Embed Size (px)
DESCRIPTION
Â
Citation preview
1934194
CALL FOR CHANGETakoma Park wants Metro project design reworked. A-3
SILVER SPRING | TAKOMA PARK | WHEATON | BURTONSVILLENEWS: Gov. Hogan namescounty GOP chairman toPSC post. A-5
TheGazetteWednesday, February 25, 2015 25 centsDA ILY UPDATES AT GAZETTE .NET
SPORTS: Blake basketballcomes on strong late in theseason. B-1
Automotive B-12Calendar A-2Classified B-8Entertainment A-12Opinion A-11Sports B-1
PleaseRECYCLE
Volume 28, No. 6,Two sections, 28 PagesCopyright © 2015The Gazette
INDEX
SEE HOME IMPROVEMENT SERVICES INSIDEADVERTISING INSIDE A SECTION
WINTERIZE YOURWINTERIZE YOURHOMEHOME
n Washington AdventistUniversity hopes to startconstruction next year
BY KEVIN JAMES SHAY
STAFFWRITER
WhileWashingtonAdventistHospital makes plans to reduceits presence in Takoma Park,Washington Adventist Univer-sity, near the medical center, isheading in the opposite direc-tion.
The four-year private col-lege, part of the Seventh-dayAdventist Church’s higher edu-cation system, hopes to startconstruction in the late spring
of 2016 on a 50,000-square-footcenter for health professions,science andwellness programs.
The project, expected tocost about $10 million, will in-volve renovating and expandingthe existing health professionsbuilding. Besides the univer-sity’s health professions and sci-ence classes, there also will becommunity programs in nu-tritional cooking, exercise andother wellness activities.
“The center will offer excit-ing and endless possibilities forthis university, as we find newways to enhance the educationof our students in thehealth andscience professions, promote
Takoma Parkcollege expands
PHOTO FROM WASHINGTON ADVENTIST UNIVERSITY
Washington Adventist University plans to expand and renovate its healthprofessions building on the Takoma Park campus. This is a rendering of howthe new 50,000-square-foot center would look.
BY KEVIN JAMES SHAYSTAFFWRITER
In the past few months,students from Barrie Schoolin northern Silver Spring havereceived, among their regularclassroom activities, a hands-on civics lesson.
Last fall, many studentsat the private school joinedan ongoing community cam-paign for a traffic signal infront of their campus on Lay-hill Road at Barrie CampusDrive/Poplar RunDrive.
On Thursday, officialswith the Maryland StateHighway Administration andWinchester Homes met withstudents, campus leaders andothers to confirm that the traf-fic light has been approvedand is targeted to be opera-tional this summer.
Students said the light issorely needed, as the num-ber of traffic accidents at theintersection has increased in
recent years.“We have learned a lot
about traffic,” said Tess Need-ham, a Barrie freshman.
Therehavebeenanumberof stakeholders in the process,and the students played animportant role in the success-ful campaign, said CharlieAbelmann, Barrie’s head ofschool.
“This shows them theirvoicesmatter,” he said.
Winchester is buildingmore than 700 single-familyhomes and townhouses inthe Poplar Run communityjust across Layhill Road fromthe school, on the site of theformer Indian Springs Coun-try Club. The Bethesda-basedhomebuilder is responsible forpaying for the signal.
A preliminary cost es-timate for the project is$225,000, said Michael P.Lemon, director of land devel-opment forWinchester.
The state is targeting a
June completion date, but itcould be later, said AnyeshaMookherjee, an assistant dis-trict engineer with the SHA.“There could be delays due toweather or other factors,” shesaid.
Usually, after a traffic sig-nal is approved, it takes a yearto be planned, designed andconstructed, saidMike Ulrich,a traffic engineer with TrafficConcepts who is working ontheproject forWinchester andformerly worked for the SHA.“This is an impressive time-line,” he said.
School officials, parentsand groups such as the Pop-lar Run Homeowners Asso-ciation have lobbied for thetraffic signal for several years.The growth of the Poplar Runsubdivision and opening ofthe Intercounty Connectortollway have contributed to asubstantial increase in traffic
Barrie students shine lighton traffic signal
BILL RYAN/THE GAZETTE
(From left) Barrie School ninth-graders Colleen Cooper, Zoe Adam and Tess Needham made a video presenta-tion on Feb. 19 asking for a traffic light at the intersection of Barrie Campus, Popular Run Drive and LayhillRoad.
n Owners to retaindowntown location whereshop has been since 1996
BY KEVIN JAMES SHAYSTAFFWRITER
A longtime downtown SilverSpring café has agreed to open asmall retail outlet inside thenewSilver Spring Library.
