58
Undergraduate Research and Creative Work 9 December 2016 – 8:45am to 1:30pm Sakamaki Hall Campus Center Ballroom Honolulu, Hawaiʻi

Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

  • Upload
    others

  • View
    1

  • Download
    0

Embed Size (px)

Citation preview

Page 1: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

UndergraduateResearchandCreativeWork

9December2016–8:45amto1:30pmSakamakiHall

CampusCenterBallroomHonolulu,Hawaiʻi

Page 2: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

1

SCHEDULE

TIME ACTIVITY LOCATION

8:45-9:20a

RegistrationandBreakfast

SakamakiFirstFloor

9:25-9:30a OpeningCeremony SakamakiFirstFloor

9:35-10:30a OralPresentationsSessionOne

BreakoutRooms

10:30-10:40a Break Courtyard

10:40-11:35a OralPresentationsSessionTwo

BreakoutRooms

11:45a-12:30pPosterPresentationsSession

CampusCenterBallroom

12:30-1:30pLunchandAwardsCeremony

CampusCenterBallroom

SAK

AM

AK

I HA

LL

CA

MPU

S C

ENTE

R

Page 3: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

2

MAPSakamakiHall&CampusCenter

Registration & Refreshments

Natural Sciences (B101-104)

Arts & Humanities (A102)

Entrance

Social Sciences (A103)

Engineering & Computer Sciences/

Natural Sciences (A101)

Page 4: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

3

LOCATION

SakamakiHallOralPresentationsSessionOne 9:35a-10:30aOralPresentationsSessionTwo 10:40a-11:35a

A101 Engineering&ComputerSciences/NaturalSciences

A102 Arts&Humanities–Research/Arts&Humanities–Creative

A103 SocialSciences

B101 NaturalSciences

B102 NaturalSciences

B103 NaturalSciences

B104 NaturalSciences

CampusCenterBallroomPosterPresentations 11:45a-12:30pLunchandAwardsCeremony12:30p-1:30p

Page 5: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

4

OralPresentationsSessionOne9:35-10:30a

SakamakiA101 Engineering&ComputerSciencesFinishedProjects

StephanieChang DesignofaBiologicalFilterforCarbon

DioxideUsingChlorellavulgaris

HailingLi ReliabilityofPunchingShearStrengthPredictionforExistingBuildings

DerekChan*, TranslatingOralTraditionsIntoAModern,AndrewGuagliardo*, Immersive,InteractiveVirtualRealityAnnaSikkink* Experience

SakamakiA102 Arts&Humanities–Research

FinishedProjects

AmberO'Brien* EnergyEfficiency:TheFutureofGlassMaking

ShelbySullivan DeathCampCommanders:AdministratorsofHitler’s“FinalSolution”

* next to name in schedule indicates student is also presenting a poster

Page 6: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

5

OralPresentationsSessionOne9:35-10:30a

SakamakiA103 SocialSciencesFinishedProjects

KseniaBussard* KnowledgeandAwarenessofHumanPapillomavirus(HPV)andHPVVaccinationAmongCollegeStudentsattheUniversityofHawai‘iatMānoa:AGenderComparisonStudy

StephanieCacal* KalusuganatKayamanan(Healthand

Wealth)ofFilipinosinKalihi

KyungMooKim* PriceDeterminantsofTuberculosisDrugs

SakamakiB101 NaturalSciencesFinishedProjects

EileenChen, ScreeningMutantHumanAsparaginase-NikkiRousslang ProducingEscherichiacolifortheProduction

ofHighlyActiveHumanAsparaginases

MichelleHu OptimizingAromataseExpressionandUncoveringNovelAllostericInhibitors

CasieKubota, ExpressionofSTAT3inE.coliforSmallMarissaKuwabara MoleculeInhibitorDevelopment

* next to name in schedule indicates student is also presenting a poster

Page 7: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

6

OralPresentationsSessionOne9:35-10:30a

SakamakiB102 NaturalSciencesFinishedProjects

DaltonMuchow RamanandFluorescenceSpectroscopyforCategorizingCoralHealthinHawai'i

AlainaSmith MaintenanceofDiversityThroughMultiple

TimescalesofVariation

RebeccaMarieWeible MethodDevelopment:IsolatingMicroplasticsfromCopepodsintheAlaWaiCanal

SakamakiB103 NaturalSciencesFinishedProjects

JennySFang* DesignandDevelopmentofPlasmids

ExpressingSexChromosomeEncodedZfy/xGenestoTestSpecificityofNewlyDevelopedAntibodiesagainstMouseZFProteins

StephenMacaspac DeterminationoftheLigand-BindingSitesof

GPCR’sthroughProteinConservationAnalysisandDockingSimulations

CindyVuong FunctionofMouseORC4Fragmentsin

FemaleMeiosis

* next to name in schedule indicates student is also presenting a poster

Page 8: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

7

OralPresentationsSessionOne9:35-10:30a

SakamakiB104 NaturalSciencesFinishedProjects

JesseBoord TheEffectsofGroundwater-DerivedNutrientsonMacroalgalGrowth

LeoVLouis MarketSurveyofFungiinBhutan

SeanReseigh ConversionofFoodWastetoRenewable

BiogasandNutrient-RichBioslurry

Page 9: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

8

OralPresentationsSessionTwo10:40-11:35a

SakamakiA101 NaturalSciencesWorksinProgress

KaimiKahihikolo ThievingStarsCaughtbyKepler:ASearchforIntermittentAccretorsinKeplerBinarySystems

MicahPascual MechanismsUnderlyingDifferential

ResponsestoNeuropeptideAllatostatin-C(AST-C)intheCardiacGanglion(CG)oftheAmericanlobster,Homarusamericanus

TaylorTashiro MolecularTaxonomicIdentificationof

NematodeSpeciesinHawai‘i SakamakiA102 Arts&Humanities–Creative FinishedProjects

TylerRamos AMusicalJourney-NationalCompetitionandSummerFestivals

JeremyFrancisco DevelopmentofMen'sFashionintheUSA

Divinagracia

Page 10: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

9

OralPresentationsSessionTwo10:40-11:35a

SakamakiA103 SocialSciencesFinishedProjects

HyeWon(Judy)Chung MentalHealthStigmaPerceivedbyRuralHealthProfessionals

NicholasKawelakai UnderstandingtheCommunityFoodFarrant MovementonOʻahu’sNorthShoreShannonNoelleRivera NowheretoGo:PerceivedBarrierstothe

UseofAssistedColonizationforClimateSensitiveSpecies

SakamakiB101 NaturalSciencesWorksinProgress

EvanFujimoto, TheProtectiveEffectsofmTORagainstDavisWong HypoxicStressorinCardiomyocytes BrennenYasuda ExpressionofAlternativeRibosomalProteins

inMycobacteriasmegmatisunderStressConditions

SakamakiB102 NaturalSciencesFinishedProjects

LaurenMathews Nutrition&ElementalStoichiometryof

MicrozooplanktonLifeStagesinaChangingClimate

DerekRisch ImpactsofFloodControlManagementon

Water Quality of Kaelepulu and KawainuiStreamsinKailuaBay

Page 11: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

10

OralPresentationsSessionTwo10:40-11:35a

SakamakiB103 NaturalSciencesWorksinProgress JasonDelaCruz LargeScaleExpressionandPurificationof

Yop1forinvitroTubuleFormation

ChristianMacaspac, VulnerabilityintheDevelopmentalVaniaFernandes RegulationoftheMechanosensorinthe

MexicanCavefish CrystalValdez EvolutionofSymbioticGutBiotaandits

RelationshiptoFattyAcidStorageinMexicanCavefish

SakamakiB104 NaturalSciencesFinishedProjects

MiaDelano HeritabilityofCoralpHTolerance

ZachQuinlan FluorescenceofDissolvedOrganicMatterof

CoralExudates

Page 12: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

11

PosterPresentations11:45a-12:30p-CampusCenterBallroom

Arts&Humanities

AmberO’Brien EnergyEfficiency:TheFutureofGlassMaking

Engineering&ComputerSciences

DerekChan, TranslatingOralTraditionsIntoAModern,AndrewGuagliardo, Immersive,InteractiveVirtualRealityAnnaSikkink Experience

NaturalSciences

AndrewChang ChemicalCharacterizationandCellularEffectof‘Uhaloa,aNativeHawaiianMedicinalPlant

JennySFang DesignandDevelopmentofPlasmids

ExpressingSexChromosomeEncodedZfy/xGenestoTestSpecificityofNewlyDevelopedAntibodiesagainstMouseZFProteins

KimberlyKahaleua, EpithelialCell-specificMechanismsofMariaPetelo CapsaicininaNativeHawaiianMedicinal

Plant,Nīoi

Page 13: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

12

PosterPresentations11:45a-12:30p-CampusCenterBallroom

SocialSciences KseniaBussard KnowledgeandAwarenessofHuman

Papillomavirus(HPV)andHPVVaccinationAmongCollegeStudentsattheUniversityofHawai‘iatMānoa:AGenderComparisonStudy

StephanieCacal KalusuganatKayamanan(Healthand

Wealth)ofFilipinosinKalihi KyungMooKim PriceDeterminantsofTuberculosisDrugs

Page 14: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

13

ABSTRACTS

Abstractsoforalandposterpresentationsarelistedin alphabetical order of presenter’s last name.Informationbelow thename includes the student’smajor, the category of their presentation, andtime/locationofpresentation.Thefacultymentor,ifappropriate,islistedbelowtheabstract.Groupabstractsare listedalphabeticallybytheLastNameof the groupmemberwhosenameoccurs inthislist:

DerekChan,AndrewGuagliardo,AnnaSikkinkEileenChen,NikkiRousslangEvanFujimoto,DavisWongKimberlyKahaleua,MariaPeteloCasieKubota,MarissaKuwabaraChristianMacaspac,VaniaFernandes

Abstractsaredirectfrompresenters;wordingandcontentaretheauthor’sresponsibility.

