comprehension of what is to be read.

-Prediction Chart transparency-recording sheet of Prediction Chart to be kept for use at the end of the story

-handout, “Elements of the Genre, Novel” to be used after reading the first page or chapter

10 Prediction Chart

Chapter by Chapter

-Before reading each chapter -Prediction Chart handout per child… I keep these in a holder on a board where students have easy access.

11 Anticipatory

Questions:Connect to

What I Know

-Before reading the book. These are with the set of questions for the entire book.

-book-handout, “Elements of the Genre, Novel or Realistic Fiction”

-handout of all questions to be kept in reading folder and questions for board

-newspaper articles, books, magazine articles, Internet search results on coal mining,

coal mine disasters, farm life, cats, cows, weather wisdoms

-travel brochures about the Breaks Interstate Park

-United States, Virginia maps-brochures or articles on “The

Guided Reading Activities for Mary Ann’s MountainPage 1

Crooked Road – Virginia’s Heritage Music Trail”

-world map and atlas to locate Guam and Okinawa

-a sample of an embroidered piece of fabric, a crocheted piece of fabric, a quilt, a darned sock with the oval wood block used to

-research on USA and world events in 1957 like the Sputnik, the first transistor radio, etc.

-research on entertainment of the era (Elvis Presley, Lucille Ball)

12-15 ReflectionQuestions

-After reading each section of book

-Skill: to allow the learner a chance to integrate what he/she knows with what has been read and to think about new learning in a new and different light.

-questions on board/overhead-student handouts to be kept

in reading folders

16-17 Vocabulary lists for

each section of the book

-Before reading each section-Skill: To aid comprehension, to

introduce regional and cultural differences in language and to understand non-standard English

-student handouts to keep in reading folder

18-29 Cloze Sentences

andAnswers

-Before each section and before each lesson until students are fluently reading the sentences

-Skill: to aid comprehension by using new vocabulary in context and to give the learner confidence in the use of new words.

-Cloze sentence worksheets per child, pages 18-28

-Answers: page 29

30-50 Vocabulary Study

VocabularyLine-Up

andPlaying Cards

-Before every class period until fluency is achieved

-Teacher can divide up the list to fit within the allotted time for this. I use the first five minutes of the class period. The next day, begin with the last word you used today.

-Skill: to provide opportunity for fluency in reading and for knowing at least one meaning of a particular word as it will be used in the text.

-Teacher notes: pages 30-31-Playing Cards: pages 32-50-vocabulary card baggies per child-extra sets of vocabulary

baggies to be kept in the classroom

-The correct order of the cards will follow the order of the vocabulary lists. This gives the teacher the opportunity to divide up the list and each use on separate days to fit the allotted time for this activity.

51-72 CriticalReading

Skills Worksheet

s

-Throughout-worksheets to be used at teacher

discretion

-figurative language, pages 51-53-answers: page 54,55-cause and effect, pages 56-63-answers: page 64


and SchemataWorksheet

s

-fact and opinion, pages 65-67-Venn diagrams, pages 68-69-character web, page 70-sequencing worksheet for plot, page 71-chart on “Mood”, page 72

73-90 Section Testsand

Answers

-After each section of chapters-Skill: create the opportunity for a

learner to assess his/her strengths and weaknesses by having the student to analyze his/her test and to hold the learner accountable. Use a checklist to mark skills needing improvement like: cause/effect relationships, inferential skills, sequencing skills, drawing conclusions, vocabulary development, identifying elements of literature, identifying figurative language, etc.

-Section Test per student for each section of chapters

-Chapters 1-6, pages 73-77-Chapters 7-15, pages 78-82-Chapters 16-27. pages 83-88-Answers, pages 89-90

*Notes from the author/teacher:

Earlier in my career, I failed to see the real connection between student understanding and achievement that extended prediction activities made. When I began to spend a whole class period on prediction activities, I saw students become more eager to read the text and more excited about what they read. Students never let me forget the prediction chart when we read new stories or books. For this book, it might be a good idea to have students to research some of the background for the book. These topics are found in the pre-reading/anticipatory questions.

I learned to allow students more time to connect what they know to what will be read. Brochures, newspaper and magazine articles, books, and Internet searches provide students with information on topics that may be completely foreign to them. It is necessary to help students understand topics which they may know nothing about.

This author/teacher uses a rubric to grade work when not putting an actual grade on each paper. Checks are used to show work that is completed out of a required number of worksheets and activities. Participation in group and class discussions is part of the check system. As I rotate around the room to listen in on group discussions, I record checks when I hear individual students interacting. Those checks become a part of the required number of checks needed for completion of work. This practice affirms to the students that the teacher is listening and is interested in what they had to say. Those checks let the teacher know when and where I needed to intervene.

Students can discuss the questions found on the Elements of Literature hand-out or response questions presented for each section. In literature circles or small


groups, students can read silently or take turns reading. I let that be their choice. They must, however, all participate in discussions. Students who finish earlier than others can preview and begin work on handouts.

Set a timer to keep students on task when needed. I have found that demanding time-on-task in the classroom works better than

making multiple homework assignments. Because many students don’t like homework, they will do their best to complete tasks in the allotted classroom time.

Students need freedom to express their thoughts. Avoid grading response journals, but do hold the student responsible for completing the tasks, and record as an activity completed or not completed. Give students who did not put much thought into their responses time to do a better job as a homework assignment.

I recommend small groups of no more than four for discussions. This provides more accountability from each child. Then, during whole-class discussions, a reporter from each group provides the group’s responses when called upon.

Students in each group are given specific jobs that they rotate for each lesson. These jobs are:

Materials Manager – picks up and returns materials, worksheets, and books needed for each reading session (Baskets or specific areas are

designated for each groups’ materials.) Secretary -records responses from the groups’ assignments for the reporter -collects completed worksheets for teacher inspection Reporter -reports the group’s responses to entire class

Movement around the room and the need to use quiet voices should be taught before using small group work.

Literature Circles or small groups: Literature circles guarantee that every child participates in thinking and responding. Literature circles can be set up to answer the questions after reading each group of chapters. The group selects a different reporter for each session. The group can be given comparison charts and other schemata for recording responses. This author likes for the circles to discuss responses as a whole and then have students to record their own answers in order to increase personal commitment to the assignment. It is very important that the teacher constantly move from one group to the next to monitor the activity. It helps for each student to have a pocket folder for keeping all paperwork until the book is completed and tests are all done.

ELEMENTS OF LITERATURE: Use as you read the story selection.(Student Pages)

Element Things to Think AboutNARRATOR:1. Who is telling the story?2. Did the author give the novel an

interesting “voice”? Would the story have been as interesting told from

Answer questions from the first box._____first person when author uses

the words “I” or “me” when telling the story?


another person’s perspective? Explain. Support your answers.

_____second person when author speaks to “you” directly when relating a story.

_____third person narrator who uses the words “she”, “he”, or “they” when telling the story?

AUTHOR’S PURPOSE:What is the most important reason the author wrote this novel or reading selection?

_____to entertain the reader_____to give the reader factual

information_____to persuade or change the

reader’s opinion about a topic_____to teach a lesson or moral

MOOD OF SELECTION:1. How does the author make you feel

when you read this selection? Is the mood lighthearted, somber, defending an idea of someone, attacking an idea or someone, supporting a cause or someone?

2. What parts make you happy, sad, angry, sympathetic etc. Explain your answer and cite examples to support your thoughts.

-First of all think about the entire book. Think about the questions asked. Then find some sections in the book that support your thoughts. Either quote some parts of the book or paraphrase the parts that support your answer. Use your own thoughts but support them with examples from the novel. You may use the T-chart activity sheet.-handout, “T-Chart on Mood”

FIGURATIVE LANGUAGE:1. Does the author use personification,

similes, metaphors, repetition of words or phrases, idiomatic expressions , dialect, street talk, colloquialisms or speech particular to a region of a country or other manners of speech to interest the reader.

2. Give examples from the novel or reading selection that explain how this language made the story more interesting.

Complete the activity sheets provided by your teacher or prepare your own chart or project.

SETTING:1. Where and when does the story take place?2. How did the author use the setting to

make the story interesting?3. Would the story have been more

interesting if it had taken place in another era (time) or in another part of our country or our world. Explain.

4. Would you like to visit the place where

Answer questions from the first box.


the story takes place? Why, or why not?

MAIN CHARACTER:1. What are the physical features of the

main character?2. What kind of person is the main

character(s)? What are some of the character’s good and/or bad qualities? What makes the character special or different from other main characters?

3. Could you relate to the main character? How? Always explain and support your answers with examples.

4. How did the main character change from the beginning to the end of the story?

Use a character web to help you write a descriptive paragraph about the distinguishing traits of your main character.

PLOT:1. What were the most important events in

the story from beginning to the end?2 Were the events in the story interesting

enough to hold your attention?

Complete a sequence chart after reviewing the chapters of the story or write a paragraph describing the events from beginning to end.

THEME:1. What is the selection about?2. What are some things you learned by

reading this story? 3. What reasons might the author have had

for writing this story selection?

Write a short paragraph telling what the story is about?It may even be helpful to avoid using the name of the main character and to pretend the story could be just about anyone like the main character. It is best to keep your explanation short rather than lengthy with too many details.

GENRE: Use your knowledge of genres to identify this reading selection. Identifying the genre before you read is a good strategy because it helps you to predict what the story might be about based on what you already know about the genre. How does being able to identify the genre help you to predict in general what this story selection will be about?

Use the worksheet in “Before I Read/Connect to What I Know” to determine the genre of this reading selection. You might check two.___mystery ___ nonfiction___autobiography ___ science fiction___biography ___ realistic fiction ___folk tale ___ historical fiction___tall tale ___ novel___fairy tale ___ legend

AUTHOR’S CRAFT:1. Does the author use language in the

conversations that sounds the way the people talk in their part of the world?

2. Does the author’s use of language help or hurt the story?

3. Does the author leave memorable images in your mind? Name some.

Discuss in your reading group or with your teacher.


4. Quote some sections of the story where the author uses special words or figurative language to help you see, hear, touch or taste what is happening.

5. Does the author repeat some of the same happenings, events, or characters’ thoughts in the story? Why do you suppose the author does that?

6. What is your favorite part of the story? Would you read something else by this author? Explain.

7. What did the author have to know in order to write this book?

Elements of the Genre Called a Novel(Student Page)

Element Questions That Help You to UnderstandMain

Characterwho can bea good or

a bad person

1. After reading the first chapter, do you know who the main character will be?

2. From whose viewpoint is the story being told?3. Could the main character have been a real person?4. What are the physical features of the main character?5. What kind of person is the main character(s)? What are some of the

character’s good and/or bad qualities? What makes the character special or different from other main characters?

6. Could you relate to the main character? How? Always explain and support your answers with examples.

7. How did the main character change from the beginning to the end of the story?

Dialogue 1. Is there conversation in the story?2. Does the dialogue help see, feel, hear, touch, or taste what is going

on in the story? Does this add interest to the story? Give examples.

3. Does the dialogue tell you in which part of our country or the world the story takes place?

4. Does the dialogue add to or take away from your enjoyment of the book?

Setting 1. Does the place where the story happens somewhere that could be real?2. Where and when does the story take place?2. How did the author use the setting to make the story interesting?3. Would the story have been more interesting if it had taken place in

another era (time) or in another part of our country or world? Explain.