LeneTsegaye,who runsKefaCafé with her sister, Abeba, saidthey signed a contract with thecounty on Friday. The spacewillbe more of a kiosk, and detailsonwhat exactly the shopwill selland provide are being workedout, she said.
“We will still keep our regu-lar café,” Tsegaye said of theBonifant Street location. “Weexpect to hire some more em-ployees, at least two people.”
Montgomery County Coun-cilman Tom Hucker (D-Dist. 5)of Silver Spring said he has beena customer of Kefa Café frompractically the day it opened in1996.
“I’m a big fan,” Hucker said.“They aremuchmore than youraverage coffee shop.”
Kefa Caféworks hard to pro-vide a real community environ-ment, such as providing spacefor local artists to exhibit workand hold events, Tsegaye said.The owners consider every cus-tomer to be a part owner, shesaid.
“There is no way we couldhave [remained in businessalmost two decades] by our-selves,” Tsegaye said. “We con-gratulate everyone who comeshere and supports us.”
In November, Pyramid At-lanticArtCenterdecidedagainstmoving into the new library,
Caféplans toopen inlibrary
A hands-on civics lesson
n State: Bidderswanted more time
BY KATHERINE SHAVER
THEWASHINGTON POST
Maryland transportation officials havepushed back by five months a major biddeadline for private companies seekingto build and operate the Purple Line, say-ing the firms requested more time to findcheaper ways to do the $2.45 billion light-rail project linking Bethesda and New Car-rollton.
The March 12 deadline has beenpushed back to Aug. 19, said Erin Henson,
a spokeswoman for the Maryland Depart-ment of Transportation. She said stateofficials notified the four bidders Fridayevening.
Henson said it was too soon to knowwhether the change will affect the private-public partnershipproject’s schedule. Statetransit officials have said theyhope tobeginconstruction on the 16-mile line this yearand open it in 2020.
Montgomery County CouncilmanTom Hucker (D-Dist. 5) of Silver SpringsaidMonday that the delay raises a “poten-tial concern” with a project that has suchstrong economic development opportuni-ties in Montgomery and Prince George’scounties. Itwasunclear exactlywhat ismo-
tivating the holdup, he said.“We don’t want to see any unnecessary
delays,” Hucker said.A group of Purple Line proponents,
the Action Committee for Transit, said ina statement that it is “deeply disappointedby Friday evening’s announcement of a5-month delay in awarding the contract forthe Purple Line.”
The delay could jeopardize private andfederal funding for the project, the groupsaid.
“Maryland cannot afford to leave 900million federal dollars on the table. ThePurple Line will provide relief to commut-
Purple Line bid date bumped five months
n Leggett’s budgetcounted on funding;
projects might have to wait
BY LINDSAY A. POWERSSTAFFWRITER
Montgomery County couldface difficult decisions if thestate doesn’t help fulfill theschool district’s funding requestfor capital projects, officials saidMonday.
Montgomery County Ex-ecutive Isiah Leggett has recom-mended approving the countyschool board’s requested $1.74billionfiscal 2015-20Capital Im-provements Program. Leggett’srecommendation banks onthe success of a state bill to di-rect more school constructionmoney to the county.
The county wants to securean added stream of state aidwithin the six-year capital pro-gram time frame, said countyspokesman Patrick Lacefield.There’s “no alternative” to thecontinued efforts to get addi-tional revenue, he said.
AmeetingMonday betweenschool officials and the CountyCouncil’s Education Com-mittee was part of an ongoingpush for more state funding.County leaders want Marylandlegislators to ramp up schoolconstruction dollars to sup-port Montgomery projects thatwould add space amid risingenrollment and repair agingbuildings.
County Councilman CraigL. Rice emphasized on Monday
Montgomerycontinues pleafor school aid
DIFFERENT WAYTO SHAKESPEAREFamed Folger Consortbrings “Merchant ofVenice” to Strathmore.
B-3
A&E
See AID, Page A-10
See COLLEGE, Page A-10See CAFE, Page A-10 See SIGNAL, Page A-10
See BID, Page A-10
1932101
www.CapitalAutoAuction.com
BUY BELOW KBB VALUE
RAIN OR SHINE!
WE HAVE VEHICLES FOR EVERY BUDGET AND NEED!
OPEN TO PUBLIC • ALL DEALERS WELCOME
Temple Hills, MD5001 Beech Road
Live/Drive Auction TimeSaturdays 9:00a.m.
Washington, DC1905 Brentwood Road
Live/Drive Auction TimeSaturdays 10:00a.m.