Page 15: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

14

JesseBoordMarineBiologyFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiB104

TheEffectsofGroundwater-DerivedNutrientsonMacroalgalGrowth

Recent evidence indicates that coastal ecosystems undergoing nutrientenrichment in areas of low circulation are susceptible to communitycomposition shifts, algalblooms,declines in coralhealthandperseveranceofinvasivemacroalgae.Inordertodeterminewhethergroundwater-derivednutrientsimpactthegrowthofmacroalgalspecieslocatedwithinMaunaluaBay, the rates of nutrient delivery over time to different locations weredetermined, before correlations between macroalgal distribution andnutrientloadswereinvestigated.Submarinegroundwaterdischarge(SGD)isa source of high nutrients on Wailupe and Black Point reef flats. As SGDseepsoutontothereefflat, it isdilutedasitmixesoffshore.Toinvestigateany correlations betweenmacroalgal growth and groundwater factors (ie.highnutrientsandlowsalinity),growthassayswereconductedatBlackPointandWailupeinzoneswithvariousdegreesofgroundwaterimpact.Compartmentalizedmesh pouches, each containing a differentmacroalgalspecies, were deployed at 18 locations, spanning 3 zones from highest tolowest groundwater impact (spring, diffuse, and transition) over 5 days.These experiments were repeated 4 times at each site, providing reliablegrowth data with respect to groundwater influence. Different macroalgalspeciesshoweddifferentgrowthrates,revealingthatalgaegrowthdifferedbybothspeciesandzone.Mentor:Dr.FlorenceThomas

Page 16: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

15

KseniaBussardPublicHealthFinishedProjectinSocialSciencesParticipationforHonors,UROPOralPresentation:Session1(9:35-10:30a)inSakamakiA103PosterPresentation:11:45a-12:30pinCampusCenterBallroom

KnowledgeandAwarenessofHumanPapillomavirus(HPV)andHPVVaccinationAmongCollegeStudentsattheUniversityofHawai‘iatMānoa:

AGenderComparisonStudyHuman Papillomavirus (HPV) is the most common sexually transmitteddisease in the United States. Some strains of the virus can cause variouscancersandcanleadtogenitalwarts inbothmalesandfemales.TherearethreeFDA-approvedHPVvaccinesthatcanpreventmostoftheHPV-causedcancersandgenitalwarts.Nevertheless,therateoftheiruptakeislowinthenationandinHawai’iinparticular.This research project was designed to estimate the prevalence of HPVvaccination among college students at the University of Hawai‘i atMānoa(UHM), to understand the possible reasons for not vaccinating, and toperform a gender comparison of HPV and HPV vaccine awareness amongUHMstudents.The study was designed as a self-administered cross-sectional survey. Thestudy population consistedof 199UH students 18 to 34 years of age. Thesurvey included multiple-choice questions as well as true-or-falsestatements. The survey results showed that bothmale and female collegestudents atUHM lacked in awareness and knowledge aboutHPV andHPVvaccines.However,male students laggedbehind their female counterpartsinknowledgeaboutHPVandHPVvaccineandthevaccineuptake.Themainreason for not getting vaccinated against HPV was identified as a lack ofgeneral knowledge and awareness about the HPV vaccines. Based on thesurvey results, public health officials should take measures to increaseawareness about HPV and HPV vaccine among college students. Thesemeasures should focus on both male and female students to achievevaccine’sintendedpublichealthbenefits.Mentor:Dr.EricHurwitz

Page 17: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

16

StephanieCacalPublicHealth,MinorinPhilippineLanguageandCultureFinishedProjectinSocialSciencesParticipationforHonorsOralPresentation:Session1(9:35-10:30a)inSakamakiA103PosterPresentation:11:45a-12:30pinCampusCenterBallroom

KalusuganatKayamanan(HealthandWealth)ofFilipinosinKalihi

Filipinos in Hawaii have high rates of obesity, diabetes, hypertension, andtheworstmeasuresofbehavioralriskfactorsliketobaccouseandpoordiet.Toaddressthesehealthissuesandcreateahealthiercommunity,culturallycompetent and relevant programs must be implemented. However, ahealthier community cannot be achieved until health is defined. Eachcommunityownsdifferent capitals/wealth,meaning theyall havedifferentdefinitions of health. This study aims to define health and non-monetizedwealthofFilipinosinKalihi.This studyworkedwithKokuaKalihi Valley (KKV)’s Community Education -Civic Engagement (CECE) program. We conducted cultures circles with 52FilipinoresidentsofKalihibetweentheagesof18-24.Intheseculturecircles,they answered four questions about health, wealth, healing, and theircommunity. The results showed that definitions of health go beyond justthatofthemedicaldefinition.Resultsalsoshowedmanydifferentsourcesofwealththatcanbefoundinthecommunity;thehighestbeingrelationshipsbetweenthepeopleandcommunitythatsurroundthem.Thisstudycreateda framework with strategies and examples on how to approach differentaspects of health defined by the community using their narratives andstories.

ThisstudycreatedaspaceandempoweredtheFilipinoresidentsofKalihitofind ways tomake themselves healthier on their own terms. Through theframework,we hope to aid in developing better programs to improve thecommunity’shealthoverall.Thisstudyalsohopestobringawarenessaboutthe relat ionship between health and non-monetized wealth.Mentor:Dr.JeffreyAcido

Page 18: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

17

DerekChan,Information&ComputerSciencesAndrewGuagliardo,AcademyforCreativeMediaAnnaSikkink,Information&ComputerSciencesFinishedProjectinEngineering&ComputerSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiA101PosterPresentation:11:45a-12:30pinCampusCenterBallroomTranslatingOralTraditionsIntoAModern,Immersive,InteractiveVirtual

RealityExperience

Virtual reality is an exciting medium that has unexplored potential fornarrative storytelling. This creative project will result in an interactive VRexperience, basedon a Polynesianmyth- a rarely investigated subject.Webegan by conducting extensive background research on Polynesianmyths.WeselectedcandidatesbasedonanestablishedcriteriaforanengagingVRexperience. We chose the myth "How Maui Snared the Sun" because itprovidedastruggleagainstsupernaturalforcesandrequiredcharactersandinteractions that would be impossible to recreate in traditional mediums.The next stepwas to begin to experiment with various ways to bring thestoryintothevirtualrealmandtoadaptthestorysothattheuserwouldfeelthat theyhada role toplay.Weendedupwitha frameworkofaseriesofpossible interactionsthatwouldleadtoacompletestoryline.Notalloftheinteractions are required to complete the story, creating a uniqueexperience,justasatraditionallytoldstorymayvaryslightlyineachtelling.Initial interactions were programmed and tested in Unity3D usingplaceholder models. We built final models and animations in Maya usingsimplifiedmannequinsforourhumancharactersandmorecomplexmodelsandanimationsforthesupernaturalcharacterssuchastheSunandMoon.Finally,ambientmusic,soundeffectsandvoiceoverwasaddedtoincreaseasenseofpresenceandcreateanadditionallayerofemotion.Mentor:Dr.JasonLeigh

Page 19: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

18

AndrewChangChemistry,MinorinArtFinishedProjectinNaturalSciencesPosterPresentation:11:45a-12:30pinCampusCenterBallroomChemicalCharacterizationandCellularEffectof‘Uhaloa,aNativeHawaiian

MedicinalPlant‘Uhaloa(Waltheriaindica)isanendemicspeciesinHawaii.Ateamadefromdriedleaves,flowersandfreshtaprootof‘UhaloaisusedinLa’auLapa’aubyKahunaLa‘auLapa‘au (traditionalHawaiihealthpractitioners) to treat sorethroat,cough,congestion,arthritis,asthma,upperrespiratoryproblems,andinfantthrush.Chemicalcompoundsof‘Uhaloaincludeflavonoidsandotherchemical compounds.Quercetin is a flavonoid in ‘Uhaloawith knownanti-bacterial and anti-inflammatory properties. In understanding the basis forla’au lapa’au applications, involved cultivating ‘Uhaloa, in soil andhydroponics with the later showing significantly higher growth rates, toprovidesufficientmaterialforthestudy.Wehavesubsequentlyundertakentheanalysisoftheknowneffectivecompoundsthatmayberesponsibleforthemultiplehealingpropertiesof ‘Uhaloa.Usingextractsderived fromthedried leaves of the cultured plant, we performed chemical and biologicalanalyses. Quercetinwas detected in initial samples from amodified Rao’sprocedure using hexane-acetone-chloroform or ethanol-hexane extract bythin layer chromatography (TLC). High performance liquid chromatography(HPLC) pilot analyses of crude ethanol extractswere conducted to identifycompounds with potential biological activities. In bactericidal assays theethanol-hexane fraction, hypothesized to contain multiple flavonoids,showed slightly greater antibacterial effect against Staphylococcus aureusthanthehexane-acetone-chloroformextractorquercetin.Cell-basedassaysin cultured epithelial cells and monocytes are aimed at identifyinginflammatory mediators potentially modified by ‘Uhaloa extracts, amechanismthatmayserveasthebasisforitsvaluablemedicinalproperties.Mentor:Dr.KatalinCsiszar

Page 20: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

19

StephanieChangMicrobiologyFinishedProjectinEngineering&ComputerSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiA101

DesignofaBiologicalFilterforCarbonDioxideUsingChlorellavulgaris

Atmosphericcarbondioxidehasbeenincreasingduetomanycausessuchastheuseof fossil fuels. Since it is agreenhousegas, it isnecessary that thelevels are reduced. Carbon dioxide is used naturally by photosyntheticorganismssuchasalgae.Theusagecanvarybasedonthealgae’sabilitytoaccessnutrientsandtheformofthecarbondioxide.Therefore,thepurposeoftheprojectwastotestdifferentmethodsofgrowingalgaetodeterminethebestmethodforcarbondioxideremoval.ThealgaeusedwasChlorellavulgarisbecauseitiseasytocultivateandhasmany uses such as a nutritional supplement and a possible biofuel. C.vulgaris was grown using three different methods. First, the algae werespreadonasheetoffilterpaperandhadthegrowthmediadrippedontothepaper.Next,thealgaeweregrownsuspendedintheliquidgrowthmedia.Inthe lastmethod, the algaewere cultivated on the growthmedia solidifiedusingagar.Mentor:Dr.Wei-WenSu