4. Would you like to visit the place where the story takes place? Why, or why not?

Plot 1. Problem Introduced: In the very first paragraph or first chapter of the story, is there a hint or statement that there will be conflicts or problems that the main character must face? What problems do you predict this character will have to face?

2. Rising Action: What were the most important events in the story from beginning to the end? At what point did you not want to stop reading the book?


3. Climax: Where in the story did you know that the main character’s problem(s) was about to be fixed or resolved?

4. Resolution: How did the problem or problems get resolved? How did the events in the story cause the main character to change?

Theme 1. What is the selection about?2. What are some things you learned by reading this story?3. Was there a lesson to be learned?

3. What reasons might the author have had for writing this story selection?

PREDICTION CHART for Mary Ann’s Mountain

Before reading the book: Use a prediction chart with these key words. Only ten words are used for this activity. Use the words in the order they come to predict what the book will be about. Record and keep for the end of the book.

After reading the book: Bring out the chart again with a recording of the prediction that the students wrote when beginning the book. Reread their prediction and ask the students if they were good predictors. Remember: Making predictions about what one reads is an important reading skill that should be sharpened.

Prediction Chart for Mary Ann’s Mountain

girl mountains grandparents farm brothers Mother cat school bully Christmas


PREDICTION CHART: Before you read each chapter, read the chapter title and the first paragraph. Predict what the chapter will be about. After reading, decide if you are a good predictor of what actually happens. A good reader is a good predictor. Can you guess what questions a teacher might ask?

Chapter or Section:_________________

I predict that…____________________________________________________________________________________________________________________________________________________________________________________________________________

What happened?____________________________________________________________________________________________________________________________________________________________________________________________________________

A question the teacher might ask…______________________________________________________________________________________________________________________


I predict that…____________________________________________________________________________________________________________________________________________________________________________________________________________

What happened? ___________________________________________________________________________________________________________________________________________________________________________________________________________

A question the teacher might ask…______________________________________________________________________________________________________________________


I predict that…____________________________________________________________________________________________________________________________________________________________________________________________________________

What happened? _________________________________________________________________________________________________________________________________________________________________________________________________________

A question the teacher might ask…____________________________________________________________________________________________________________________

BEFORE READING THE BOOK/CONNECT TO WHAT I KNOW(Student Page)

___1. What does the picture on the cover tells you about what you will be reading?Guided Reading Activities for Mary Ann’s MountainPage 9

___2. What clues might the title of the book give you about the story to be told? ___3. Read the first page of the book. Does the genre give you some clues about

what you will be reading?___4. What do you know about farm life and the schools of the 1900’s? The story

takes place in the 1950’s on a farm that was established in 1900. How has farming changed since then? How are schools different? What are some new inventions since 1900 or 19 57? What has happened in space travel and technology?

___5. Who was president of the United States in 1900? 1957? Now?___6. Where are the Cumberland and Clinch Mountain ranges? Of which major

mountain range are they a part? Where are the islands of Guam and Okinawa?a) Look at the map of Virginia to locate these mountains and note the different towns in Southwest Virginia. Find Southwest Virginia on a United States map, a state map or an atlas.

b) Find the islands of Guam and Okinawa on a world map or in an atlas. Why were those islands worth fighting for during World War II?

___7. What do you know about coal mining? Share what you know or do some research and share with your group or with the class. What do you know about cat behaviors? dog behaviors?

___8. Who were some famous musicians in 1957? Do you like mountain music or bluegrass? What instruments are commonly used by these musicians? Have you ever heard of the Grand Ole Opry?

___9. What were the trends in clothing? In children’s games and toys? ___10. Have you ever darned a sock, crocheted an afghan, embroidered

something special or pieced a quilt? Do you know someone who has done these things? What is involved?

___11. Begin the worksheet, “Elements of the Genre, Novel” to predict and to look for what will be happening in the book.

REFLECTION QUESTIONS FOR THE CHAPTER SECTIONS(Student Page)

CHAPTERS 1-2

___1. Who is the telling the story (narrator)?___2. When does the story take place? What was happening in our country at that

time? ___3. Who are the members of Mary Ann’s family?


___4. Describe the grandparents’ home. How is it like yours or different from yours? Where is the home located? (Use a Venn diagram to compare where you live and what your home is like to Mary Ann’s home in Virginia.)

___5. What makes you think that Mary Ann probably likes where she lives?___6. What would you like about the life of a farm girl or boy? What would you dislike?___7. Describe the heritage and culture of the people of Southwest Virginia. What

makes Mary Ann’s life different from yours? (You could do a comparison chart or Venn diagram).

CHAPTERS 3-4

___1. How does being made fun of make you feel? How do you think it made Ling feel?___2. How would you deal with someone who makes fun of others?___3. How does Mary Ann feel about taking care of chickens? Would you like her job?

CHAPTERS 5-6

___1. Do you think that Mary Ann’s brothers are bad boys? Why do you think the way you do?

___2. There are more clues about Mary Ann’s life on the farm that tell you that her grandparents still do some things to “old way”. What are some of those clues?

___3. Do you think Mommy and Poppy have a good reason to tell their grandchildren not to name the farm animals and to not get attached to them?

___4. Why do you think Mommy Laurie is so keen on gadgets? ___5. How do the folks on Mary Ann’s Mountain feel about getting into each other

people’s business?___6. Why do you think Mommy felt it important to tell Mary Ann about bootleggers?___7. Why did Mary Ann not want to make the trip with Poppy to the co-op this time?

CHAPTERS 7-9(Student Pages)

___1. What did Mommy Laurie do that lets you know that she can be playful? What did she do that shows she knows about cat behavior?

___2. Describe Wild Thing. How do you know he is not used to his surroundings yet?___3. Would you tell a friend’s secret? Would there ever be a time to share that

secret?


___4. What was Poppy’s response to Mary Ann when she said she that it didn’t seem fair that her friends, Judy and Dianna, had more than their share of problems. How do you feel about his response?

___5. Why did Mary Ann share Dianna’s secret with Poppy?___6. Is it important for you to know your family’s history? Why would it be important? ___7. Was Mary Ann happy that she made the trip to the co-op with Poppy? How

do you know?___8. What animal behaviors did Lassie and Wild Thing display during the

confrontation with the coyote?___9. Mommy Laurie packed extra food every day in Mary Ann’s lunch box for

Sturgis. What does this tell you about Mary Ann’s grandmother?

CHAPTERS 10-15

___1. What dangers faced Mary Ann as she went to collect the heifers?___2. How important is the role of a farm dog like Lassie? ___3. Do you think that Mary Ann has more responsibilities than the average fifth

or sixth grader?___4. How do you think the families of coal miners feel when sending their loved

ones off to the mines each day? What are some worries that farmers face?

___5. How does Mary Ann feel about Uncle Raffer? ___6. According to Poppy, what is the best part of Christmas? ___7. What were some of the “weather wisdoms” in the reading selection? Can

you research for more examples? How believable are “weather wisdoms”? How do you think these sayings came about?

___8. On her way down the mountain with her brother Dale to find a Christmas tree, how does Mary Ann explain Lassie’s bravery? Do you think that she admires Lassie as much as she does Wild Thing?

___ 9. Do you think that Thurston is a “whiner”? Explain.___10. Why did Mommy Laurie have Thurston and Mary Ann tell a little white lie

about the eggs? Do you agree with Thurston’s explanation to Mary Ann? Do you think a grandmother should tell her grandchildren to tell a little white lie? When is a little white lie harmless? When is it harmful to others or to yourself?

___11. How do you know that Mary Ann was glad that Sturgis’s family was given eggs for Christmas?

___12. What excitement stopped the Christmas pageant?___13. Would you have been happy with a Christmas gift in the form of a note like

the one Mary Ann received from her mother? Tell why or why not.___14. What was Mommy Laurie’s advice to Mary Ann about gaining the affection

of Wild Thing? Do you think it will work?___15. Describe Poppy’s words about the newborn calf? Do you think he had a

soft spot in his heart for farm animals?___16. What are some lessons that Mary Ann learns?___17. Was Wild Thing’s behavior in the chapter “Wild Thing the Adventurous” in

keeping with known cat behavior? How do you know?


CHAPTERS 16-21

___1. How does Mary Ann feel about not being a part of her family’s move from Emory back to the mountain?

___2. Why are some reasons that Mary Ann’s mother would make the quilts and bedspreads for the new house? Is this different from how things are done today?

___3. How did Poppy know what to do to help the heifer and her calf to be born?___4. What surprised Mary Ann about Poppy?___5. How does Mary Ann feel about changing schools? What makes her feel

better about leaving the mountain to go to school in town?___6. Have you ever changed schools? What was hard about it?___7. How did Mary Ann’s family feel about her mother graduating from college? ___8. What are some reasons found in your reading that Mary Ann’s mother and

brothers are moving back to the mountain? What might be other reasons that the family moved back?

___9. Do you think Garrison expressed how most of the students felt about Miss McCoy leaving?

___10. What do you think of Miss McCoy? Would you have liked her for a teacher?___11. How did Mommy Laurie make long hours of tedious work fun? ___12. How did Poppy, Thurston and Mary Ann feel about the fireworks displayed

on the mountain?___13. Why did Mary Ann think that Wild Thing was a hero? Do you think that Wild

Thing was more of a hero than Lassie? Why did Mary Ann not give Lassie the same praise as she gave Wild Thing?

___14. What are some real dangers of growing up on a mountain farm?

CHAPTERS 22-27(Student Page)

___1. How is the memorial service on the mountain different from services that you’ve attended?___2. How did Thurston stand up for Mary Ann when Prissy was critical of her hair

and clothes? Has anyone ever made fun of your clothes or the way you dress?

___3. How did Thurston get Prissy to appreciate life on the mountain?___4. What did Wild Thing do that shows he might want some attention from Mary Ann?___5. Have you ever been told stories by the older folks in your family that did not

really explain what was actually happening in certain situations? Why do you think adults don’t tell all the facts as Mommy Laurie did in explaining to Lizzie how fireflies mate?

___6. How do you know that Poppy would love to have had a formal education past sixth grade?___7. Have you ever been bullied at school? Did you feel the same way Mary Ann

did? ___8. How can you be a friend to someone who has been bullied?


___9. Think back about Ling being made fun of by Danny, Wild Thing being slapped by Bobby, Judy losing her father, Dianna’s mother being hit by her very own father and Mary Ann and her friends being bullied by Stan. Think about how each situation ended. Is there always just one way to resolve a problem? Make a list of ways to get help or to solve problems that you aren’t sure about how to handle?

___10. Do you believe in Poppy’s motto, “forgive and forget”? Do you think that forgiveness is a good way to handle a problem whether it is settled or not? What are some ways to show that you forgive?

___11. What happens between Mary Ann and Wild Thing?___12. How has Mary Ann grown up between her fifth and sixth grade years? In what ways have you grown up between the ages of 10 and 12?___13, Were you able to identify with Mary Ann’s way of life and her problems? ___14. Do other fifth and sixth graders face some of the same problems as

MaryAnn faced? Explain. Think about problems you have faced whether at home or at school.

___15. Do fifth and sixth graders face the same kind of problems whether or not they

were growing up long ago or growing up in present times? Explain.