AUCTIONS EVERY SATURDAY
Call 301-640-5987or email [email protected]
1931304
Since 1989
1931316
WEDNESDAY, FEB. 25No More Morning Mayhem, 7:30-9:30
p.m., Parent Encouragement Program,10100 Connecticut Ave., Kensington. Forparents of children 4-12. $33. 301-929-8824.
THURSDAY, FEB. 26Thursday Morning Book Discussion,
10:30 a.m.,Marilyn J. Praisner Library,14910 Old Columbia Pike, Burtonsville.The selection for February is “A Common-wealth of Thieves” by Thomas Keneally.240-773-9455.
New Year, New You: Food, Fitness andFinances, 6-8 p.m., Argyle Country Club,14600 Argyle Club Road, Silver Spring.Stay on track with resolutions and learnhow to stick to a budget. Free. [email protected].
The Visual Made Verbal, 7:30 p.m.,Takoma Park Community Center, 7500Maple Ave., Takoma Park. Joel Snyderuses video and dialogue to lead the audi-ence in a discovery of how performance,film and visual displays aremade acces-sible for growing audiences of people whoare blind or have low vision, using audiodescription. 301-891-7266.
FRIDAY, FEB. 27Microsoft Excel Class, 11 a.m.-noon,
Marilyn J. Praisner Community Recre-ation Center, 14906 Old Columbia Pike,Burtonsville. Learn how to create and usespreadsheets, including creating formulas.Free, registration required. 240-773-9460.
International Night, 5-9 p.m.,Whea-tonHigh School, 12601DalewoodDrive,Silver Spring. There will be various foods,vendors and art demonstrations from 5 to7 p.m. and cultural performances at 7:30p.m. Proceeds will go to student scholar-ships. $6 per person; children 5 and underare free. 301-929-2050.
Cantor-in Residence Weekend, 5:30-8p.m., Har Tzeon Agudath Achim, 1840University Blvd.West, Silver Spring. Kab-balat Shabbat followed by a Friday nightcommunal dinner and presentation: “ThePower ofMusic to Teach Language” byCantor Joel Lichterman. $25 for adults, $15for ages 5-13, free for children less than5 years old. $75max per family. 301-649-3800.
Temple Emanuel’s Shabbat University,6:30 p.m., 10101 Connecticut Ave., Kens-ington. Rabbi Stonewill speak about thethemes andmotifs of the ancient texts andapply them to the contemporary world.
Cantor Boxt will share a song from the textfor each Shabbat. Free. 301-942-2000.
Film Screening: The Symbol of theUnconquered, 7:15 p.m., AFI Silver Theatreand Cultural Center, 8633 Colesville Road,Silver Spring. A silent film by pioneeringblack filmmaker OscarMicheaux, featur-ing livemusical accompaniment by freejazz kingpinWilliamHooker. $12-$15.301-495-6720.
SATURDAY, FEB. 28Cantor-in Residence Weekend, 9 a.m.,
Har Tzeon-Agudath Achim, 1840Uni-versity Blvd.West, Silver Spring. Shabbatmorning services with song and sermonby Cantor Lichterman, “Shoot-out at HighKedushah” followed by an extra specialkiddush-luncheon. Free. 301-649-3800.
“Body and Soul” Film Screening, 3p.m., AFI Silver Theatre and Cultural Cen-ter, 8633 Colesville Road, Silver Spring.A second silent film by pioneering blackfilmmaker OscarMicheaux, featuringlivemusical accompaniment by free jazzkingpinWilliamHooker. $12-$15. 301-495-6720.
Origins Concert Series, 8 p.m., Churchof the Ascension, 633 Sligo Ave., SilverSpring. Featuring the world premiere ofLadies Slippers for flute, harp and viola; apremiere of a new version of Harbor Bellsfor voice and bowl gongs; andWomeninMeeting for two flutes, among otherpieces. $5-$10. 301-608-9637.
Greek Get-Out, Old Skool Party, 8p.m.-midnight, Knights of ColumbusHall,9707 Rosenstell Ave., Silver Spring. NPHC-MC in the Past, Present and Future. [email protected].
SUNDAY, MARCH 1Shrimp and Oyster Feast, 1-5 p.m.,
Wheaton Volunteer Rescue Squad, 2400Arcola Ave., Wheaton. Proceeds benefitWheaton Volunteer Rescue Squad. Ticketprice includes raw shucked oysters, friedoysters, steamed shrimp, ham, sides, softdrinks and beer. $45 per ticket; $20 chil-dren 12 and younger. 240-424-5188.