Page 21: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

20

EileenChen,ChemistryNikkiRousslang,BiologicalEngineeringFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiB101ScreeningMutantHumanAsparaginase-ProducingEscherichiacoliforthe

ProductionofHighlyActiveHumanAsparaginases

Current treatment for Acute Lymphoblastic Leukemia (ALL) includes theusageofdrugsderived frombacterial asparaginase (ASNase).ASNase is anenzyme that breaks up asparagine, a nonessential amino acid for humansbut essential amino acid for cancerous lymphoblasts. Unfortunately, somepatients experience mild to fatal allergic reactions to the drug due to itsderivation from bacteria. Human ASNase (hASNase) drugs may have thepotentialtodisplacethebacterialASNasedrugs.BecausehASNasesarenotforeign to human bodies, they should not trigger allergic reactions likebacterialASNasesdo.However,hASNaseissignificantlylessactivethanthebacterialASNase.Therefore,ourgoalwastoobtainamoreactivehASNaseby introducing mutations into the hASNase gene. We screened thesemutants using a pH-sensitive assay and isolated mutants with increasedactivity. Then, we developed protocols for expression and purification toextractactivehASNase.OurfuturegoalistoobtainahASNasemutantthatisatleasttwiceasactiveastheoriginalhASNase.AllourresearchtookplaceinDr.HoNg’sproteinstructurelaboratory.Mentor:Dr.HoLeungNg

Page 22: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

21

HyeWon(Judy)ChungPsychologyFinishedProjectinSocialSciencesParticipationforHonors,UROPOralPresentation:Session2(10:40-11:35a)inSakamakiA103

MentalHealthStigmaPerceivedbyRuralHealthProfessionals

To investigate mental health stigma, this study focuses on rural and NativeHawaiiancommunitiesacrosstheStateofHawai`i.Confrontingmentalhealthstigmaisvitaltoimprovinghealthservices.Researchhasidentifiedmentalhealthstigmaisabarriertoaccessinghealthservicesandahigherprevalenceofmentalhealthstigma inruralcommunities.Finally, themajority of Native Hawaiians reside in rural communities, where healthresourcestendtobelimited.An online survey has been designed to assess the extent to which healthprofessionals working in and/orwith rural and Native Hawaiian communitiesparticipate in the Department of Psychiatry (DoP) continuing educationactivities.Thecurrenthonorsprojectenhancedthesurveybyaddingsixmentalhealthstigma items ineffort to identifymentalhealthstigmaasperceivedbyrural health professionals. Data collection will be coordinated under thesupervision of DoP continuing education board member. Local professionalassociationswill be contacted to gain permission to distribute the survey viarespectivelistservs.Datawill be analyzed based on professional context (working in rural,NativeHawaiiancommunity;professionalaffiliation)usingSPSSsoftware,withreportsofdescriptivestatistics.Itisexpectedthatprofessionalsworkinginand/orwithrural and Native Hawai`ian communities will rate perceived mental healthstigmahigherthanprofessionalsworkinginothercommunities.Continuing education may be facilitated by the DoP to enhance rural healthaccess through professional development. Future research should seek toassess the efficacy of the DoP’s continuing education activities in reducingmentalhealthstigmaamonghealthprofessionals.Mentor:Dr.SusanaHelm

Page 23: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

22

JasonDelaCruzBiologyWorkinProgressinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiB103LargeScaleExpressionandPurificationofYop1forinvitroTubuleFormation

One of the most interesting aspects of the Endoplasmic Reticulum withineukaryotic cells is its ability to create a vast network of peripheralmicrotubules throughout a cell. This network allows the EndoplasmicReticulum to facilitate lipid transfer and calcium signaling between localorganelles. This network would not be possible without the presence ofYop1,amembrane-boundproteinthathelpsformthemicrotubulestructure.The overarching goal of this project is to optimize Escherichia coli’sexpression of the Yop1 protein, test the protein’s functionality, andcrystallizetheproteininordertoelucidateitsstructure.Asofnow,I’mstillworking on optimizing the expression protocol to yield higher levels offunctional protein. This process includes varying the growing conditions ofthecellculturesandusingdifferentYop1constructsandexpressionschemessetbyBradyet.al.Yop1playsakeyrole inmaintainingthemorphologyofthe peripheral endoplasmic reticulum, which is important for highereukaryotic organisms. By understanding its structure, we can use theinformation to learnmore about the protein itself as well as neurologicaldisordersassociatedwithendoplasmicreticulumstressincludingAlzheimer'sdiseaseandCrohn’sdisease.Mentor:Dr.HoLeungNg

Page 24: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

23

MiaDelanoGlobalEnvironmentalScienceFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiB104

HeritabilityofCoralpHTolerance

Coral reefsare someof themostbiologicallydiverseecosystemsonEarth,butarethreatenedasanthropogenic(man-made)carbondioxideemissionslowerthepHoftheocean.Thisprocess,knownasoceanacidification(OA),is expected to reduce coral growth rates. Heritable variation underlies thepotential for evolution over time, but the degree of variation in pHtolerancesamongcorals,aswellastheheritabilityofanysuchvariation,hadnotyetbeenstudied.ThisstudyquantifiesthevariationincoralcalcificationtolerancestoOAandtheheritabilityofanysuchvariationamongtheeightdominantcoralspeciesfoundaroundtheislandofO’ahu,constituting>97%coralcoveronHawaiianreefs.Coralcoloniesweresampledacrossnaturalgradientsinseawaterchemistryfrom six different locations around O’ahu, Hawai’i. The experiment wasconductedattheHawai’iInstituteofMarineBiologyinKane’ohe,O’ahu.Six3to5centimetersamples,callednubbins,werecutfromeachparentcoralandplacedinfouroutdoor,flow-through300Lmesocosmtanks,totaling160nubbins per tank. Twoof the four tankswere randomly chosen to receivecarbondioxidedosing(pH~7.6)andtwowerekeptatambientseawaterpH(pH~8.0)forthesix-weekexperiment.Species Montipora patula, Porites evermanni, and Porites meandrinadisplayed strongly heritable calcification rates and varied significantly inresponses between colonies. As coral reefs serve as the basis of vastecosystems, the identification of species that may adapt as the oceanacidifiesisasignificantfirststepinplanningforthefuture.Mentor:Dr.RobToonen

Page 25: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

24

JeremyFranciscoDivinagraciaFashionDesign&MerchandisingFinishedProjectinArts&Humanities-CreativeParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiA102

DevelopmentofMen'sFashionintheUSA

Fashion is a never-ending update of previous designs. For the menswearmarket,tailoringwaslostovertimeafterthe1960sandiscurrentlyregainingmomentuminthismoderngeneration.Theexponentialgrowthofinterestinmen’s fashion within the industry is recognized nationally. This involveschallengingtheacceptedaestheticsofmasculinityandbreakinggender-fixedclothingsilhouettes.Streetstyleisaneccentricexpressionofcontemporarycultureinfashion.Ithasbecomearesourcethatinspiresdesigners’collections.Hawaiʻiisoneofthe most recognizable travel destinations globally, which brings differentcultures intoone location.Thecombinationofcultures inoneplaceallowsanarrayofdiversitythatcanbeseenonthestreetsofHonolulu.Thesearedocumented in “Honolulu Street Style” by Maile Moran, Attila Pohlmann,andAndyReilly.This creative project focuses on developing a fashion line for thecontemporary menswear market by combining the aesthetics of classicgentlemen’swearwiththediversityfoundinstreetstyleinHawai`i.Mentor:Dr.AndyReilly

Page 26: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

25

JennySFangMolecularCellBiologyFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiB103PosterPresentation:11:45a-12:30pinCampusCenterBallroomDesignandDevelopmentofPlasmidsExpressingSexChromosomeEncoded

Zfy/xGenestoTestSpecificityofNewlyDevelopedAntibodiesAgainstMouseZFProteins

Inmice,twocrucialY-linkedgeneswereidentified,SrydrivingformationoftestesandEif2s3y responsible for initiationof spermatogenesis.Malemicewith Y chromosome contribution provided by these two genes producedhaploid round spermatids, which after injection into the oocytes yieldedoffspring. These round spermatids represented immaturemale gametes asthey lacked tails andwerenotable to fertilizeon theirown.Whena thirdgeneY-gene,Zfy2,wasaddedtomalescarryingSryandEif2s3y,spermwithtailswereformed.Zfy2 isthereforeacrucialgeneformalereproduction inthe mouse, but nothing is known about the mechanism or molecularfunction of its action. The first step to uncover this requires creatingexperimentaltools.ThegoalofmyprojectistoidentifyanantibodythatcanrecognizeZFY2from itsX-linkedhomologueZFXandY-linkedZFY1,bothofwhichareverysimilar.Tofulfillthis,Iwillproduceplasmidsthatwillbeusedfor transfection of Human Embryonic Kidney (HEK) cells in order tomakethemtranslateeachZFX/Yproteins.ThesetransgenicHEKcellswillthenbeused to test the specificity of the anti-ZFY2 antibodies (which we arecurrently developing) using dot blots, western blots, andimmunofluorescence. The importance of this work is that it will allowidentificationof thebestZFY2-specificantibody for future investigationsofthefunctionalroleofZFY2 inspermmaturation.SinceZfy2 isan importantmale fertility gene, the study bears relevance to understanding andtreatmentofhumanmaleinfertility.Mentor:MonikaWard

Page 27: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

26

NicholasKawelakaiFarrantInterdisciplinaryStudiesandHawaiianLanguageFinishedProjectinSocialSciencesParticipationforHonors,UROPOralPresentation:Session2(10:40-11:35a)inSakamakiA103