VOCABULARY LISTS

CHAPTERS 1-2Appalachian MountainsCumberland MountainsClinch MountainsridgetreacherousScotch-Irishinterlopersretaliationmuck outskimdollopslatherdaftGuamtelegramsacrificedloomingramshackle

CHAPTERS 3-4

staplesrutsequitableimmigrantsdiversityscanhorizonconsumptionproductivitysuffocatingfree rangemonumentalagricultureirespring house

CHAPTERS 5-6

dormitorypillow ticktickingchifforobedecorumsufficescomplylaughing stocklye soapdarncrochetembroidercauldrondemiseheifersconfinelurkssorghum molassesgadget

CHAPTERS 7-9

assessmentstock markettraumaticdocilecudfelinedolefulhygienesacudderbalmteatsmannaemblazoneddescendedtrekco-opconfiscatelivestock


trekpokeadjoiningpreservejigethnicfodderunwarycoke ovensgnarlyheritage

waftingassaultpokecontraptionmoonshinebootleggersrevenuerrevelationailspartakeroot cellar

cavalryshenanigansincessantbrayscommotionmenacehunkers

VOCABULARY LISTS

CHAPERS 10-15

galoshesurgencyveterinariandamantibodiesnutrientscolostrumchop sacksmeanderspectaclecarcassaskewwarytroughhayrackdynamitespecialtyclambercorn cribmiffedtrudgewhelping boxmesmerizesmenageriesaunterssentimental

CHAPTERS 16-21

consoleinheritgeneratordistractionumbilical cordspindlypaddockanticipationdistinguishedtenacityaccomplishbalenaughtbushelmortalsagriculturalhybridsdomesticated plantsfiendishginsengpoacher

CHAPTERS 22-27

decreaseddronelulledspiralsbabblediscerntoleratechinkedprattlinglegendvaultsrelentsscrimmagecarpentrymimics


guffawingunfazedrabidcracklingsluge

Chapters 1-2, Vocabulary/Cloze Sentences: Find the word that best fits in each sentence. You may or may not use all the words.

ridgetreacherousScotch-Irishinterlopersretaliationmuck outheritage

dollopslathereddafttelegramssacrificedlooming

trekpokeadjoiningpreservejigcloggingethnic

foddercoke ovensgnarlyskimmedramshackleunwary

1. A ________________ of butter sure tastes good when it is ________________ on a biscuit.

2. The trespassers, or_______________, were not welcome by the natives of Southwest Virginia.

3. Black beans and rice is an ______________ food brought to American by the Hispanics.

4. The home sat on top of the _________________ overlooking the Cumberland and Clinch mountains.

5. It was not a pleasant job to have to _______________ the barn stalls or the chicken house.

6. The Scotch-Irish faced ________________ by the Cherokees who felt they were tricked into selling their lands for trinkets.

7. The long _______________from the coast of North Carolina by the Scotch-Irish was very difficult at times.

8. A telegraph machine is used to send messages called _________________.9. The soldier __________________his life for our country on an island called Guam.10. The woman picked a ____________________full of scrappy apples.11. The men shoveled coal into the________________ where coal is burned to a

certain hardness so that it can be used in steel mills as fuel to melt metals.12. Some folks thought the woman was just _________________ in the head because she chose to live in a _______________house in the middle of nowhere. She had a milk cow whose cream she ______________off the top of the milk in order

to make butter.14. Dark clouds ______________in the sky could cause _______________men trouble.15. The ___________________farm is just one ridge over from our farm. Our pastures

share a fence.


16. On a farm, the women _____________________the fruits and vegetables that are grown for the year to come.


staplesdiversityproductivitymonumental

rutsscanireconsumption

equitablehorizonsuffocatingspring house

immigrantsagriculturefree range

1. The mother bought ______________________, especially flour and cornmeal, from the grocery story.

2. The ______________________brought a ___________________of needed skills to their new country.

3. The chickens are allowed to _____________________ in the yard where they make big messes.

4. The ____________________that the coal trucks make in the road can sure stir up my grandfather’s_________________.

5. As his eyes ____________________the _____________________, he predicts that the looming clouds will bring bad weather.

6. The Cherokees felt that trinkets, pots, and pans were not an__________________ exchange for their land.

7. Often, increasing the ______________________of farm land is a ____________________task. It requires a lot of knowledge of ____________________to know all there is to know about crops and livestock.

8. The _____________________of too much food can make an animal sick.


dormitoryboisterouslaughing stockcrochet

pillow tickdecorumroot cellarembroider

chifforobesufficeslye soapcauldron

bantam roosterscomplydarndemise


heifersgadgetcontraptionrevelation

confinewaftingmoonshineail

lurkassaultbootleggerspartake

sorghum molassesrevenuer

1. When my brothers sleep upstairs in the _______________________, they can become very loud and _______________________. Sometimes, they even fight like little _________________________.

2. There are so many feathers stuffed into the ______________________, it’s a wonder the pillow doesn’t burst.

3. The turnips, carrots, sweet potatoes and Irish potatoes are stored in the ________________________.

4. Mother likes her new can opener. She thinks the new ____________________is real helpful.

5. The ____________________, a strong soap, was made by my grandmother in a big __________________ over an outdoor fire.

6. In the old days there were no closets. A piece of furniture called a ___________________was used instead.

7. We will confine the ____________________to the barn because a coyote may _____________________ in the pasture waiting for a calf to be born.

8. The coyotes travel in a pack in order to coordinate their ___________________to kill their prey.

9. The bootleggers hide in the mountains to make ____________________so the revenuers have a hard time finding the lawbreakers.

10. The wonderful smells ______________________from the kitchen made us very hungry.

11. It was a _____________________to me that fireflies gather together by the thousands in the summertime.

12. The parents demanded that their often boisterous boys ___________________with the parents’ expectations of proper ___________________while eating at the restaurant.

13. Her grandmother had to mend or, _______________________, the socks using a rounded, wooden block inside the sock to make it easier to sew.

14. The family had their last name initial, “S”, ______________________on the napkins.


15. When the musicians get together to practice, they like to ____________________ a quick meal together. This _____________________their need for food and fun.

16. The _______________________of the sick calf made the veterinarian wonder if the same problem would _____________________the other calves.

Chapter 7-9, Vocabulary/Cloze Sentences: Find the word that best fits in each sentence. You may or may not use all the words.assessmentstock markettraumaticdocilecudfelinemenace

dolefulhygienesacudderbalmteatsintimidating

mannaemblazoneddescendedtrekco-opconfiscatedrespite

livestockcavalryshenanigansOkinawaincessantbraying

commotionrabiesaccustomedburlap sackshunkerediodine

1. The veterinarian’s assessment was that neither the mule nor the livestock had the dreaded virus called ______________________.

2. The farmer will take good care of his ____________________because he wants the animals to bring a good price at the _____________________.

3. The incessant firing of the Japanese tanks and rifles was very _______________ to the American soldiers in the Battle of Okinawa; but, the American soldiers __________________ down in the trenches, dared to be brave, and won the battle.

After taking the island, the soldiers badly needed a __________________from that battle.


4. The cats’ _____________________ride to the mountain and to the farm life to which they were not ______________________made the family fearful that the cats would run off.

5. The coyotes were a ____________________to the livestock. The loud _____________________ from the barn and the mule’s __________________

let the farmer know something was wrong.

6. The tame and ___________________feline drank the cow’s milk like it was __________________from heaven.

7. The cow got into the briar patch and there were cuts and scratches on her __________________, but my grandmother rubbed bag __________________on the cow’s ____________________ and teats.

8. A __________________is a group of soldiers who fight riding on horses. This is the way soldiers fought a long time ago.

9. The soldiers ___________________the family’s food to feed their troops. They stuffed ______________________ full of food and carried them off.

10. The pony had a beautiful white marking ______________________on his forehead. The pony is ______________________from a highly-prized line of ponies used by the Native Americans.

11. It was a long, hard ______________________down the Grand Canyon as we were riding on the backs of donkeys that skillfully walked on a treacherous, narrow trail.

12. The trek off the mountain to get cattle feed and some new farm tools from the ___________________made for a long day.

13. The cow chews its food, sends it to one of the stomach’s four compartments, brings the partially softened food back up to its mouth and chews the food or hay some more. This softened food is called ______________________.

14. Doctors tell us to wash our hands often because good ___________________ keeps us from getting so many viruses or bacteria.

15. The ____________________look in her eyes let us know that she was very sad and needed a ___________________from the tragedy of her war-torn country.

16. The family did not tolerate the _______________________of the deceitful salesman.



galoshesurgencyveterinariandamsantibodiesnutrients

colostrummeanderspectaclecarcassaskewwary

troughhayrackdynamitespecialtyclambercorn crib

trudgewhelping boxmesmerizessaunterssentimentalguffawing

rabidcracklingslugeunfazedmiffed

1. The two Olympians hopped on their sled and completed the event called the __________________in record time. They seemed ___________________ by the neck-breaking speed they traveled.

2. Setting the dynamite is my uncle’s ____________________in the coal mines.

3. A ____________________fox got into the hen house and spread rabies to the some of the chickens.

4. The ____________________ told my uncles to get rid of the dead cow’s ___________________ before the virus could spread to the other cattle. His tone of voice spoke to the ___________________of this matter.

5. The first milk that a calf gets from its mother is called __________________which holds the __________________and ___________________a calf needs for a healthy life.

6. One has to be ___________________of the dangers of the corn sheller which sits in the ___________________. The metal teeth can tear up a hand.

7. The litter of baby kittens in the whelping box ___________________ us as we watch the babies wriggle and crawl over each other to get their mother’s milk.

With the kittens and all the other animals on the farm, we have quite a _____________________!


8. The fireflies on the mountain at night create quite a _______________________.

9. A ____________________in the barn holds the grains that a cow eats while a manger holds the hay for the cow. A _____________________ holds hay for a lot of cattle when they eat out in the fields. The cows can stick their heads in between the metal bars of the rack to get a bite of hay.

10. We trudge through the woods, then ____________________to the top of highest rock to watch the river _____________________ peacefully through the mountains. This makes me _____________________ since it reminds me of the river back home.

11. In no particular hurry, the man _____________________to the door of his home. The ______________ protecting his shoes are covered in mud and he removes them before entering his house.

12. The boy did not like the _______________________he heard from the other children when he fell off his bike with his hat sitting ______________________ on his head.

13. ______________________are cows that have given birth before while heifers are first-time mothers.

14. When hogs were killed on the farm, my grandmother cut pork skin into small, thin pieces, salted them, and fried them for snacks. These snacks were called _____________________.


Chapters 16-21, Vocabulary/Cloze Sentences: Find the word that best fits in each sentence. You may or may not use all the words. You may use a word more than once.

consoleinheritgeneratorsdistractionumbilical cordmethane gas

spindlypaddockanticipationdistinguishedpoacher

tenacityaccomplishmentbalenaughtbushels

mortalshybriddomesticatedfiendishginseng

1. There is a big hunt on for the _______________________in Africa who slaughters hundreds of elephants for their tusks.

2. The mountain community tried to _____________________each other when they learned of the deaths of the coal miners in an explosion of methane gas.

3. Hospitals have back-up ______________________ in case the electric power goes out.

4. The dog fought with _______________________as she tried to protect her litter from the _________________coyote.

5. The use of herbs and plants like ______________________to cure diseases or sicknesses has been done for thousands of years.

6. ____________________plants are plants that were found in the wild but now are grown in carefully tended gardens.

7. Sometimes, farmers will grow _____________________ plants like the grapple or the plumcot.

8. The son and daughter will _______________________the farm from their father. Their father wants them to carry on the farming tradition for which the family is known.