Prelude to Spring Concert, 3-5:45p.m., Calvary Lutheran Church, 9545Georgia Ave., Silver Spring. Presented bytheWashington Piano Society. Featuringsolo and chamber works by Beethoven,Chopin and Schumann. Free-will offeringis appreciated. 301-793-1863.
Azalea City CD Release Concert, 7p.m., Takoma Park Community Center,7500Maple Ave., Takoma Park. Hear somelocalmusicians fromAzalea City Record-
ings, a local record label cooperative,including Jesse Palidofsky, Karen Collins,Ruthie Logsdon and JoeUehlein. 301-891-7266.
MONDAY, MARCH 2American Red Cross Blood Drive,
2:30-8 p.m., Liberty GroveUnitedMeth-odist Church, 15225 Old Columbia Pike,Burtonsville. Hosted by the Lions Club ofBurtonsville. Walk-ins accepted based onavailability. 800-733-2767.
TUESDAY, MARCH 3The Basics: Memory Loss, Dementia
and Alzheimer’s Disease, noon-2 p.m.,Gwendolyn Coffield Community Center,2450 Lyttonsville Road, Silver Spring. Foranyonewhowould like to knowmoreabout Alzheimer’s disease and related de-mentias. 800-272-3900.
Need Help with E-Books?, 1-3 p.m.,Marilyn J. Praisner Library, 14910 OldColumbia Pike, Burtonsville. A trainingsession to learn how to use e-books ona Kindle, Nook, iPad or other electronicdevice. Free. [email protected].
Hands-On STEM Fun!, 4 p.m.,WheatonLibrary, 11701 Georgia Ave., Wheaton.Come learn and playwith drop-in science-based crafts and/or experiments. Grades1-6. 240-777-0678.
WEDNESDAY, MARCH 4Senior Connection Volunteer Open
House, 9:30-11 a.m., Holiday Park SeniorCenter, 3950 Ferrara Drive, Silver Spring.Learn about flexible volunteering op-portunities including driving seniors tomedical appointments and helping withgrocery shopping. 301-942-1049.
THE GAZETTEPage A-2 Wednesday, February 25, 2015 s
BestBet
Empowering Youthto Have Positive In-teractions With LawEnforcement Officials,10 a.m.-12:30 p.m.,Clifton Park Baptist
Church, 8818 Piney Branch Road,Silver Spring. Community work-shops focusing on empoweringyoung people and their familiestomake good decisions and havepositive interactions with law en-forcement officials. Participantswill include legal advocates, lawenforcement officials, and othercommunity leaders. Free. [email protected].
SAT
28
EVENTSSend items at least two weeks in advance of the paper in which you would like them toappear. Go to calendar.gazette.net and click on the submit button.Questions? Call 301-670-2070.
MORE INTERACTIVE CALENDARITEMS AT WWW.GAZETTE.NET
PHOTO GALLERYChurchill’s Elaina Faerber competes in the girls state diving finals at theUniversity of Maryland, College Park, on Friday. Go to clicked.Gazette.net.
SPORTS Girls and boys basketball playoffs are scheduled to tip off on Friday.Check online for coverage.
GAZETTE CONTACTSThe Gazette – 9030 Comprint Court
Gaithersburg,MD 20877Main phone: 301-948-3120 Circulation: 301-670-7350
Andy Schotz,managing editor, Silver Spring : [email protected], 240-864-1531Kevin James Shay, staff writer: [email protected], 301-670-2033
Get complete, currentweather information
at NBCWashington.com
The Gazette (ISSN 1077-5641) is publishedweekly for $29.99 a year byThe Gazette, 9030Comprint Court, Gaithersburg,MD 20877. Periodicals postage paid at Gaithersburg,Md.Postmaster: Send address changes. VOL. 28, NO. 6 • 2 SECTIONS, 28 PAGES
In a Feb. 11 letter to the editor,Montgomery County CouncilmanCraig L. Ricewrote that Neville Levi has been “a resident of Montgomery Village for 16 years.”However, Levi said on Monday that he has owned property in Montgomery Vil-lage for 17 years, but hasn’t lived there since 2013. Members of the MontgomeryVillage Foundation Board — for which Levi is a candidate — must either live inMontgomeryVillageorownproperty there.Rice saidhe reliedon information fromLevi for his letter.
CORRECTION
THE GAZETTEWednesday, February 25, 2015 s Page A-3
Blake student in theatricalshow at StrathmoreAdalia Jiminez of Blake
High School in Silver Springwill be featured next month ina theatrical production at TheMusic Center at Strathmore inNorth Bethesda.