UnderstandingtheCommunityFoodMovementonOʻahu’sNorthShore

Recognizingopportunities to improvepublichealth,promote regional foodsecurity,andprotectagricultural land,community leadersofOʻahu’sNorthShoreorganizedtheFirstAnnualNorthShoreFoodSummit(NSFS) in2013.Initsfour-yeartenuresincethatinnaguralevent,theNSFShasexploredtheconnectionsthattheNorthShorefoodsystem,includingcommunityhealth,Kanaka ʻŌiwi (indigenous Hawaiian) culture, local and community-basedenergyproduction,waterissues,andlandconservation.Theseconversationshave been facilitated through a wide variety of contexts, includingpresentations and panel discussions, collaborative breakout sessions, sitevisits,andyouthinvolvement.This research involved the compilation and analysis of existing qualitativedata recorded throughout planning and implementation of the four NorthShoreFoodSummiteventstodate.Italsoincludedgatheringandanalyzingthe reflections of prominent NSFS participants and planners on theirexperienceswithandhopesfortheannualevent.Lastly,itdrawsuponotherexamples fromother communities toplace theNSFSwithin the contextofthe contemporarymovement for food reform throughout Hawaiʻi and theWorld.ConclusionsdrawnfromthesedatanotonlyserveasaguideforNorthShorecommunity members’ continued efforts, but also as a record of thismovement to inform and inspire other communities involved in similarefforts.Mentor:Dr.NoelaniGoodyear-Kaʻōpua

Page 28: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

27

EvanFujimoto,BiologyDavisWong,BiochemistryWorkinProgressinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiB101TheProtectiveEffectsofmTORagainstHypoxicStressorinCardiomyocytes

Heart failure is a major cause of death worldwide and results fromcardiomyocyte(CM)injurycausedbyischemicevents.Ischemia-reperfusion(I/R) injury is a major pathophysiological feature seen in clinical practicebecause of reperfusion therapies. I/R injury generates reactive oxygenspecies (ROS) released from mitochondria, thus leading to cell death.Previously we reported that mTOR (mammalian target of rapamycin)protects the heart against I/R injury in both in vivo and ex vivo animalmodels. However, the role of mTOR in CMs is poorly understood. In thisstudy, we subjected H9c2 cardiomyoblasts to hydrogen peroxide (H2O2)-induced ischemia invitro to study the roleofmTOR in I/R injury.H2O2 isawell-known ROS that increases in I/R injury. Wildtype H9c2 and mTORstable-celllineswereculturedin500μMH2O2for30minutes,andcelldeathwas analyzed using a Live/Dead Cell Viability Assay (Invitrogen). We usedfluorescencemicroscopytophotographthreerandomareasineachwell.Wecountedviableanddeadcells,whichshowedadecreaseincelldeathincellswith mTOR overexpression compared to the wildtype (controls vs. mTOR;11.1±2.4%vs.2.3±0.3%,p<0.05,n=3each).Theresultofthisexperimentisfurther evidence for the protective effects of mTOR in cardiomyocytes.Understanding the cardioprotective effects of mTOR could lead to newtherapiesforheartfailure.Mentor:Dr.TakashiMatsui

Page 29: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

28

MichelleHuBiochemistryFinishedProjectinNaturalSciencesParticipationforHonors,UROPOralPresentation:Session1(9:35-10:30a)inSakamakiB101OptimizingAromataseExpressionandUncoveringNovelAllostericInhibitors

Breastcanceroccurs in1outof8womenwhile2,600newcasesofbreastcancerareexpectedformenin2016alone1.Aromatase,acytochromeP450enzyme that converts androgens, is linked to hormonal breast cancerdevelopment2. Aromatase inhibitors are currently used to treat breastcancer,butthemethodofbindingforsomeofthemremainsunknown.Theobjective of this project is to optimize aromatase expression inE. coli anduncover novel allosteric inhibitors. While screening possible compoundsusinganinhibitionassay,AR11andAR13producedIC50valuesof25.35μMand0.41μMrespectively, compared toknown inhibitorsketoconazoleandendoxifen.Expressionofmutant-typearomatasewasnotincreased,despiteadjusting induction time, incubation temperature, and cell strain. Thoughoptimization of aromatase was not achieved, possible inhibitors wereuncovered which will be used in future crystallization screening onceexpressionisimprovedon.Thesecrystalscreenscanthenbeusedtocreatenew structures for aromatase, leading to improved inhibitor potency andreducedtoxicity.Mentor:Dr.HoLeungNg

Page 30: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

29

KimberlyKahaleua,BiologyMariaPetelo,BiologyFinishedProjectinNaturalSciencesPosterPresentation:11:45a-12:30pinCampusCenterBallroom

EpithelialCell-specificMechanismsofCapsaicininaNativeHawaiianMedicinalPlant,Nīoi

Nīoi (Capsicum frutescens), has been used by traditional Hawaiian healthpractitioners to treat aches and pains, arthritis, rheumatism and skinconditions. One of its components, capsaicin, topically reduces pain andsymptomsassociatedwithinflammation,acommonfeatureinskindisordersincluding psoriasis, atopic dermatitis, and eczema with high prevalence inNative Hawaiian populations. Immune responses and expression of pro-inflammatory cytokines are also suppressed by capsaicin. While an earlyinflammatory phase is prominent during skinwound healing, controversialresults were reported for capsaicin treatment involving slow healing,delayed wound contraction, and hypertrophic scars, demonstrating strongeffect on skin epithelial cell functions. However, epithelia-associatedmechanismsandresponsestocapsaicinremainundocumented.We have evaluated capsaicin-induced changes in a secondary analysis ofDNA array data of gene expression in epi-4 human epithelial cells, anddownstream effects on the migration, proliferation and adhesion ofembryonickidneycells (HEK293)andepidermalkeratinocytes (HEKa).Geneexpressiondatarevealedcapsaicin-alteredgeneexpressionofgrowthfactorsand their receptors; of cell-cell interactions; of genes responsible forremodeling the cellular microenvironment; and of those encodingcomponents of the basal lamina that determines epithelial functions.Downstreamphenotypeeffects includeda tendency for reducedmigrationand a significant decrease in cell proliferation of capsaicin treated HEKakeratinocytes, but not HEK239 cells. Both array data and cell phenotypechanges indicated altered cell adhesion. Collectively, results demonstratethat capsaicin has strong, but differential effects on epithelial cell typeshighlyrelevanttoitstopicalapplications.Co-Authors:AndrewChang,NoemiPolgar,RozaliaLackzo,BenFogelgrenMentor:Dr.KatalinCsiszar

Page 31: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

30

KaimiKahihikoloAstrophysicsWorkinProgressinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiA101

ThievingStarsCaughtbyKepler:ASearchforIntermittentAccretorsinKeplerBinarySystems

Binary stars, under certain circumstances, have a possibility of forming asymbiotic binary star system---a phenomenon where one star begins todevouritscompanion.Thesesystemscanbedetectedusingthreemethods:studyinglightcurvesforintermittentbrightening,intermittentdimmingandorbital period decay. By re-purposing data from the Kepler telescope andtaking near-infrared photometry using the Faulkes telescope, potentialsymbioticbinarystarsystemshavebeendetected.Followupobservationsofthesepotentialaccretorswillbecarriedoutnextsummer.Mentor:Dr.RobertoMendez

Page 32: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

31

KyungMooKimEconomics,CertificateinClassicalLanguagesFinishedProjectinSocialSciencesParticipationforHonorsOralPresentation:Session1(9:35-10:30a)inSakamakiA103PosterPresentation:11:45a-12:30pinCampusCenterBallroom

PriceDeterminantsofTuberculosisDrugs

Thoughdrugs for tuberculosishasexistedsince the1940s,over9.6millionpeoplefellillwithTBand1.5milliondiedfromdiseasein2014.Developingcountriescarrymuchoftheburden:over95%ofTBdeathsoccurinlow-andmiddle-incomecountries,accountingformorethan80%ofnewtuberculosiscases globally every year. It is therefore important that tuberculosis drugsareavailableandaffordable to countries that arenot adeptatnegotiationand/orprocurement.ThePriceandQualityReporting(PQR)systemisaweb-basedsystemthatcollectsprocurementdata forselectcommoditiesunderThe Global Fund to Fight AIDS, Tuberculosis and Malaria. Little empiricalwork has beendoneon factors that affect global tuberculosis drugpricingandaffordability.AdatasetcontainingPQRinformationfrom2006to2014wasobtainedfromtheGlobalFund.We isolatedprocurementdatarelatedto tuberculosis and its treatment. There were 6372 transactions and theproducts purchased amount tomore thanUS$400million (current terms).We analyze using regression analysis the relationship between prices andfactors including time intervals between purchase order date and deliverydate,FDCs,GDPpercapita(Atlasmethod),publichealthexpenditureas%ofGDP,populationdensity,educationrates,governmentcorruption,incidenceof tuberculosis, suppliers, geography, and infrastructure (% roads paved).Preliminary results suggest positive correlations of price with increases inpublic healthcare expenditure, GDP per capita (current US$), populationdensity,CPIAscores,incidenceoftuberculosis,andurbanpopulation.Mentor:Dr.VictoriaFan

Page 33: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

32

CasieKubota,BiochemistryMarissaKuwabara,BioengineeringFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiB101

ExpressionofSTAT3inE.coliforSmallMoleculeInhibitorDevelopment

AbnormalfunctionandactivationofSTAT3,aproteininhumansthatassistsincellproliferationandsurvival,ismanifestedinmanyhumandiseasessuchas cancer.We are interested in producing high resolution visualizations ofcrystallized STAT3proteins that arebound to an inhibitor. Currently, thereareasurplusofinhibitorsthatbindtoSTAT3,butnonebindstronglyenoughtomakethatinhibitoraviableoptionformedicaltreatment.DuetothefactthatthecrystalstructureofaSTAT3proteinbindingtoaligandisnotknown,scientistsareunabletomoveforward incancertherapyresearch.ThegoalofthisprojectwastocrystallizetwodifferentvariantsoftheSTAT3proteinthat isboundtovarious ligands inhopestogiveresearcherspowerfuldatathatcouldpossibly leadtoabreakthrough incancertreatment. Inordertodothis,STAT3wasexpressedinE.colicellsandthencollectedandpurified.The purified protein was then incubated in crystallization trays containingvarious solutions in an effort to produce viable crystals. Using thesemethods, STAT3 crystals were successfully grown in MCSG-2 and MCSG-4crystallization trays. It was also found that Arginine greatly increased thestabilityofSTAT3whenusedinthepurificationprocess.Thecrystalswillbesoaked in various ligands in attempt to bind the ligands to the crystals. Afollow-up project is currently under way to obtain diffraction data on thecrystalsinordertoproduceaproteinstructureusingdigitalsoftware.Mentor:Dr.HoLeungNg