9. The dog’s barking created a ______________________while the farmer shot the coyote.

10. When one’s actions are for nothing, the actions are for ____________________.

11. An _______________________acts as an air hose from the mother to the newborn.

12. The hay was neatly picked up by the baler and wrapped by heavy string into a ______________________.

13. In ______________________of rain, the farmer baled his hay as quickly as he could.


14. The field planted in potatoes yielded 50 ________________________of potatoes this year.

15. The newborn calf tried to stand and walk on his long ____________________legs.

16. The farmer ________________________himself by producing more potatoes per acre than had ever been done before. He was awarded the “Best Producer of Potatoes” by the National Association of Potato Growers. This was quite an ________________________for any farmer.

17. The work horses are kept in the ________________________ away from the cattle.

18. Human beings living on this earth are called ______________________.

Chapters 22-27, Vocabulary/Cloze Sentences: Find the word that best fits in each sentence. You may or may not use all the words. You may use a word more than once!

decreaseddronelulledspiralscarpentry

babblediscerntoleratechinkedmimics

prattlinglegendvaultsrelentsscrimmage

1. At first, the incessant ______________________of the airplane engine scared the chickens and lessened, or _____________________, the number of eggs they laid.

2. The soothing __________________________of the mountain stream _________________________us to sleep.

3. The _______________________atop the village’s church steeples could be seen for miles around.


4. Was the veterinarian able to ________________________whether or not the virus had spread to other cows?

5. Sometimes a person who has distinguished himself is called a __________________.

A legend is, also, a story about the feats of a well-known character that are passed down from generation to generation. The story may get changed. Many such stories are told in different cultures all around the world.

6. The spaces between the logs of a log home are filled, or ___________________, with mud.

7. The coaches did not ________________________ poor sportsmanship in the ____________________with the other team.

8. Incessant talk without any particular purpose is called ______________________. My grandmother called such talk “useless talk”.9. At the state track and field competition, the high jumper who _________________ over the highest pole without knocking off the pole is the winner. The high

jumper uses a long pole to lift him or her high into the air.10. The little girl makes her eyelashes flutter as she _____________________the flutter

of a butterfly’s wings.11. The little girl begs her mother for a new doll until her mother ________________.12. The builder has good _______________________skills and can hammer, saw, and

lay brick with the best builders anywhere in the country.

Answers to Vocabulary/Cloze SentencesChapters 1-2 Chapters 3-4 Chapter 5-6 Chapters 7-9 Chapters 10-15 Chapters 16-21 Chapters 22-

27

1. dollop slathered

2. interlopers

3. ethnic

4. ridge

5. muck

6. retaliation

7. trek treacherous

8. telegrams

9. sacrificed

10. poke

11. coke ovens

12. jig

13. daft ramshackle

1. staples

2. immigrants diversity

3. free range

4. ruts ire

5. scan horizon

6. equitable

7. productivity monumental agriculture

8. consumption

1. dormitory bantam roosters

2. pillow tick

3. root cellar

4. contraption

5. cauldron

6. chifforobe

7. heifers lurk

8. assault

9. bootleggers moonshine

10. wafting

11. revelation

12. comply decorum

1. rabies

2. livestock stock market

3. intimidating hunkered respite

4. traumatic accustomed

5. menace commotions braying

6. docile manna

7. sac balm udder

1. luge unfazed

2. specialty

3. rabid

4. veterinarian carcass urgency

5. colostrum nutrients antibodies

6. wary corn crib

7. mesmerizes menagerie

8. spectacle

9. trough hayrack

10. clamber meander

1. poacher

2. console

3. generators

4. tenacity fiendish

5. ginseng

6. Domesticated

7. domesticated

8. inherit

9. distraction

10. naught

11. umbilical cord

12. bale

1. drone decreased

2. babble lulled

3. spirals

4. discern

5. legend

6. chinked

7. tolerate scrimmage

8. prattling

9. vaults

10. mimics

11. relents

12. carpentry


skimmed

14. looming unwary

15. adjoining

16. preserve

13. darn

14. embroidered

15. partake suffices

16. demise ail

8. cavalry

9. confiscated burlap sacks

10. emblazoned descended

11 . trek

12. co-op

13. cud

14. hygiene

15. doleful respite

16. shenanigans

sentimental

11. saunters galoshes

12. guffawing askew

13. Dams

14. cracklings

13. anticipation

14. bushels

15. spindly

16. distinguished accomplishment

17. paddock

18. mortals

VOCABULARY STUDYSkill: Learn new words to enhance comprehension of what is read

Before reading the different sections of the book: Pre-teach vocabulary before reading each group of chapters. The book is divided into sections for this. Begin with vocabulary study every day until the students have a solid grasp of pronunciation and meanings.

Whole Class Activity: I do this activity with the whole class first. Present vocabulary list to students to identify words they already know. Then pass out the cloze worksheet and have partners identify more words by using context clues, definitions within the sentence, appositions, etc. Have students share answers with the class. Each student should complete the worksheet with the correct answers and keep work in reading folder. Teacher should use a copy of the worksheet and record answers on board. Emphasize using context clues as the first skill to use when figuring out an unknown word. Have students to use the dictionary to look up meanings that were missed. Note: The use of context clues is crucial to becoming a good reader.

Whole Class Activity for “Vocabulary Line-Up”: Cut out the cards provided and store in a zip-lock plastic baggie. Be sure to label the baggies as to which book section is represented. Teacher must have a master list of all the words being used and the correct order of the words. *Then the teacher can track the correct order of words and definitions by following the sequence of words on the chapter lists. The game begins and ends with the same student. That student’s definition begins the game and the word at the top of his/her card ends the game. The game can begin with any card. I shuffle the cards each time we play so that the game never starts with the same word. To begin game, the teacher shuffles and gives each student one card. If there aren’t enough students in the group, some students may get a second card. If there are too many students for the number of cards, then pairs can work together. To begin, the teacher calls on a student to read only the definition from his/her card. Student will say, “This word means...” The student who has the correct word says, “I have (says the word)”, and then he/she reads his/her definition. To encourage speed, a timer can be set for five minutes to prevent the dragging out of


the lesson. If students are not reading fluently, I make extra vocabulary sheets available for the student to take home to keep for practice.

Individual Practice for “Vocabulary Line-Up”: The game is the same as above. Each student is given his own set of cards to cut apart and to place in a baggie. To save time, I cut apart the cards and have them ready for each student. I write each student’s name on the baggie. I, also, found that by using a larger rectangle of regular copying paper was more easily handled than small pieces of paper. These hold up to repeated use and are cheaper than index cards. The teacher writes the word on the board and as students enter the room they may begin ordering words and definitions. This encourages students to get to class and to get on task. Teacher sets the timer for 5 minutes when all students are seated. Students spread their cards out on their desk. Then they match words and definitions and line up their cards in order with only the word on top showing. During this time, the teacher is constantly monitoring and pointing out mistakes. When the timer goes off, one student will read his words in order. If there are mistakes the teacher gives the correct word and allows another student to read answers from that point or the teacher may read the words in order. In the beginning, students may not get all words in the correct order, but students will strive to beat the timer. I had students from nine different cultures who did not speak English fluently. I found that students felt empowered with this activity. Reminder to students: The meanings given are for the definition of the word as it is used in the book context. If the allotted time ran out, just check the words to that point. Then, begin with the next word the next class period. That way all words are practiced.

Example of Activity “Vocabulary Line-Up”

Cards laid out on desk

in random order

Line up cards in order

first card

last card


Cumberland and Clinch mountains

slatherword

definition

word

definition for next word

word

definition

daft

slaughter

a part of the southern Appalachian Mountains

word

definition

word

definition

word

definition

Vocabulary Cards for Chapters 1-2

Appalachian Mountains

These are the mountains that are a part of the greater Appalachian Mountains and are found in all or part of the states of West Virginia, Virginia, Kentucky and East Tennessee.

treacherous

This refers to people who are descended from the people of Scotland and Ireland.

Cumberland and Clinch mountains

This is the long and narrow top edge of a mountain.

Scotch-Irish

This word means people who trespass onto other people’s land or property for the reason of taking up residence or living there without an invitation or payment.

ridge

This means full of danger.

interlopers

This word means the shoveling out of manure from a barn.



muck out

This word means to take off the top as in to take the cream off the top of milk.

slather

This is a synonym for insane, crazy or foolish.

skim

This means a lump or blob of a substance.

daft

This is an island in the Southwest Pacific Ocean used in World War II from where fighter planes were sent to bomb the Japanese ships and islands.

dollop

This means to smear on thickly as to spread a lot of jam on toast.

Guam

This is a message sent by telegraph which is a device whereby the sender uses the Morse code and the cutting off and on of electric current to make words.


telegram ramshackle


This is to give up something important for another purpose.

This means a long, difficult journey or trip.

sacrifice

This means to rise or appear above the horizon.

trek

This is a synonym for a brown paper bag. This word was used long ago.

looming

This means poorly made or held together.

poke

This means to connect to or to be next to.


adjoining

This means to keep safe or made to last as in keeping vegetables in a way that keeps them from spoiling so they can be used later.

ethnic

This word means not paying any attention to what is going on around you or not aware of possible danger around the corner.


preserve

This means a lively, happy dance.

unwary

These are huge, outdoor beehive looking ovens that men feed coal which is burned to a certain point then sent to steel meals where the coke burns at its highest temperature to melt metals.

jig

This word is used to describe a person’s home country, religion, race, culture, and language.

coke ovens

Synonyms are knotted and twisted.


gnarly

This is the life a person is born into with its privileges, its culture, its beliefs, its way of making a living, etc.

heritage

This means a well-deserved break Guided Reading Activities for Mary Ann’s MountainPage 31

from a stressful situation for a short period of time.

respite

This is the chain of mountains that run from Canada and Maine to Birmingham, Alabama.


staples

These are tracks in a busy road made by the tires of many vehicles driving over the road.

immigrants

This word means having many differences such as in beliefs, in jobs, in dress, etc.

ruts

This word means fair, equal to, or just.

diversity

This word means to look at closely for details such as looking closely at the sky for weather coming in.


equitable

These are people who come from foreign lands to escape political injustices in their home country, to seek new jobs, or to find a new place to call home.

scan

This is the place where the earth and sky meet.


horizon

This means using up something like eating a lot of food.

suffocating

This means the freedom an animal has to move around in search of food.

consumption

This means producing goods for sale or services that benefit others. This word also means the making of something that is beneficial with a lot of time and effort.

free range

This means of great importance and done with great effort as in the effort to build the great Transcontinental Railway.

productivity

This word means smothering or not having the ability to breathe.

monumental

This is the growing of crops and the raising of farm animals of many kinds usually for the purpose of


selling to others.


agriculture

Synonyms for this word are anger, exasperation, annoyance or displeasure.

ire

This is a building over a spring where water gurgles out of the ground. The building keeps the water clean and keeps foods like milk cool so it doesn’t spoil.

springhouse

This word means the most important foods for the preparation of many kinds of foods.


dormitory chifforobeGuided Reading Activities for Mary Ann’s MountainPage 34

This is the pillow casing that is made of real thick, sturdy material in which feathers are stuffed to make a pillow.