Page 34: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

33

HailingLiInformation&ComputerScienceFinishedProjectinEngineering&ComputerSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiA101

ReliabilityofPunchingShearStrengthPredictionforExistingBuildings

The punching shear strength of steel-reinforced concrete slab-columnconnections inexistingbuildingshasbeen thesourceofmanycatastrophicfailuresduringearthquakesandaccidentaloverloadofbuildings.Whenoldbuildings are analyzed using the current formulas prescribed by theAmericanConcrete Institute(ACI)BuildingCodeRequirements(ACI318-14)engineersconcludesthatthestrengthisinsufficientandrepairsareneededevenifthestructurehasbeenperformingadequatelyfordecades.Tobetterpredict the strength of these connections, the reliability of historical ACIpunching shear models (PSM), from 1912, through today’s code can beevaluated.Areliabilitymodelmustconsiderboththevariabilityindemandandcapacity.PSMs are used to predict the capacity of these connections; however theactual strength is influencedbyvariability ingeometry,materialpropertiesas well as how accurate the model represents reality when compared toexperimentaldata.MonteCarloSimulation(MCS)wasusedtoevaluatehowwell the historical PSMs were able to predict the actual strength ofconnections determined by 522 experiments available in the literature. Aprofessional factor, the mean ratio of the actual failure load to predictedcapacity,wasdeterminedforeachPSM.The professional factor, MCS, and a realistic statistical variation of loadswerethenusedtodevelopaninitialestimateofreliabilityforeachPSM.Atypical slab column connection designed such that the demand perfectlymatched the nominal capacity predicted by the PSM was used for thisanalysis.PreliminaryestimatesofreliabilityforeachPSMwillbepresented.Mentor:Dr.GaurJohnson

Page 35: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

34

LeoVLouisEthnobotanyFinishedProjectinNaturalSciencesParticipationforHonors,UROPOralPresentation:Session1(9:35-10:30a)inSakamakiB104

MarketSurveyofFungiinBhutan

TheKingdomofBhutanisarelativelysmallyetculturallyandbiologicallyrichmountainouslandlockedcountrytothenorthofIndia.Elevationsrangefrom200–7500 meters and includes sub-tropical, alpine, and temperate zones.Bhutan is made up of 20 dzongkhags (districts), and there are 23 spokenlanguages.Morethan69%ofthepopulationliveinruralcommunitieswhereediblewildplants (EWP)contribute toa largeportionofhouseholdannualincome. In particular, harvested mushrooms are extremely important, insome cases contributing up to 70% of the annual income for somecommunitymembers.Despitetheirobviousvaluebotheconomicallyandasafoodsource,limitedworkhasbeendonetoassesstheecologicalandsocialimplications of harvest. Here I present the results from market surveysconducted in three districts in western Bhutan. The goal of these surveyswas to investigate the diversity and relative quantity ofmushrooms beingharvested for sale. As well as local ecological knowledge related to theharvest ofmushrooms. Preliminary results reveal both a large diversity ofmushrooms being sold, and a relatively sophisticated understanding ofmushroom ecology among some community members. However, someBhutanese people have expressed concern that competition amongstharvestersisleadingtoadeclineinmushroomsizeandquality.ForinstanceCantharellus cibarius, considered a favorite amongst many Bhutanese, isexposed to large harvesting pressures that have resulted in a noticeabledecline in sizeandquality inmarkets. These issuesdraw intoquestion theecologicalandsocialimplicationsofmushroomharvesting.Mentor:MichaelB.Thomas

Page 36: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

35

ChristianMacaspac,BiologyVaniaFernandes,BiologyWorkinProgressinNaturalSciencesParticipationforResearchLabOralPresentation:Session2(10:40-11:35a)inSakamakiB103VulnerabilityintheDevelopmentalRegulationoftheMechanosensorinthe

MexicanCavefish

Stability of the developmental process is key in maintaining an ‘adapted’speciesinagivenenvironment,whereasitcouldreduceachancetoadapttothe novel environment. The Mexican tetra, Astyanax mexicanus, iscomposed of two morphs; the cave dwelling and surface dwelling forms,whichhavebothevolvedfromthesurfacedwellingancestormillionsofyearsago.Throughevolutionintheperpetualdarkandfoodsparsecave,cavefishshowa larger numberof themechanosensory superficial neuromasts thanthat of the surface fish, which are the sensor for a cave-adapted foragingbehavior,rheotaxisandschooling.Totestthedevelopmentalrobustnessofthis sensor,wepharmacologically inhibited theendothelin signaling,whichperturbsthecranialboneformation,thus, indirectlyinducingmorenumberofsuperficialneuromasts.After5timesofrepeatedexperiments,wefoundthattheneuromastnumbersignificantly increasedmoreincavefishthaninsurfacefish,suggestingthatthecavefishmayhaveevolvedadevelopmentalflexibilityinmechanosensorinordertoadapttothenovelenvironment.Weare further exploring the developmental process of this sensor and therelationshipwithitsadaptiveforagingbehaviors.Mentor,Co-Author:Dr.MasatoYoshizawa

Page 37: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

36

StephenMacaspacBiologyFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiB103

DeterminationoftheLigand-BindingSitesofGPCR’sthroughProteinConservationAnalysisandDockingSimulations

G-protein coupled receptors (GPCRs) are known to be involved in variousphysiological functions. Once ligand-binding sites are identified,pharmaceutical interactions can be further studied and applied to theprofusionofGPCR-relateddisorderssuchashormone-inducedcancers.ThecrystalstructuresofmostGPCR’shavenotbeendetermined,andthebindingsites ofmost ligands have not yet been experimentally identified. Variouscomputationalapproacheshavebeenusedtopredictligand-bindingsitesinGPCRs. Traditionally, docking methods have been utilized to compute thelowest energy orientation of a ligand fit to a receptor surface. Anotherfeaturethatcanbeusedisproteinconservationbecauseligand-bindingsitesof proteins are usually conserved. We applied a hybrid scoring function,using information from liganddockingandproteinconservation, topredictbinding sites on sites on a G-protein coupled estrogen receptor (GPER).Crystal structures of the a2a adenosine receptor and beta-2 adrenergicreceptor have been determined. Because their structures have beenexperimentally isolated with their ligands, they can serve as models toascertaintheaccuracyofthehybridscoringfunctionemployedtoGPER.Thecoordinates for the crystal structures a2a adenosine receptor bound byadenosine and beta-2 adrenergic receptor bound by epinephrine wereacquired from RCSB protein databank and uploaded to chimera. Eachreceptor was screened for amino acids interacting with their respectiveligands. These residues served as a benchmark for comparison withpredictions. Predicted binding sites parallel benchmark residues and verifythe potency of a hybrid scoring function that can be extrapolated toadditionalGPCRs.Mentor:Dr.HoLeungNg

Page 38: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

37

LaurenMathewsGlobalEnvironmentalScienceFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiB102Nutrition&ElementalStoichiometryofMicrozooplanktonLifeStagesina

ChangingClimate

Copepods, highly abundant microzooplankton, generally have rigidmetabolic needs, andmust adjust their feedingbehavior and/ormetabolicrates in order to compensate for imbalances in food stoichiometry. Ascopepods develop through a lifecycle, their demand for limiting nutrients,suchasphosphorus,shifts;thehighestphosphorusdemandoccurringduringthenaupliarstages.Measurementsofspecificzooplanktonbiomass,grazingrates,and internal stoichiometryaresampled throughoutonecopepod lifecycle from nauplii to adult in order to assess how reduction in relativephosphorous content of a phytoplankton food source will affect a smallcopepod species, Parvocalanus crassirostrus, at different developmentstages. In addition, to simulate variable sea surface temperature aroundHawaii, the same experiment is conducted at three different controlledtemperatures: 25˚C(meanwintertemperature),28˚C,and32˚C.Significantdifferencesacrossfoodtreatmentaswellastemperaturewereobservedforspecific P. crassirostrus biomass for copepodites, while nauplii indicated astronger resilience toboth temperatureand food treatment. Thisdatawillbe presented along with P. crassirostrus grazing rates and carbon:phosphorouselementalstoichiometricdataofbothP.crassirostrusandtheTisochrysis lutea food source for all food treatments and temperatureincubations.Knowledgeofcopepodnutritionandsubsequenthealthastheplanetwarmsandseasurfacetemperaturesriseisimportanttotheabilityoftrackingtheeffectsclimatechangeonbiological lifeandwillcreateabasisthat could lead to a warning system for fishery crashes and dangerousmarineanoxiczones.Mentors:Dr.CraigNelson,Dr.CarolynFaithfull

Page 39: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

38

DaltonMuchowGlobalEnvironmentalScienceFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiB102

RamanandFluorescenceSpectroscopyforCategorizingCoralHealthinHawai'i

Themajorityoftheworld’sreefecosystemsareatriskduetochangesinthelocal and global environments. Many common current techniques thatdeterminecoralhealthoverlargeareasrequirescientiststoSCUBAdiveonacoralreeftomakeobservationsandcollectsamples,requiringanenormousamountofplanningandfunding.RemoteRamanspectroscopyisapowerfultechnique capable of quickly identifying a large variety of chemicals,including pure elements, simple molecules, inorganic chemicals, organiccompounds, biogenic compounds, and rock forming minerals (calcite,aragonite) from any state of aggregation (solid, liquid, and gas phase).Another powerful remote sensing technique is “Time Resolved LaserInduced Native Fluorescence” (TR-LINF) and has been used as a standoffbiofinder capable of differentiating between mineral and biologicalfluorescence. Both of these techniques are fast (detection time <0.1s) andcanquicklyandaccuratelymeasure largeareasof interest.RemoteRamanand TR-LINF’s proven use in categorizing biological markers at remotedistance provides potential for application in measuring and categorizinglargeareasofcoralreefhealthfromadistance.Currently,nobodyinHawaiihas the capability to remotely measure coral and assess its health usingremotespectroscopyunderdaylightconditions.Mentor:Dr.AnupamMisra

Page 40: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

39

AmberO'BrienArt(Glass)andPsychologyFinishedProjectinArts&HumanitiesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiA102PosterPresentation:11:45a-12:30pinCampusCenterBallroom

EnergyEfficiency:TheFutureofGlassMaking

Innovation and invention have been a hallmark of individual artists toimprove glass making technology since the beginning of the studio glassmovement. Studio operations and equipment are complicated and requireskillful technical maintenance, financial literacy, and access to energyproducing natural resources. Energy consumption, policy and funding ofglassartstudiosandtheiruseofmaterialresourcesareareasofdiscussionthat shouldbe viewed throughapositive lens. Thepurposeof thisprojectwas to encourage the conversation of energy efficiency in the glasscommunityandestablishanetworkofresourcestoactualizefutureresearchand promote sustainable glassmaking practices. Themethods of researchinvolvedgatheringqualitativedatathroughsurveysofpublications,lectures,interviews, and observations from the Glass Art Society Conference andvarious studio visits around the country. The resultshavebeen centralizedinto a comprehensive database,www.GlassArtEnergy.org,which is easy touse and will be continuously updated as the conversation continues. Theconclusion is thatenergy efficiency in the glass studio relies on mindfulpracticesoftheuserandtheawarenessofavailabletechnologiescombinedwith the responsibility toapply them.Thisprojecthasbeenable togatherprimary resourcesandmake themanaccessibleeducational resource.Thisplatformhas thepotential todecrease theenergyexpenditureof theglassmakingcommunityasawholeandprogressustowardsamoresustainablefuture.Mentor:RickMills

Page 41: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

40

MicahPascualMicrobiologyWorkinProgressinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiA101

MechanismsUnderlyingDifferentialResponsestoNeuropeptideAllatostatin-C(AST-C)intheCardiacGanglion(CG)oftheAmericanLobster,

Homarusamericanus

Peptides are important modulators of neural circuit activity. In centralpattern generator (CPG)-effector systems, peptides allow for flexibility inrhythmic motor output. In the lobster, Homarus americanus, the cardiacneuromuscular system, which consists of the cardiac ganglion (CG) andcardiac muscle (CM), controls the rhythmic motor output of the heart.Recent investigations of the actions of the peptide hormone allatostatin-C(AST-C) on the cardiac neuromuscular system have shown variability inphysiological response among lobsters. Specifically, perfusion of AST-Cthrough the semi-intact heart consistently decreased the frequency ofongoing heart contractions, but showed varied effects on contractionamplitude, decreasing it in some lobsters and increasing it in others. Ourworking hypothesis is that the different responses of the lobster cardiacneuralcircuittoAST-CareduetothetypesofAST-CreceptorspresentintheCG in preparations that respond to AST-C with increases vs. decreases incontractionamplitude.Asafirststepintestingourhypothesiswegeneratedtissuespecifictranscriptomesforthelobster(brain,eyestalkgangliaandCG)andhaveminedthemusinghomology-basedBLASTsearchesfortranscriptsencodingputativeAST-Creceptors.Viatheseanalyses,fourdifferentAST-Creceptor types were identified. We are nowworking to generate severaladditional transcriptomes (i.e., one from CGs that show increases incontractionamplitudeandonefromCGsthatshowdecreasesincontractionamplitude)todetermineiftherearedifferencesintherelativeabundanceofthereceptortypesinanimalswithdifferentphysiologicalresponsestoAST-C.Mentor:AndrewEChristie

Page 42: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

41

ZachQuinlanMarineBiologyFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiB104

FluorescenceofDissolvedOrganicMatterofCoralExudates

Benthic organisms in tropical reef ecosystems all exude dissolved organicmatter as a portion of their primary production. Understanding thecomposition of these exudates as well as the response to changingenvironmental conditions is essential tounderstanding themetabolismsofthese organisms. We collected in-situ filtrate during a multi week surveyfromcorals for thedetectionoforganicexudates.Weanalyzed the filtrateusing fluorescence spectroscopy to characterize the exudate compositionanddifferential exudate concentrations acrossmultiple response variables.Exudateswerecollectedfromthreespeciesofcoral;Pocilloporadamicornis,Porites compressa, Montipora capitata, and across multiple patch reefswithin Kaneohe bay. Using previously catalogued fluorescent dissolvedorganicmatter(fDOM)exudatemarkersforcoralexudationwedeterminedthedistance fromthecoral inwhich theseexudatesignaturesdisappearedduetodispersion.Thecoralcolonieswereselectedfromcloned individualswhich displayed differential thermal tolerance and bleaching during pastbleaching events. Although in-vitromeasurements of proteinaceous fDOMshowedhighexudationofspecificaromaticaminoacid-likecompounds, in-situ coral species were found to exude different proportions of theseproteinaceousexudatesdependentonspeciesandlocation.Mentor:Dr.CraigENelson

Page 43: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

42

TylerRamosMusicFinishedProjectinArts&Humanities–CreativeParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiA102

AMusicalJourney-NationalCompetitionandSummerFestivals

TheculminatingpieceofmyprojectwasanhourlongsolopianorecitalthatraisedmoneyfortheHawaiiPianoTeacher’sAssociation.IpresentedworksofvariousstylesfromJohannSebastianBach(1685-1750)toAvnerDorman(1975-present). IstudiedtherepertoirepresentedatthisrecitalwithworldrenownedteachersattheprestigiousBanfffestivalinAlberta,Canada,whichtheUndergraduateResearchOpportunitiesProgram(UROP)fundedforme.IpresentedthisrecitalbecauseitshowstherangeofstylesthatIcanperform,and Iwanted to giveback to themusical community thathelped raisemeintothemusicianIamtoday.My project deals with the creative process, and finding an original andappealingvoicedespiteplayingfromthesamescoreaseveryoneelse.HowdoImakethemusicleapoffthepage,whatisstylisticallycorrect,andhowdoIpersonalizethepiecetomyinterpretationofthescorewithoutdeviatingfrom the composer’s wishes? These questions will be answered in mypresentation.Inmymusicalstudies,I’vealwayshadthehelpofmyinstructors,andthey'veguidedme towards independenceandmusicalmaturity. The fruitsof theirlaborshowinmywinningthirdplaceinanationalcompetitionandattendingtheBanffsummerfestival,ofwhich30outof200applicantswereaccepted.Mentor:Dr.ThomasYee

Page 44: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

43

SeanReseighNaturalResources&EnvironmentalManagementFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiB104ConversionofFoodWastetoRenewableBiogasandNutrient-RichBioslurry

FoodwastefromtheUniversityofHawai`iatMānoa(UHM)campuscentercafeteria was converted to renewable energy and nutrient-rich effluent(bioslurry) through anaerobic digestion. Biochemical methane potential(BMP) tests were performed utilizing three foodwaste to inoculum ratios(i.e.3:1,2:1,and1:1volatilesolidbasis).Subsequently,thisstudytestedtheeffectivenessof thebioslurryproducedduringanaerobicdigestionasasoilamendment was also studied. The plant used in the pot experiment wasBrassicaJuncea(BabyKaiChoy).Thepotexperimentconsistedoftwoslurrydosages i.e. with 200 mg of N and 400 mg of N per kg of soil. Anothertreatment was added with 400 mg of N of a commercial fertilizer, and acontrol treatmentwithouta soil amendment.Effluent from thebatchwiththehighestmethaneyieldwasadded in intervals for5weeks tomeet theNitrogencontentgoaloftheslurrytreatments.Theresultsrevealedthatthebatchwith the smallestamountofadded foodwaste (i.e.1:1) showed thehighest methane yield. However, increasing food waste to inoculum ratiocould significantly decrease methane yield. The inappropriate carbon tonitrogenratioof thebatchwithhigh foodwaste to inoculumratio (i.e.2:1and3:1)couldexplainthisphenomenon.Thepotexperimentconcludedthatthe treatment added with 400 mg of N from the slurry produced thehealthiest,densest,andmostnutrientrichplantsincomparisontoawidelyusedcommercialfertilizer.Mentors:Dr.JonathanDeenik,Dr.SamirKhanal

Page 45: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

44

DerekRischNaturalResources&EnvironmentalManagementFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiB102ImpactsofFloodControlManagementonWaterQualityofKaelepuluand

KawainuiStreamsinKailuaBay

Coastaldevelopmentandurbanizationnegatively impactwaterqualityandalter the movement of freshwater. Management actions such as streamchannelization accelerate the delivery of freshwater, along with dissolvednutrients and sediments, tomarine ecosystems. The purpose of this studywas to compare the impacts of rainfall events onwater qualitymetrics intwoadjacenthuman-modifiedstreamsystemsthatdischargetotheocean.Kawainui stream receives surface water from the Maunawili watershed,whileKaelepulustreamislargelycutofffromthewatershedduetoabarrierbuilt by the Army Corps of Engineers. Four sampling stations wereestablishedineachstream,arrangedlinearlyfromthemouthofthestreamtoward the interiorof thewetland.Samplingwasconductedmonthly fromMay to August 2016 on the highest tide, as a baseline, and when rainfallmeasured intheMaunawiliwatershedexceeded2.7cm.Waterqualitydata(salinity, pH, dissolved oxygen (DO), turbidity) were collected using a YSIProPlus multiparameter instrument. Surface water was collected at eachstationandiscurrentlybeinganalyzedfordissolvedinorganicnutrients(NO3