These are small roosters that seem to engage in a lot of fighting.

pillow tick

This is a real thick, sturdy material for making feather beds and feather pillows.

bantam roosters

Synonyms are loud, clamorous, disorderly, rowdy.

ticking

This is a piece of furniture that is used in place of a closet for holding clothing. This was used a long time ago when homes did not haveclosets.

boisterous

This means to follow instructions, to follow an agreement, to follow what is asked.


comply

This word means a person who is being made fun of. It comes from colonial days when men or

darn, crochet, embroider

This means death or the end.


women were locked in a stock in the town square so the villagers could humiliate him.

laughing stock

This is a very strong soap that was made in a cauldron over an outdoor fire a long time ago.

demise

These are cows that are first-time mothers.

lye soap

These are different kinds of sewing that use different thicknesses of thread and different kinds of needles or other tools.

heifers

This means to be shut or closed in.


confine

This means sneaking around and watching for a chance to create mischief or to do harm.

gadget

This means carried along such as being carried on air currents.

lurks waftingGuided Reading Activities for Mary Ann’s MountainPage 36

This is the thick, sticky, sweet substance that comes from a plant that grows like corn.

This means an attack with the intent of harm, or it means an attack that is imagined and expressed verbally.

sorghum molasses.

A synonym is contraption. This is a tool that helps make a particular job easier to do.

assault

This means a brown paper bag in this story, not punching at something.


poke

This is a gadget or object that is built usually by a person with no particular expertise to solve a problem. Synonyms are gadget, thingamajig, doohickey, device, etc.

bootleggers

This is a representative of the government who is allowed to collect taxes that are owed the government and who can shut down or destroy illegal businesses.

contraption

This is liquor made from corn and is illegal to make or sell.

revenuer

This means being struck by a sudden thought or idea.


moonshine

These are the folks who make liquor or moonshine illegally.

revelation

This means makes sick, makes one feel bad.


ails

This means to take part in something such as eating and drinking.

root cellar

This is a long room underneath the roofline of a house and is used for sleeping several people.

partake

This is a room underneath the ground or partly underground where it is cool and is used for storing potatoes and other root vegetables.



assessment

This is the place where livestock is taken to be auctioned off for the best price offered.

docile

This is the partially chewed food that comes back up from one of the cow’s stomachs for the cow to chew a second time.

stock market

This means causing great emotional or physical stress.

cud

This means an animal that belongs to the cat family in general such as the domestic cat, lions, tigers, lynxes, jaguars, etc.

traumatic

This means very tame, easy going, or gentle.

feline

A synonym is sad.



doleful

A synonym is cleanliness.

udder

This is the thick ointment used to heal scratches and sores or to keep skin from chafing.

hygiene

This is the bag that holds a cow’s udder and teats.

balm

These are the parts of a cow’s udder that stick out to make it easy to squeeze milk from them.

sac

This is the part of the cow’s sac where milk is made.

teats

This is a gift of wonderful food.



manna

This means marked with bright, showy, colorful, or majestic colors or designs.

trek

This is a business or building that many different folks share in the running of the business or building. The members provide money or goods to keep the business going.

emblazoned

In the animal kingdom, including human families, this means to have come from the relatives before you.

co-op

This means to take something away from someone in the name of the law or government. Sometimes, this is done outside the law and causes harm to others.

descended

This is a long, hard trip.

confiscate

These are useful farm animals like cows, goats, horses and pigs.


livestock

These are the soldiers who fight from their horses in a war.

incessant

This is what a mule does when it is alarmed or is trying to intimidate an enemy. The mule makes this


harsh, loud sound.

cavalry

Synonyms are deceitful behaviors, foolishness, or trickery.

brays

This is a noisy disturbance.

shenanigans

This means without stopping or going on and on and on.

commotion

This is something that causes harm or can bring danger to someone or to an animal.


menace

This means squatting down or positioning the body to be ready for a fight.

burlap sack

This is a red liquid used to sterilize wounds or sores.

hunkers iodine


This means threatening or bullying.

This means to have gotten used to or to have become a habit.

intimidating

This is a big bag made of a rough textured material.

accustomed

This is a virus that can infect dogs, cats and man. The virus is spread through animal bites.


rabies

This word means a needed break from a stressful situation.

respite

This means looking over the facts of a situation and coming to some conclusion or conclusions about that situation.

Notes on Vocabulary Study: At this point, students have enough cards to work with and have been introduced to a fair number of words that further the understanding of the reading selection. I would have students to continue with the Vocabulary Line-Up the first five to ten minutes of class. Remember: Students will learn to proceed quickly and will gain confidence to be become more accomplished readers. I would then present the Cloze sentences for the next group of chapters and have partners read the sentences to each other. The teacher should walk from group to group to listen to and to make corrections as needed. This makes students more accountable and gives them more time on task than if a whole class activity occurred. Always review as a whole class activity.


Figurative Language used in Mary Ann’s Mountain: Identify the following examples of figurative language. Be ready to tell how you decided the answer. Is it an example of personification, metaphor, simile, repetition of words or phrases for emphasis, idiomatic expression, colloquialism, exaggeration, street language, dialect, or use of invented words?

(Student Pages)

Identify theFigurative Language

Chapters 1 – 6: Quote or word from the text using figurative language

1. shore (sure), molassie biscuit (biscuit with molasses spread on top), learnt (learned), gettin’ (getting), young’uns (young ones), oncet (once), heerd (heard), forgit (forget),Note: Folks from the mountains of Virginia often do not say the ending to words especially the g’s. Often two words run together as well. This is a carry-over from the language the ancestors used in their home countries of Ireland and Scotland and Britain.

2. Folks often come to our house just to catch a breeze on the front porch.

3. We already paid our dues on that score what with him livin’ in those ramshackle bunk houses.

4. Poppy jokes, “My ears are so big they could sail me from here to China!”

5. “If that ain’t the best lesson I ever heerd, I’ll swallow a fly!

6. “We’d be the laughin’ stock, wouldn’t we?”Note: In the colonial days, a person who had a grievance against him was put in a stock which anchored his head and hands so he couldn’t move. This stock was located in the middle of the town square. Passers-by could taunt him and laugh at him. He would not want that experience again!

7. rednecks – people with sunburned necks from laboring in their fields or gardens in the sun day after day


hillbillies – people who come from the mountains or the South and who are mistakenly considered to be ignorant people

8. The piglet squeals in delight.9. When he speaks, Poppy’s soft voice sounds like music.10. Poppy’s ears are fodder for family jokes.

Chapters 7-15: Quote or words from text using a form of figurative language.

11. The tractor travels so slowly that it is about as slow as the heifer.

12. Mommy said, “Now, hurry along! I see snow clouds buildin’. Never know how fast or furious the snow may come.”

13. Poppy says that bad weather is tricky to predict. He says weather is like a bull and that you don’t know when it’s going to get angry and come at you.

14. One time my brothers and cousins rode sleds over the snow on Rocky Bank so much that they turned the snow into an Alaskan glacier.

15. The Earth is so hushed, I hear my heart beat.16. When we have to climb Rocky Bank with one

hand on the ground for balance, Thurston jokes that we put a monkey to shame.

17. It was so cold and Thurston had no gloves. He hadn’t complained a bit, but his hands were red as beets!

18. My brothers eat so much that their stomachs must be bottomless pits.

19.20.

On Christmas Day, Poppy’s (19) words seeped into my heart and (20) made it feel like singing a new song.


21. Poppy leaves the umbilical cord connected because it acts as an air hose.

22. Poppy turns up the bottle and takes one big swig and swallows.

23.24.

Miss McCoy said, “ (23)I declare, every morning, my old (24) Buick groans in protest when we begin the trek up this mountain!”

25. Miss McCoy said to Mary Ann, “I do believe that your cat wants to talk to you!”


26. Before the gurgling stream lulls us to sleep, we load ourselves back into the car and follow the crooked road back to our mountain home.

27. Garrison stood to speak, “Miss McCoy, reckon I have a right to speak, too!”

28. We don’t want the effort to put up the hay to be for naught!

29. The mountain provided more wonder and beauty tonight than I could ever have imagined was possible.

30. I can’t help but wonder what other secrets our mountain holds.


31. Mommy Laurie complained that the airplane sounded like an airborne buzz saw.

32. Thurston informed Prissy, “George Washington slept in more places than there were days of his life!”

33. Cousin Clara said, “Y’all have fun, you hear? I’m going to miss those cow pies sooo much! Yum!”

34. Thurston informs Prissy, “This farmhouse is as old as the hills, almost!”

35. As soon as Miss Tully hears a story, it will spread like wildfire!


Figurative Language used in Mary Ann’s Mountain: Identify the following examples of figurative language. Be ready to tell how you decided the answer. Is it an example of personification, metaphor, simile, repetition of words or phrases for emphasis, idiomatic expression, colloquialism, exaggeration, street language, dialect, or use of invented words?

Identify the Figurative Language Chapters 1 – 6: Quote or word from the text using figurative language

1.dialect shore (sure), molassie biscuit (biscuit with molasses spread on top), learnt (learned), gettin’ (getting), young’uns (young ones), oncet (once), heerd (heard), forgit (forget),Note: Folks from the mountains of Virginia often do not say the ending to words especially the g’s. Often two words run together as well. This is a carry-over from the language they used in their home countries of Ireland and Scotland.

2. colloquialism, idiomatic expression Folks often come to our house just to catch a breeze on the front porch.3. colloquialism We already paid our dues on that score what with him livin’ in those ramshackle

bunk houses.4. metaphor (ears to sailboat) Poppy jokes, “My ears are so big they could sail me from here to China!”5. exaggeration “If that ain’t the best lesson I ever heerd, I’ll swallow a fly!6.colloquialism “We’d be the laughin’ stock, wouldn’t we?” (In the colonial days, a person who had

a grievance against him was put in a stock which anchored his head and hands so he couldn’t move. He was sentenced to so much time in this stock which was located in the middle of the town square. Passers-by could taunt him and laugh at him. He would not want that experience again!)

7. use of invented words rednecks – people with sunburned necks from laboring in their fields or gardens in the sun day after dayhillbillies – people who come from the mountains or the South and who are mistakenly considered to be ignorant people

8. metaphor (piglet to a child who squeals)

The piglet squeals in delight.

9. simile (voice to music) When he speaks, Poppy’s soft voice sounds like music.10. metaphor (ears to fodder) Poppy’s ears are fodder for family jokes.


11. simile (tractor to a heifer) The tractor travels so slowly that it is about as slow as the heifer.12. personification (snow clouds

to a furious person)Mommy said, “Now, hurry along! I see snow clouds buildin’. Never know how fast or furious the snow may come.”

13. simile (weather to a bull) Poppy says that bad weather is tricky to predict. He says weather is like a bull and that you don’t know when it’s going to get angry and come at you.

14.metaphor (snow to an Alaskan glacier)

One time my brothers and cousins rode sleds over the snow on Rocky Bank so much that they turned the snow into an Alaskan glacier.

15.personification (Earth to a person who get hushed)

The Earth is so hushed, I hear my heart beat.

16.metaphor (the children to a monkey)

When we have to climb Rocky Bank with one hand on the ground for balance, Thurston jokes that we put a monkey to shame.

17.simile (hands to red beets) It was so cold and Thurston had no gloves. He hadn’t complained a bit, but his hands were red as beets!

18.metaphor (stomachs to bottomless pits)

My brothers eat so much that their stomachs must be bottomless pits.

19.metaphor (words compared to something that seeps like water)20.personification (heart to a

person who sings)

On Christmas Day, Poppy’s words seeped into my heart and made it feel like singing a new song.(Here are two comparisons)


21. simile (umbilical cord to air hose) Poppy leaves the umbilical cord connected because it acts as an air hose.

22.colloquialism Poppy turns up the bottle and takes one big swig and swallow.

23.colloquialism Miss McCoy said, (23) “I declare, every morning, my old (24)Buick


24.personification (Buick to a person who groans)

groans in protest when we begin the trek up this mountain!”

25.colloquialism Miss McCoy said to Mary Ann, “I do believe that your cat wants to talk to you!”

26.personification (stream to a mother who sings her child to sleep)

Before the gurgling stream lulls us to sleep, we load ourselves back into the car and follow the crooked road back to our mountain home.

27.colloquialism (reckon means to suppose )

Garrison stood to speak, “Miss McCoy, reckon I have a right to speak, too!”

28. colloquialism We don’t want the effort to put up the hay to be for naught!29.personification (mountain to

a person who can provide)The mountain provided more wonder and beauty tonight than I could ever have imagined was possible.

30.personification (mountain to a person)

I can’t help but wonder what other secrets our mountain holds.


31. simile (airplane to a saw that makes a buzzing sound)

Mommy Laurie complained that the airplane sounded like an airborne buzz saw.

32.exaggeration Thurston informed Prissy, “George Washington slept in more places than there were days of his life!”

33.colloquialism (cow pies instead of cow poop)

Cousin Clara said, “Y’all have fun, you hear? I’m going to miss those cow pies sooo much! Yum!”

34.simile (farmhouse to the hills)

Thurston informs Prissy, “This farmhouse is as old as the hills, almost!”

35.simile (story to wildfire) As soon as Miss Tully hears a story, it will spread like wildfire!

WORDS THAT SIGNAL A CAUSE AND EFFECT RELATIONSHIPAdd more to the list as you find them.

because due to from


in order that resulting

from so so that therefore thus

Cause/Effect for Chapters 1-2: Complete 1-5, then write a cause/effect relationship on your own. On the back, write a complete sentence for each below showing the cause and effect relationship. Use a signal word that shows the cause and effect relationship.

Cause – tells why something happens

Effect – tells what happened or what will happen

1. The Cherokee murdered interlopers like John Douglas.

2. Mary Ann pours a bucket of water over Sadie Mae.

3. Mary Ann’s mother needed to finish


college to get a job teaching school.

4. Mary Ann’s mother couldn’t afford a baby-sitter to take care of her after school.

5. One time at an all-county chorus practice, an older girl whom Mary Ann did not know, ran over to her and hugged her.

6.

Cause/Effect for Chapters 3-4: Complete chart for 1-5, then write a cause/effect relationship on your own. On the back, write a complete sentence for each below showing the cause and effect relationship. Use a signal word that shows the cause and effect relationship.



1. Mommy Laurie told Mary Ann that she could not jump rope.

2. Danny called Ling a “slant-eyed Chink.”

3. Miss McCoy told the class that America needed the contributions of new immigrants to our country.

4. Judy’s father was killed in a coal mine Guided Reading Activities for Mary Ann’s MountainPage 50

explosion.

5. When the professors asked Mommy Laurie if there was a better road to use on their return trip to Blacksburg, Mommy Laurie got angry.

6.




1. Kyle and Dale cheated while playing the game, Monopoly.

2. Mary Ann’s brothers got a spanking with a shoe.

3. There was a pillow fight.

4. Two new black and white cats were given to Mary Ann and her family.

5. The yucky sweet smells of sorghum molasses make Mary Ann sick to her stomach.


6.

Cause/Effect for Chapter 7-9: Complete 1-5, then write a cause/effect relationship on your own. On the back, write a complete sentence for each below showing the cause and effect relationship. Use a signal word that shows the cause and effect relationship.

Cause –tells why something happens


1. Mary Ann told Poppy that Dianna’s parents were fighting.

2. Dianna’s dad drank too much.

3. Aunt Ellen never had her horse or her bags of corn and wheat stolen by the soldiers.

4. General Lee’s soldiers’ horses died of hoof and-mouth disease.

5. The Confederate and the Union scouts ignored each other when they came to the Clinch Mountains to collect their rifles repaired by Cassie’s great-grandfather.

6.





1. Newborn calves must have the first milk, or colostrum, from their mothers.

2. Kyle and Dale milked the cows for several days straight just before Christmas Day.

3. Mary Ann and her brother Dale stopped only for a moment as they carried the Christmas tree back up the mountain.

4. The heifers are close to their birthing times and snow clouds are looming over the mountains.

5. Mommy Laurie told Stuart a little white lie about how many eggs she had.

6.





1. Miners are not allowed to smoke in the mines.

2. The calf was being born with its back legs coming out first.

3. Mary Ann was stunned by her mother’s announcement that she would be going to school in town next year.

4. Bobby slapped at Wild Thing as he sat on Mary Ann’s shoulder.

5. Mary Ann’s mother and brothers move back to the mountain instead of remaining at Emory.

6.




1. The noise from Mark’s airplane was very loud as he flew over the chickens on the Stanley farm.


2. Visitors and preachers from all around came to the family cemetery on the mountain every year on the fourth Sunday of August.

3. Prissy acted like a know-it-all and made fun of Mary Ann’s dress and pigtails.

4. Wild Thing began perching on the outside of Mary Ann’s window at night.

5. Stan became ashamed of his inappropriate behavior.

6.

Answer Key for Cause and Effect *Accept all reasonable answers

Chapters 1-2

1. Because the Cherokee felt that they had been cheated with the purchase of their lands.2. So, Sadie Mae squealed in delight.3. Because Mary Ann’s father had died.4. Mary Ann had to live with her grandparents.5. Because Mary Ann’s father took groceries to the girl’s family when her father had been injured in the coal mine.

Chapters 3-4

1. Because Mary Ann sneaked some sips of Coke which were only to be used for upset stomachs.2. Miss McCoy had a lecture about how important immigrants were to our nation.3. Because Danny made fun of the way Ling’s eyes were shaped.4. Judy became very quiet and hid behind her books, refusing to talk to anyone.5. Because the state of Virginia did not spend tax money to keep up the mountain roads.

Chapters 5-6

1. A big argument broke out and there was a pillow fight.2. Because they got into a fight and burst a feather pillow.3. Feathers flew everywhere.


4. So the cats would eat the barn mice that were eating the cow’s feed.5. Mary Ann did not want to go with Poppy to the co-op to get the sorghum ground up into feed.

Chapters 7-9

1. Because she was very worried about Dianna and her parents.2. He hit on Dianna’s mother. When he drank too much, he had flashbacks about the war and lost control.3. Because she was wily enough to lie to and to flatter the soldiers into believing that her family supported their side in the war.4. Because there was not enough salt in their diet.5. Because the soldiers needed a respite from the war and were willing to turn a blind eye to their enemy

Chapters 10-151. Because the colostrum had the nutrients and antibodies that newborn calves needed in order to survive.2. Uncle Raffer and Uncle Culley wired the barn with electric light and a heater for Mommy Laurie.3. Because it began to snow very hard.4. Mommy Laurie sent Mary Ann and Lassie down the mountain to bring the heifers to the barn.5. Because she wanted to keep some eggs for her needy neighbors.

Chapters 16-21

1. Because methane gas is highly explosive.2. Poppy had to help the calf to be born.3. Because it would be easier with her mother’s schedule4. Wild Thing slapped back and clawed Bobby.5. Because Mommy Laurie and Poppy needed help on the farm. Because Mary Ann’s mother needed to grow and sell

produce for extra money.

Chapters 22-27

1. As a result, the number of eggs that the chickens laid decreased.2. Because Mary Ann’s family had a memorial service every year.3. Thurston told Prissy he didn’t like the way she spoke to his sister.4. Because he decided he liked Mary Ann.5. Stan apologized to Mary Ann, Grace and Kaylee for snapping their bras.

IS THE STATEMENT A FACT OR OPINION?

FACT OPINION

It is fact if… it can be proven you witness it it is true it can be measured in some

mathematical or scientific way

Some signal phrases are: I know for a fact… This proves that… It is for sure… It is true according to the

data collected

Add more signals as you find them.

It is an opinion if… it cannot be proven there are no witnesses it cannot be measured in

some way

Some signal words are… seems feel probably possibly in my opinion I believe, I do believe think least, most good, better, best bad, worse, worst should, should not I guess usually


always never most likely

Add more signals here:

Fact and Opinion for Entire Book, Mary Ann’s Mountain: Write fact or opinion to describe the sentences below. If there are words that signal whether or not the sentence is a fact or opinion, circle the word or words. On the back, write some of your own sentences from the story and identify them.

(Student Pages)

_______________1. Our farm sits on a high ridge overlooking the Cumberland Mountains to the west and the Clinch Mountains to the east.

_______________2. There is never a dull moment on our mountain.

_______________3. I’d have to say that Mommy’s pinto beans with cornbread and her Sunday fried chicken with tomato grave can’t be beat!

_______________4. As one piglet tumbles down from the top of the heap, another piglet climbs up.

_______________5. Mother thinks that football gives my brothers an outlet for excess energy.

_______________6. I am lucky to have my grandfather.

_______________7. The Chinese and the Hungarians worked alongside Poppy at the coke ovens on Tom’s Creek.

_______________8. Miss McCoy lectured, “Yes, we should thank the families like Ling’s, Angelica’s and Kornel’s.”

_______________9. Poppy said, “Little Chank, I do believe Garrison knows what he’s talkin’ about! You have one good teacher!”


______________10. Students from the agricultural school come to our farm to learn about the care and feeding of chickens.

______________11. ________________________________________________ ________________________________________________ ________________________________________________

______________12. ________________________________________________ ________________________________________________ ________________________________________________

_______________13.___________________________________________________________________________________________________________________________________________________

_______________14.___________________________________________________________________________________________________________________________________________________

_______________15.___________________________________________________________________________________________________________________________________________________

_______________16.___________________________________________________________________________________________________________________________________________________

_______________17.___________________________________________________________________________________________________________________________________________________

_______________18.___________________________________________________________________________________________________________________________________________________

_______________19.___________________________________________________________________________________________________________________________________________________

_______________20.___________________________________________________________________________________________________________________________________________________


Use a Venn diagram to compare yourself to the main character in Mary Ann’s Mountain or to another character.

Use a Venn diagram to compare life in the late l950’s to your life today.


Character Web: Use this web to describe the main character or other characters in the story.


Sequence of Events: Use the elements of PLOT to record the main happenings in the story in order.

Problem(s) to be faced or resolved:

Event or group of events:




Climax:

Resolution:

Chart for Mood: Cite examples of mood, an important element of literature that tells how the book makes you feel as you read. Keep adding to this list as you read the story selection.

Mood Quote or paraphrase from story that supports your answer.feel happy On brisk mornings like today, a dollop or two of fresh

butter in a steaming bowl of oatmeal is so good!feel sad

feel angry

feel calmandpeaceful


feel gloomy

Test on Chapters 1-6 for Mary Ann’s Mountain Name____________________

A. Circle the letter of the best answer.

1. At what time of year does the story begin as suggested by this quote, “The weather is cool and that means hog killing time. In another month it will be Christmas.”

a. fall b. winter c. spring

2. Which statement does not describe why Mary Ann likes her grandfather? a. He tells her stories about how his family came to the new world,

America. b. He listens to what she has to say and talks to her like a grown-up. b. He is always working and is too exhausted to spend time with her.