-+NO2

-,PO43-,NH4

+,H4SiO4).PreliminarydatafromtheYSIinstrumentshowalargedifferenceintheresponseofthetwostreamstostormevents.Salinity,pH, and DO were relatively unchanged following the largest storm in theKaelepulustreamsystem,whilethesamestormcausedasubstantialchangeacrossallparameterswithintheKawainuistream.AsimilartrendisexpectedforinorganicnutrientconcentrationswithhigherconcentrationsinKawainuiduetorunoffinthewatershed.Mentor:Dr.MelissaRPrice

Page 46: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

45

ShannonNoelleRiveraEnvironmentalStudiesandGender&ConflictResolutionMinorsinZoologyandDanceFinishedProjectinSocialSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiA103NowheretoGo:PerceivedBarrierstotheUseofAssistedColonizationfor

ClimateSensitiveSpeciesTheHawaiianIslands,astheplanet’smostremotearchipelago,arehometoan array of species that are as vulnerable as they are unique. With thehighest rate of extinction per square mile on earth, timely and effectiveactionsmustbetakentocountertheadditionalpressureplacedbyclimatechange on the 400 species in Hawai‘i listed as Endangered. Assistedcolonization,the intentionalmovementandreleaseofanorganismoutsideitshistoricalrange, isonemanagementoptionforspeciespredictedtolacksuitablehabitatunderlikelyclimatechangescenarios.Withafocusoncaseswhere such an extreme action may provide a reasonable hedge againstextinction,firstpersoninterviewswithemployeesoffederal,stateandnon-profit agencies were used to evaluate both the perceived and existingobstacles to the use of assisted colonization. We found several potentialbarriers to utilization of this management tool. Assisted Colonization isconsidered by many to be high-risk, due to factors such as the cost ofpreparing the target habitat, and potentially highmortality in translocatedindividuals.Our results suggest that,despiteexistingpolicies thatallow forassisted colonization in cases where it is warranted, this action is rarelyconsidered.Sinceassistedcolonizationisbestcarriedoutwhenpopulationsare robust enough to tolerate the removal of individuals for translocation,we recommend that this management action must be considered inconservation planning for species projected to have little or no suitablehabitatremainingasclimatechangeprogresses.Mentor:Dr.MelissaRPrice

Page 47: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

46

AlainaSmithGlobalEnvironmentalScienceFinishedProjectinNaturalSciencesParticipationforHonors,UROPOralPresentation:Session1(9:35-10:30a)inSakamakiB102

MaintenanceofDiversityThroughMultipleTimescalesofVariation

Diversity can be maintained through resource fluctuation because speciescan evolve different strategies to thrive under different conditions. Thesestrategies include being able to grow the fastest, being able to store themostresources,orbeingable touseresourcesmoreefficiently, thusbeingthe best competitor under limited resources.Nutrient supply in the oceanlikely varies overmultiple time scales (e.g., seasonal variation vs. storms);however, we do not understand how multiple frequencies of variationaffectsphytoplanktoncommunities.Totesttheroleofmultiplefrequenciesof variation, I amusing amodel describinghowphytoplankton respond tovarying nutrient supply. I compared how the community structure duringconditionswherethereweretwopulsefrequenciesdifferfromcommunitiesunderonepulsefrequencyconditions.Under one pulse conditions it was reiterated that species with differentstrategies did better under competition at different periods. As the pulseperiods increased therewere clear shifts in the community structurewithrespect to the strategies. However, when a second pulse frequency wasadded, pulse periods where species with one strategy usually dominated,were found to contain a co-existence between species with multiplestrategies. In short, it was found that multiple frequencies of resourcevariationallowforagreaterdiversityofstrategiespresentinthecommunity.Understanding themaintenance of diversity in phytoplankton is importantbecause they are the base of the foodweb and they play amajor part inbiogeochemical cycles including the carbon cycle, which affects how thebiospherereactstoclimatechange.Mentor:Dr.KyleEdwards

Page 48: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

47

ShelbySullivanHistoryFinishedProjectinArts&Humanities–ResearchParticipationforHonorsOralPresentation:Session1(9:35-10:30a)inSakamakiA102

DeathCampCommanders:AdministratorsofHitler’s“FinalSolution”

Historianshaveacknowledgeddifferentelementsthatcombinedtoproducethe Holocaust, ranging from ideology and totalitarian leadership, todetached and numerous bureaucrats and desk-murderers, to rank-and-fileexecutionsasthosecommonpeoplewhosupporttheirwork.Betweenthesepolarends–theupperechelonleaderswhoremainedlargelydisconnectedfromtheon-sitemurdersandtheslavelaborerswhoassistedthem–thereisa middle level functionary who is in a different position. The high levelleadersconcernedthemselveswithlong-rangeplans,statisticalreports,andeffortstorealizethevisionoftheFuhrer.Thoseindividualsremaineddistantfromthekillingsthatthey indirectlyauthorized.Manyofthe lower-rankingindividualswhowould takepart in theactualkillingofpeoplewouldclaimthey were under orders, or working under threat of death. The fewindividualswhowereon-siteandwhohad theability toactwitha relativeamountof personal initiative are the subject of this study. Thepurposeofthis paper is to examine a small group of SS leaders who were given theresponsibility of runningHitler’s extermination camps. The individuals thatwere appointed to oversee these centers represent an important middle-levelofmanagementintheexterminationsystem,andtheywillbeanalyzedagainstthebackdropofinterdisciplinaryscholarshipinordertogaugewhatattributes these men possessed, the extent to which they affected campoperations,andwhethertheymettheexpectationsoftheirsuperiors.Mentor:Dr.PeterHHoffenberg

Page 49: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

48

TaylorTashiroMolecularCellBiologyWorkinProgressinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiA101

MolecularTaxonomicIdentificationofNematodeSpeciesinHawai‘i

Nematodes that attack and parasitize plants have become an issue foragricultural crops and food security in Hawaii as well as other localitiesaroundtheworld.IdentifyingnematodesusingDNAcouldgreatlyfacilitateidentification of nematodes to the species level. This could be of vitalimportance for assessing biodiversity and for finding ways of properlydealingwiththesedestructiveandhighlyinvasivespecies.Inthisstudy,therelatively new DNA based method known as “DNA Barcoding” is used.Barcoding uses DNA sequences obtained from one specific gene that hasbeen characterized in awide rangeof organisms. Using this approachwehopetoidentifythepresenceofdestructiveplant-parasiticnematodessuchas root-knot nematodes in the genus Meloidogyne, possibly down to thespecies level. For this project the organisms used were both laboratorycultured nematodes andwild specimens collected in a field on Kauai nearKauai Community College (KCC). This process included 4 basic steps: (1)extracting DNA of specimens, (2) using PCR to amplify copies of the COI“barcode” gene aswell rRNA genes to produce viable DNA sequences, (3)analysisofDNAsequencesobtainedusingcomputersoftwareprogramssuchas DNAStar, (4) comparisons of DNA sequences to international databasessuchasGenBank.Throughouranalysiswehaveidentifiednematodespeciessuch asM. arenaria,M. incognita, andM. javanica to be present in ourcollections.Furtherresearchwillbedonetoidentifymorespeciesandfindproperimplicationsfortreatmentoftheparasites.Mentor:Dr.DavidHaymer

Page 50: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

49

CrystalValdezBiologyWorkinProgressinNaturalSciencesParticipationforResearchLabOralPresentation:Session2(10:40-11:35a)inSakamakiB103

EvolutionofSymbioticGutBiotaanditsRelationshiptoFattyAcidStorageinMexicanCavefish

Gutmicrobiota iscrucial forgutdevelopment,guthomeostasisandproperfunctionofhost immunesystem,metabolismandneuralprocessing.Short-chainfattyacidsareanemergingcomponentthatmicroorganismssupplytothe host which appears crucial for gut structure, immune response andneuralprocessing.Astyanaxmexicanusisaspeciescomposedofblindcave-dwellingmorphandtheirsightedsurface-dwellingmorph.Thesightedcavefishancestorsweretrappedincavesmillionsofyearsago,shiftingtheirdietofsmallfishandcrustaceanstoaleandietofrottenorganicmatterandbatguano. Despite significant changes, they remain interfertile, allowing us toapplypowerfulgeneticstoresolvetheevolutionofthegutbiotasymbiosm.Here,weperformedgeneticanalysesongutmorphology,gutbiotaandfattyacid composition of cave fish, surface fish and F1 hybrids. They were fedthree diets—nutrient-rich brine shrimp, nutrient-poor spirulina and batguano.Morphometrics revealed that cavefishhave significantly lesspyloriccaeca,longermicrovilliandawiderhind-gutthansurfacefish.Analysisofgutbiotausing16SribosomalRNAsequencingshowedthatsurfacefishandcavefish gut biota significantly differ, while F1 hybrids are an intermediate ofbothmorphs. Regardless of diet, gut biota remains stable suggesting hostgeneticsareinvolvedthus,Astyanaxmexicanusmayserveasanalternativemodel to highlight the molecular mechanisms of the gut symbioticinteraction. We will report how gut morphology changed under thecombinationofdiet,morphandfattyacidcomposition insurfacefish,cavefishandF1hybrids.Co-Authors:KateCoyle,ReadeRoberts,JoanneYewMentor:Dr.MasatoYoshizawa

Page 51: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

50

CindyVuongMolecularCellBiologyFinishedProjectinNaturalSciencesParticipationforUROPOralPresentation:Session1(9:35-10:30a)inSakamakiB103