3. What was the biggest industry in the mountains of Virginia during the 1950’s?

a. coal mining b. raising chickens and selling eggs c. raising cattle for the stock market

4. Which statement best describes the genre of this book? a. It is historical fiction about a time in the past with some historically

correct facts. b. It is a biography about a young girl’s actual life with real events. c. It is realistic fiction about a young girl’s life with events that could

really have happened.Guided Reading Activities for Mary Ann’s MountainPage 63

5. What is the setting for this book? a. on a high ridge overlooking the Rocky Mountains b. on a high ridge overlooking the Blue Ridge Mountains c. on a high ridge overlooking the Clinch and Cumberland mountains

6. Which statement best describes that the punishment for the pillow fight was heavy on the brothers’ minds as they cleaned up the mess left from

having a pillow fight? a. They were talkative as they picked up the feathers.

b. The silence was deafening. There was no talking.c. They got into another argument about who was most to blame for

getting into trouble.7. Which statement best describes why Poppy was not a coal miner?

a. He did not like digging coal on his knees day after day. b. He did not like all the coal dust that got on and in his skin, nor did

he want to get “black lung”. c. He was afraid that the ceiling of the mine would collapse and kill him.

8. Which statement best describes how Mary Ann felt about not ever having met her father.

a. She was angry with her grandparents and Mother for never talking about her dad.

b. She loved to hear people tell about things her father did.c. She felt that she would never had a chance in life without her

father’s support.

9. Which phrase tells you that life on the farm is not always easy? a. the feeding of a motherless calf every two hours night and day b. having friends to help with the shucking and shelling of corn c. getting delicious fresh milk from Ole Cherry

10. What clue tells you that Mommy Laurie doesn’t consider corn liquor to be all bad? a. She tells Mary Ann that the moonshiners have an illegal business. b. She tells Mary Ann that the corn liquor is sold out of state so that local people don’t talk about it. c. She reminds Mary Ann that the corn liquor cured her sore throat; therefore, it can be used for medicinal purposes.

B. Fact or Opinion: Write “F” for fact or “O” for opinion before the statements.

11. _____ I think that living on a farm is a hard way to live.12. _____ The Cumberland Mountains are a part of the greater Appalachian Mountains.


13. _____The best thing for Mary Ann was to live with her grandparents.14. _____ Mary Ann had three wonderful brothers, Kyle, Dale, and Thurston.15. _____ Poppy had a sixth grade education.16. _____ Mommy Laurie did most of the milking.

C. Cause and Effect Relationships: Write the cause and effect for the following.

Cause tells why it happened. Effect tells what happenedor what will happen

17. Mary Ann’s mother could not afford a baby-sitter.

18. Lucy Lou had to be bottle fed every two hours day and night.

19. People would wait a year or more for Papa to build their homes.

20. Because Kyle, Dale, and Thurston were spanked by

their mother using a shoe.

21. Mommy Laurie talks to Mary Ann about bootleggers and white lightnin’.


D. Figurative Language: Write metaphor, simile, repetition of words for emphasis, personification, dialect, exaggeration, or colloquialism.

22. Sleeping so close together makes those boys act like a bunch of bantam roosters at times.

23. When he speaks, Poppy’s soft voice sounds like music.

24. At night the feather beds smell like pure sunshine and mountain air.

25. Most of the time, we do what we are told. Most of the time, that one eyebrow that Mother can so artistically raise so abnormally high suffices to warn us that we are about to step across the line.Most of the time, naughty behavior stops before it even begins.

26. These mountains sure do sing.27. Poppy often jokes, “My ears are so big they

could sail me from here to China!”28. Folk sure do like Poppy’s honey. (word used to

mean people in general)

29.30.

Garrison, one of the seventh graders, piped up, “Amen, Miss McCoy. You told ‘em good. If that ain’t the best lesson I ever (29)heerd, (30)I’ll swallow a fly!”

E. Vocabulary: Write the word that best fits the sentence on the line provided. You may or may not use all the words.

dollopsimmerbutchergnarly

interlopersaptlychifforobeimmigrants

featgnarlyunwaryboisterous

agriculturalcloggingunwaryheritage

equitablesufficesconsumptiondiversity

31. ___________________Mama lets the beef stew ____all day on the coal stove.32. ___________________When my brothers sleep in the ___ they can get quite

boisterous.33. ___________________The trespassers or ____ were not welcome by the natives of

that land.34. ___________________The teacher said, “Use words in your paragraph that most

____ describe the scene.35. ___________________It is quite a ____to be able to swim the length of the pool in

one minute. 36. ___________________ ____ of too much food is not good for you.Guided Reading Activities for Mary Ann’s MountainPage 66

37. ___________________The boys hung their Sunday clothes in the ___as this was used in place of a closet.

38. ___________________ Many farmers ____their hogs in the fall to keep the meat from spoiling so fast.

39. ___________________ A ___of butter slathered on a biscuit is yummy. 40. ___________________ My family is proud of its Scotch-Irish ___.41. ___________________ It will be necessary to negotiate an ___ exchange of money

for land.

F. Answer the following questions in complete sentences. Support your answers.

42. Describe one thing that you learned about life in the mountainous coalfields of Southwest Virginia.

________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________

43. Explain how you feel about Ling being called a name in school. Support your answer. __________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________

44. Mary Ann’s Mountain is told in first person by the main character. What do you like or dislike about this story being told that way? Support your thoughts.

____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________

Section Test on Chapters 7-15 Name___________________A. Circle the letter of the best answer.

1. What makes Wild Thing stand out? a. He was very docile and sweet.b. He learned to jump into the air to catch a stream of milk in his mouth

on the first try. c. He had a white M emblazoned on his forehead.

2. Which statement tells you that Mommy Laurie knows the nature of cats?


a. She makes them a bed using the same box and newspaper knowing they will connect to their own scents and be comfortable with something familiar.

b. She scolds them for not learning to catch the milk that she squirts into the air.

c. She tells Mary Ann that cats are not very smart and that they do not obey the same way as dogs do.

3. Which statement tells why Mary Ann is proud to have a relative like Aunt Ellen? a. Aunt Ellen was small for her age, just like Mary Ann b. Aunt Ellen was very quick-witted, gutsy and brave in the face of danger.

c. Aunt Ellen had a “smart mouth” and talked incessantly without thinking about what she had to say.

4. Which statement best describes how Poppy feels about war. a. War is a terrible thing, but war is necessary to get back at your enemy.

b. Poppy says that soldiers need a respite from war and that drinking is the best thing for them to do.

c. Soldiers need a respite while fighting a war because they see many terrible things happen.

5. Which statement does not tell why Mary Ann told Dianna’s secret to Poppy?a. Mary Ann likes to get her friends to tell her their secrets so she can whisper

them to others. b. Mary Ann was burdened with the knowledge that Dianna’s father was

hitting her mother. c. Mary Ann did not feel that it was fair that her friend Judy lost her father in a coal mine explosion.

6. Which statement best describes why Mary Ann was so upset about the newborn calf whose mother was dying?

a. She knew the calf, if it survived, would be taken to the stock market immediately because her grandparents would refuse to bottle feed another calf as they did Lucy Lou.

b. She knew the calf would be given away and she would never see it again. c. She knew the calf could not survive if it did not get its mother’s first milk,

or colostrum, which would give it the nutrients and antibodies it needed to fight diseases.


7. Which statement best explains why Mommy Laurie told Stuart a little white lie about not having any more eggs to sell him?

a. She wanted to make sure that her neighbors who were going through great hardships had food to eat.

b. She did not care about how Stuart treated his customers and didn’t want him to overcharge them for the eggs she sold him at a discount.

c. She wanted to teach Thurston and Mary Ann a lesson about charity.

8. Which statement best explains why Christmas on the mountain wasn’t all about gifts under the Christmas tree? a. Gifts do not always make everyone happy. b. Most gifts don’t last very long and are a waste of money.

c. Being with family is more important than getting gifts from under the Christmas tree.

9. What action does not tell you that all life on the mountain is respected

and loved? a. Mommy Laurie turns down the bed for all the children every night. b. Poppy says that new life on the farm is such a wonder!

c. Mommy Laurie and Poppy refuse to take care of another calf that is born with problems.

d. Mother makes beautiful matching purple dresses for little Lizzie and her doll.

10. Which statement does not tell you that Mary Ann shares a lot of the responsibilities on the farm? a. Uncle Raffer said to Mary Ann, “I believe you’ve earned your keep today!”

b. Mary Ann and Lassie went down the mountain in bad weather to collect the heifers that were about ready to calve.

c. Mary Ann feared bad weather and told Mommy Laurie that she did not want to go after the heifers.

B. Fact and Opinion: Write “F” for fact or “O” for opinion before each statement.

11. _____ Weather wisdoms are based on observations over a number of years.

12. _____Weather wisdoms are always true.13. _____Ole Cherry gets mean when she is being milked in pitch dark.14. _____Mommy told Wild Thing, “I do believe you are the courageous one.”15. _____Wild Thing stretched his paws up to Mommy’s lap and looked her

straight into her eyes.Guided Reading Activities for Mary Ann’s MountainPage 69

C. Figurative Language: Write metaphor, simile, repetition of words for emphasis, personification, dialect, exaggeration, or colloquialism.

16. ___________________Uncle Raffer says, “It’s hard to see a sick animal, ain’t it?”17. ___________________On Christmas Day, Poppy’s words seeped into my heart and

made it feel like singing a new song.18. ___________________Mommy Laurie cooks a breakfast good enough to feed

Queen Elizabeth!19. ___________________We don’t want the poem to end, but it does. We don’t want

the night to end, but it does.20. ___________________“Where there’s a will, there’s a way!” proclaims Stuart.

D. Read each sentence and write the cause and effect for each.

21. Mommy told a little white lie because she wanted her needy neighbors to have eggs for Christmas morning breakfast.

cause-why it happened effect-what happened or what will happen

22. The snow is getting pretty deep and Rock House Road will become impassable

in an hour or two. cause-why it happened effect-what happened or what will

happen

E. Vocabulary: Write the word that best fits the sentence on the line provided. You may or may not use all the words.

emblazonedsaunteredmiffeddescended

urgencymenacecommotionmeanders

menagerieconfiscateincessanttraumatic

23. _____________________Wild Thing had the letter “M”____ on his forehead.24. _____________________Lassie barked with a sense of ____ as she herded the

heifers to the barn.25. _____________________In defiance, Wild Thing ____off to the farmhouse.Guided Reading Activities for Mary Ann’s MountainPage 70

26. _____________________A ____ is a collection of many different wild or tame animals.

27. _____________________Poppy gets angry, or ____, because he has to keep up our road that other people tear up when driving their trucks and cars over it.

28. _____________________During the Civil War, soldiers traveled around the countryside in order to ____food from families without permission in order to feed their troops.

29. _____________________Coyotes can be a ____ to heifers and dams who are about to calve.

30. _____________________The little girl’s ____ chatter got on my grandmother’s nerves.

31. _____________________There was such a ____ coming from the barn, that we all went to see what was happening.

32. _____________________Mary Ann is ____ from a Scotch-Irish clan who came to America in the 1700’s.

33. _____________________It can be a ____ experience to have to move away from your friends.

34. ______________________Caney Creek ____ around and through the mountains of Dickenson County.