FunctionofMouseORC4FragmentsinFemaleMeiosis

During female mammalian meiosis, the oocyte extrudes half of itschromosomes twice to reduce DNA content to 1N. The extrudedchromosomeswithinpolarbodieshaveminimalcytoplasmandareincapableof fertilization.Themechanismsbehindpolarbodyextrusion (PBE)are stillunclear. We previously demonstrated that in both meiotic divisions ofmurineoocytes, theDNA replication licensingprotein,ORC4, forms a cageonlyaroundthesetofchromosomestobeextruded inthepolarbodyandnotaroundthechromosomesremainingintheoocyteforfuturefertilization.This ORC4 cage possibly helps expel chromosomes unused by the finaloocyte. Theproposedproject testedwhatpartsofORC4arenecessary forcage formation. We reasoned that the cage required polymerization ofORC4, either with itself or another protein(s). Using the predicted three-dimensional structure for ORC4, we synthesized three mRNA-ORC4-HISfragments (120 bp). These fragments represented amino acids facing theprotein exterior that might disrupt the ORC4 cage by competitive bindingwithpolymerizationsites.WeinjectedthemRNAfragmentsindividuallyintoMIIoocytesandobservedoocytedevelopment.TwomRNAfragments,neartheN-terminusandnearthemid-regionoftheprotein,inhibitedORC4cageformation and also prevented PBE. The third mRNA fragment, containingpartsoftheC-terminus,hadnoeffectonORC4cageformationorPBE.TheseresultssuggestthatORC4isrequiredforcageformationandPBE,whichisanessentialprocessforpreventionofclinicaldisordersrelatedtochromosomalabnormalitiessuchasDownandTurnerSyndromes.Mentor:Dr.WStevenWard

Page 52: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

51

RebeccaMarieWeibleMarineBiologyFinishedProjectinNaturalSciencesParticipationforHonors,UROPOralPresentation:Session1(9:35-10:30a)inSakamakiB102

MethodDevelopment:IsolatingMicroplasticsfromCopepodsintheAlaWaiCanal

Microplastics are less than 5 mm in size (Zarfl & Matthies, 2010) andoriginate from the breakdown of larger plastics, cosmetic scrubbers,synthetic fibers, and air-blasting (Cole et al., 2011). Past studies haveindicatedaconcernforbioaccumulationofmicroplasticsinthefoodchainasapossibility(Coleetal.,2011;Desforgesetal.,2015;Zarfl&Matthies,2010),butnopublisheddatatestingthishypothesishasappearedintheliterature.Therefore, the focus of this project was on developing methodologies toidentifywhetherornotmicroplasticsexist in theAlaWaiCanaland if theyare consequently available and consumed by the canal’s copepods. Thisstudyanalyzedtheefficiencyofmethodsthat involvecopepod ingestionofmicroplastics less than 1mm in size. Results indicated that plankton towswere the most efficient method of collecting copepods andmicroplastics,that digestionswere not very effective, and that a baseline understandingfor the featuresandpropertiesofmicroplastics less than1mm in size stillrequires testing in order to isolate microplastics from copepods in theirnaturalenvironments.Inconclusion,furtherbaselinestudiesandknowledgeneedstobeacquiredbeforeonecandeterminewhetherornotmicroplasticsare biologically available to zooplankton, much less determine ifbioaccumulationupthefoodchainisapossibility.Mentor:Dr.KarenSelph

Page 53: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

52

BrennenYasudaMicrobiologyWorkinProgressinNaturalSciencesParticipationforUROPOralPresentation:Session2(10:40-11:35a)inSakamakiB101ExpressionofAlternativeRibosomalProteinsinMycobacteriasmegmatis

underStressConditions

The biological function of ribosomes to perform translation on encodedmRNAs is vital for life. Mycobacterium tuberculosis (Mtb), the causativeagent of TB, has been shown to express both primary and alternativeribosomalproteins(AltRPs).AprimaryribosomalproteinS18-1ismorelikelyto be incorporated into ribosomes when zinc is available. At low zincconcentrations,however,theexpressionofhomologousAltRP,S18-2proteindramatically increases, and it is able to replace S18-1 during ribosomebiogenesis. S18-1 and AltRP S18-2 proteins are also found in a relatednonpathogenic bacteriumMycobacterium smegmatis (Msm) and thereforeweusedthisorganismtofurtherinvestigateAltRPs.WetestedifconditionsotherthanlowzincinduceAltRPexpression.Invitrostressconditionswerechosen to test for expression of AltRPs based on similar physiologicalstresses thatMtb encounter during infection. First, a series ofMicroplateAlamar Blue Assays were performed to determine minimal inhibitoryconcentrations (MICs) for Cumene hydroperoxide (oxidative stress),DETANONOate (nitric oxide stress), Diamide (thiol oxidation stress), andPlumbagin (superoxide stress). Further,we exposedMsm to stresses at orbelow theirMICs and followedexpressionofAltRPsbyusing a fluorescentreporter controlled by the altRP promoter. However, results fromfluorescence readings show an increase in AltRP expression whenMsm isexposed to Cumene hydroperoxide compared to the untreatedMsm cells.Currently,weplan topurify andanalyze ribosomes in cells exposed to theCumene hydroperoxide in order to get a better understanding how theircompositionchangesinresponsetostresses.Mentor:Dr.SladjanaPrisic

Page 54: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

53

NOTES

Page 55: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

54

ACKNOWLEDGMENTS

MAHALO NUI LOA to Interim UH-Mānoa Chancellor David Lassner, Vice Chancellor for Research and Interim Vice Chancellor for Academic Affairs Michael Bruno, and Assistant Vice Chancellor for Undergraduate Education Ronald Cambra. STUDENT VOLUNTEERS We would like to thank the student volunteers who helped to set up and take down the facilities and to monitor the rooms during sessions. STAFF The organizers would like to extend a special thank you to their respective office staff for all their hard work behind the scenes during the conference and throughout the year. Thank you to: Michelle Brown Graduate Assistant, Honors Program Dr. Siobhán Ní Dhonacha Academic Advisor, Honors Program Dr. Vernadette Gonzalez Director of Honors Program & UROP Dr. Sue Haglund Educational Specialist, Honors Program Angelique Lepordo Student Assistant, Honors Program Troy Peiler Student Assistant, Honors Program Dr. Jayme Scally Academic Advisor, Honors Program Jasmine Samiere Student Assistant, UROP Sheela Sharma Educational Specialist, UROP Sylvia Wu Educational Specialist, Honors Program SPECIAL THANKS We would like to thank our event partners:

Ako Kifuji and Ahmad Ramadan for catering from Da Spot Campus Center Meeting and Event Services Staff for

facilities and planning assistance Copy Hut Hawaii for program and poster printing services Sakamaki Hall for use of facilities Sodexo staff for catering services

Page 56: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

55

ACKNOWLEDGMENTS

JUDGES AND MODERATORS We would like to thank all the faculty members, administrators and researchers who volunteered to judge and moderate the sessions and to lend their experience and expertise to this student conference: FACULTY JUDGESDr. Kimo Armitage Jason Mitchell, PhD, MPH Dr. Kasey Barton Dr. Aaron Ohta Dr. Amy C Brown Dr. Sladjana Prisic Dr. Katherine Finn Davis Leon Roose Dr. Kyle Edwards Dr. Raul Rudoy, PhD, MPH Dr. Nicole S Grove Dr. Rebecca Schweitzer Dr. Nicholas G James Ms. Angie Solomon Wendy Kawabata Dr. Anna Stirr Dr. Kent Kobayashi Dr. Zoia Stoytcheva Dr. Mukesh Kumar Prof. Eric Szarmes Dr. Rozalia Laczko, PhD Dr. Philip von Doetinchem Dr. Creighton M Litton Dr. Lori Yancura Dr. L Joyce Z Mariano GRADUATE STUDENT MODERATORS AND JUDGES Kaleonani Hurley Roberto Rodriguez Navid T Khajavi Nicole Schlaack Becca Lensing Maura Stephens Nicole Muszynski Lindsay Veazey Jourdan Posner Nathaniel Wehr

Page 57: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

56

ACKNOWLEDGMENTS

FACULTY MENTORS We would like to acknowledge the time, effort and expertise that faculty mentors put into advising students on their projects. Mahalo to the following people for their hard work:Dr. Jeffrey Acido Andrew E Christie Dr. Katalin Csiszar Dr. Jonathan Deenik Dr. Kyle Edwards Dr. Carolyn Faithfull Dr. Victoria Fan Dr. Noelani Goodyear-Ka‘ōpua Dr. David Haymer Dr. Susana Helm Dr. Peter H Hoffenberg Dr. Eric Hurwitz Dr. Gaur Johnson Dr. Samir Khanal Dr. Jason Leigh Dr. Takashi Matsui Dr. Roberto Mendez

Rick Mills Dr. Anupam Misra Dr. Craig E Nelson Dr. Ho Leung Ng Dr. Melissa R Price Dr. Sladjana Prisic Dr. Andy Reilly Dr. Karen Selph Dr. Wei-Wen Su Dr. Florence Thomas Michael B Thomas Dr. Rob Toonen Monika Ward Dr. W Steven Ward Dr. Thomas Yee Dr. Masato Yoshizawa

Page 58: Undergraduate Research and Creative Work€¦ · Hitler’s “Final Solution” * next to name in schedule indicates student is also presenting a poster . 5 Oral Presentations Session

The Honors Program provides opportunities for talented and motivatedundergraduates to excel in their academic studies. Students complete achallengingenquiry-basedcurriculumthatencourages independent researchandcreativeexpression.Theyenjoyintimateandpersonalizededucationalexperienceswithin the settingof a large researchuniversity through small classes,dedicatedadvising, peer mentorship and faculty-guided projects. The Honors Programpromotescriticalthinkingandoral,writtenandaudio-visualcommunicationskills;respectfordiversityandcommitmenttosocialjustice;andcivicparticipationandcapacityforleadership.Itfostersamongitsstudentsandfacultyasenseofidentityand a joy in scholarship, which it communicates to the university and thecommunity.manoa.hawaii.edu/undergrad/honors/

TheUndergraduateResearchOpportunitiesProgram(UROP)wasformed in2011with generous support fromUHMānoa Chancellor Virginia Hinshawto promoteandfosterundergraduateresearchinitiativesatUHMānoabyofferingfundingforundergraduate research projects and providing access to on- and off-campusresearchopportunities.

manoa.hawaii.edu/undergrad/urop/