F. Write 3 statements about what you learned about Mary Ann’s Christmas on the mountain farm.

1._____________________________________________________________________________________________________________________________________________________________________________________________________

2._____________________________________________________________________________________________________________________________________________________________________________________________________

3._____________________________________________________________________________________________________________________________________________________________________________________________________

G. Write 2 statements that tell how you know that Mary Ann’s Mountain is a novel.

1._____________________________________________________________________________________________________________________________________________________________________________________________________

2._____________________________________________________________________________________________________________________________________________________________________________________________________

H. What is the “theme” of this book. Support your answers with explanations.


1._____________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________

Section Test on Chapters 16-27 Name______________________

A. Circle the best answer for each question.

1. All of the following makes living in the mountains of Southwest Virginia difficult except for which one statement.a. Mining coal is a dangerous job because of the backbreaking work, the

danger of collapsing ceilings, and the danger of methane gas.b. Mommy Laurie lets the children make ice cream when the neighbors come

to help string beans.c. The winter weather can make travel hazardous.d. The mountainous land makes it difficult to plow and grow crops.

2. How did Judy show she was a friend to Mary Ann?a. She always stopped reading her books to talk to Mary Ann.b. She wanted Mary Ann to talk to her more about the mine explosion

that killed her dad. c. She scolded Bobby when he slapped at Wild Thing telling Bobby he

deserved the scratch that Wild Thing gave him.

3. All of the following statements describe the wonders of the mountain according to what Mary Ann sees and feels except for which one?a. Copperheads like to catch the mice that come to eat the grains left from

putting up hay. b. The spectacular night show of fireflies is not only breathtaking but also a

source of storytelling. c. The miracle of life on the farm causes Mary Ann to respect and appreciate

not only the lives of newborn calves and kittens but also the lives of her beloved family and friends.

4. Which statement best describes how Mary Ann handled Stan, the class bully? a. She told Stan what she thought about what he had done and then later

showed him with a smile and with her help in math that she forgave him. b. She got angry and rudely told him off in front of the whole cafeteria, then

stomped off.


c. She let Ella do all the talking for her and never gave Stan the time of day again.

5. Which statement best describes the change in Stan attitude and behavior? a. He refused to apologize to Mary Ann and the other girls, and he told them

that they were just not letting him have any fun?b. He told everyone how much fun and helpful the tangram puzzles were with

his math learning and that everyone should ask Mary Ann and Ella to show them how to do pre-algebra with the puzzles.

c. He brimmed over with enthusiasm for math because of Mary Ann and Ella’s help, and he realized that Mary Ann and Ella were showing him that they could forgive him for his past actions since he was sorry for what he had done.

6. Which action on Thurston’s part best describes that he loved his sister and their way of life on the mountain?

a. He told Prissy that he did not like her making fun of his sister. He explained that living on a mountain far away from big cities didn’t mean that mountain folks were any different from anyone else.

b. He bragged to Prissy about all the books that he and Mary Ann had read and told Prissy that folks can get a good education no matter where they live. He said that a city girl was not the only one who could get a good education.

c. He made fun of Prissy and her city talk saying that there is only one way to talk, and that was talking with the mountain dialect.

7. Which statement does not describe why Mary Ann admires Wild Thing and Lassie?a. Both animals demonstrated their bravery by using their body language to first threaten an enemy, and when that didn’t work, they went into action.

b. Both animals had a great instinct to protect those that they loved, animals and people alike.

c. Mary Ann thought that Wild Thing and Lassie were not capable of thinking and acting on their own without being commanded to act.

8. Which statement least describes how Mary Ann’s grandmother shows her love more than she speaks it?

a. She puts extra fried apple pies and chicken biscuits in Mary Ann’s lunch box

for Sturgis. b. She tells her grandchildren all the time, “I love you!”

c. She turns down the grandchildren’s beds every night.


9. Which statement does not describe how the author used the setting to make the story more interesting?

a. The author did not want the reader to be able to relate to the main character and her problems by having Mary Ann live on a farm in the mountainous coalfields of Southwest Virginia.

b. The author used a farm in the mountainous coalfields of Southwest Virginia so that she could use the dangers, the fun, and the challenges that the rugged mountains forced the main character to face.

c. The author wanted the language of the region to be entertaining to the reader.

10. Which statement best describes the author’s viewpoint in this reading selection? a. The author wants the reader to see that there are many problems growing

up in the mountainous coalfields of Southwest Virginia and that there are not many ways to solve those problems.

b. The author wants the reader to understand that growing up in the mountainous coalfields of Virginia can teach a girl or boy Mary Ann’s age many valuable lessons that cannot be learned anywhere else.

c. The author wants the reader to relate to the problems that every girl or boy will face no matter where they grow up, and she wants the reader to know that problems can be faced with the help of family and friends.

B. Fact and Opinion: Write “F” if the statement is a fact. Write “O” if the statement is an opinion.

11. ______On a clear day on the mountain, Mary Ann could see twenty miles all the way to St. Paul.

12. ______ Mary Ann and her mother were not happy when Mary Ann’s brothers had to scrimmage another team in the afternoons which always made them too late getting home to do their chores.

13. ______ Poppy talked to his state legislator to see what could be done by the state

to help with the upkeep of his road when the coal company was not willing

to do its fair share of work.14. ______ Poppy complained too much about the ruts in the road.15. ______ The memorial service at the cemetery on the mountain had been a

tradition for more than seventy years.

C. Figurative Language: Write metaphor, simile, repetition of words for emphasis, personification, dialect, exaggeration, or colloquialism.


16. _______________________Wrestling a stiff hose is like wrestling a stubborn Lizzie when she doesn’t want to take a nap.

17. _______________________ “I declare, every morning, my old Buick groans in protest when we begin the trek up the mountain!”

Miss McCoy declared. 18. _______________________ Bobby announces, “He can leap from the tallest trees!

It’s a squirrel! It’s a plane! No, it’s Super Cat!”19. ______________________ Before the gurgling stream sings us to sleep, we load

ourselves back into the car and follow the crooked road back to our mountain home.

20. ______________________ I can’t help but wonder what other secrets our mountain holds.

D. Cause and Effect: Read each sentence. Write the cause and effect in the correct boxes.

21. We live close to my grandparents because we have to help with farm chores.

cause-why it happened________________________________________________________________________________________________________________________________________________________________________________________________

effect-what happened or what will happen______________________________________________________________________________________________________________________________________________________________________________________________________

22. Mother got a college education so that she could get a job to support her family.

cause-why it happened________________________________________________________________________________________________________________________________________________________________________________________________________________________________

effect-what happened or what will happen________________________________________________________________________________________________________________________________________________________________________________________________________________________________

E. Vocabulary: Write the word that best fits the sentence on the line provided. You may or may not use all the words. You may use a word more than once.

fiendishpoacherlullingdiscern

spindlyinheriteddroneprattling

toleraterelentedinheritpaddock

anticipationaccomplishhybriddistinguished


23. ____________________ The coyote had a ____look in his eyes as he planned his attack on the mule.24. ____________________ A calf’s legs are long and ____ unlike the legs of a bulldog. 25. ____________________ Mother ____herself by graduating from college in three years.26. ____________________ All the young ginseng roots had been dug by the ____,

therefore, there will be no more ginseng growing in Poppy’s woods.

27. ____________________ We decorated the Christmas tree in ____ of the arrival of Santa.

28. ____________________ When two plants have been grafted together or their seeds have been combined, they produce a new plant called a ____. A plumcot is an example.

29. ____________________ Prissy just kept ____ on and on until even she forgot the hurts her talk caused.

30. ____________________ When beginning a new venture, it is important to set some realistic goals for yourself, then it is even more important to try to ____ a few or of those goals.

31, ____________________ The mother rocked her baby and sang softly ____ it to a sound sleep.

32. ____________________ Sometimes, it is hard to ____ whether or not someone is being honest with you.

33.____________________ The children kept begging their mother to let them go to the movies so that she finally ____ and took them.

34. ____________________ Horses are often separated and kept in ____ where they have freedom to graze.

35. ____________________ Mary Ann ____ her green eyes and blonde hair from her Scotch-Irish ancestors.

36. ____________________ The ____ of the airplane engine could be heard for miles around.

37. ____________________ Sometimes, it is difficult to ____ the difference between identical twins.38. ____________________ Joe’s grandparents did not ____ the peddler’s shenanigans.

F. Circle all the clues that tell you that this story took place in the late 1950’s.

A Mother drove the boys to school in her new 1957 Chevrolet.B Students in Mary Ann’s class had computers.C Black and white oxfords were worn to school by many girls.D Coal mining was the biggest industry in Southwest Virginia.E Chinese checkers and the board game, Monopoly, were two popular games

of the time.F The first rocket, the Sputnik, was sent to space by the Russians. G Dwight D. Eisenhower was president.


H General stores still sold everything a family needed: groceries, clothing, tools, furniture, etc.

I Cell phones were the most commonly used form of communication.J Families went to the mall to shop for everything they needed.K One-room or two-room schools were still in use in the late 1950’s.

G. Describe one scene you liked best in the book. Give good reasons for it being your favorite. Write complete sentences. Use your book to refer to your favorite passage.

________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________

ANSWER KEY FOR TESTSCHAPTERS 1-6 continued… Chapter 7-15 continued…

Part A1. a2. b3. a4. c5. c6. b7. c8. b9. b10. c

Part B11. O12. F13. O14. O15. F16. F

Part C17. She had to live with her grandparents.

Part D22. simile23. simile24. simile25. repetition of words26. personification27. metaphor28. colloquialism29. dialect30. exaggeration

Part E31. simmer32. dormitory33. interlopers34. aptly35. feat36. Consumption37. chifforobe38. butcher39. dollop40. heritage41. equitable

Part A1. c2. a3. b4. c5. a6. c7. a8. c9. c10. c

Part B11. F12. O13. O14. O15. F

Part C16. dialect17. simile18. exaggeration

Part E23. emblazoned24. urgency25. sauntered26. menagerie27. miffed28. confiscate29. menace30. incessant31. commotion32. descended33. traumatic34. meanders

Parts F, G, HAccept all answers that demonstrate good support statements.


18. Her mother died.19. Because he was the best carpenter and bricklayer around20. They were humiliated.21. Because she wants Mary Ann to know what is happening around her. She wanted Mary Ann to know why the children laughed when the jar of whiskey was given to Miss McCoy.

Accept all reasonable answers.

Part FAccept all answers that demonstrate good support statements.

19. repetition of words20. colloquialism

Part D21. Cause-because she wanted her needy neighbors to have eggs for Christmas morning breakfast. Effect- Mommy told a little white lie.22. Cause- The snow is getting pretty deep. Effect- Rock House Road will become impassable in an hour or two

ANSWER KEY FOR TESTSCHAPTERS 16-27 continued…

Part A1. b2. c3. a4. a5. c6. a7. c8. b9. a10. c

Part B11. F12. O13. F14. O15. F

Part C16. simile17. personification18. exaggeration19. metaphor20. personification

Part D21. Cause- because we have to help with the

Part E23. fiendish24. spindly25. distinguished26. poacher27. anticipation28. hybrid29. prattling30. accomplish31. lulling32. discern33. relented34. paddocks35. inherited36. drone37. discern38. tolerate

Part FA, B, D, E, F, G, H, K

Part GAccept all reasonable answers. I allow students to use their books to find a passage.


farm chores. Effect – We live close to my grandparents.22. Cause – so that she could get a job to support her family. Effect – Mother got a college education



Documents

· Web viewYou may use the T-chart activity sheet. ... Do you like mountain music or ... The cow got into the briar patch and there were cuts and scratches on her