Jiminez and Hailey Gid-dings of Our Lady of GoodCounsel High School in Olneywill be part of “West Side Story+ Roméo et Juliette,” a com-bination of theater and opera,according to a press releasefrom Young Artists of Americaat Strathmore, a nonprofit or-ganization.
The production is a col-laboration with the MarylandClassic Youth Orchestra andis directed by Rick Davis ofGeorge Mason University, thepress release says.
The performance will beMarch 8 at 4 p.m. Tickets areavailable for $28 to $42 at ti-nyurl.com/p7x4fdm.
Board will hostsuperintendent meetings
The Montgomery CountyBoard of Education has sched-uled four community meetingsabout its search for the next su-perintendent.
Two meetings will be held 7to 9 p.m. March 4. They will be atEastern Middle School, 300 Uni-versity Blvd. East, Silver Spring,and at Walter Johnson High
School, 6400 Rock Spring Drive,Bethesda.
Two meetings will be held 7to 9 p.m. March 5. They will beat Gaithersburg High School,101 Education Blvd., Gaithers-burg, and at Paint Branch HighSchool, 14121 Old ColumbiaPike, Burtonsville.
Child-care services will beprovided. Language translationalso is available by calling 301-517-5539 by Feb. 27.
The school board has hiredHazard, Young, Attea & Associ-ates to help with the search.
Joshua P. Starr’s last day assuperintendent was Feb. 16.Larry Bowers is the interim su-perintendent.
Two from Silver Spring onW.Va. Wesleyan dean’s list
Silver Spring residents Da-vid Smith and Andrew Fleminghave been named to the Fall2014 dean’s list at West VirginiaWesleyan College.
Students must have a grade-point average of at least 3.5 toqualify.
Silver Spring womanhas new book
A new book called “NextGeneration: Know Before YouGrow” was written by NickuKyungu Mordi of Silver Spring.
The book, from Tate Pub-lishing and Enterprises, is de-
scribed in a press release as“the ultimate manual for everyyoung boy and girl who desiresto become greater in life,” us-ing strong principles and mor-als.
It is available throughbarnesandnoble.com and am-azon.com.
Mordi is the president andfounder of International Gos-pel Outreach Ministries Inc.
Her other books include“Never Forgotten” and “NextGeneration: Do You Know WhoYou Are?”
‘Unseen Beauty’photos on display
A photo exhibit in Laurel isshowcasing the work of home-less people and senior citizensin Silver Spring and TakomaPark.
The exhibit is called “Un-seen Beauty — Seeing Throughthe Eyes of the Unseen.”
A group called Art for thePeople purchased disposablecameras, frames and other ma-terials and helped print photosand create the exhibit.
The photos are on displaythrough March 15 at Him-melfarb Gallery at the Mary-land University of IntegrativeHealth, 7750 Montpelier Road,Laurel.
The gallery is open 8 a.m. to7 p.m. weekdays and 8 a.m. to 4p.m. on the weekend.
PEOPLEMore online at www.gazette.net
n Many residents stillconcerned over buildingheight, green space
BY KEVIN JAMES SHAYSTAFF WRITER
The Takoma Park CityCouncil agreed Monday to aska developer to further amendits project near the TakomaMetro station.
The council unanimouslypassed a resolution asking forchanges in the design to ad-dress building height, greenspace and other issues.
EYA and the WashingtonMetropolitan Area Transit Au-thority have sought to buildaround the station for morethan a decade.
EYA recently revised its siteplan. Its changes include:
• Moving the pedestrian en-trance to the proposed apart-ment complex to the sidewalkfacing the bus loop and openspace area.
• Allowing for a 10-foot-wide bike trail and five-foot-wide sidewalk in the greenspace area between the pro-posed building and EasternAvenue.
• Reducing the entry driveto the residential dropoff areato two lanes.
Many residents are stillconcerned about the proposedbuilding height, green spaceand other issues. The devel-opers plan about 200 apart-ment units, walking and bikingpathways and alterations to thedropoff lot.
Sabrina Eaton, who liveson Eastern Avenue in TakomaPark, told the council on Mon-day that the proposed devel-opment in Washington, D.C.,will affect a lot of people onthe Maryland side. She askedthat the developer reduce theproposed building height andprovide more buffer space.
“Hopefully, we can getsomething everyone will behappy with,” Eaton said.
Thecouncil’s resolutionsaysEYA’s current building design“far exceeds” the 40-foot maxi-mumbuildingheightallowedbyzoning on land fronting EasternAvenue and the 50-foot maxi-mum building height allowedby zoning on land closer to therailroad right of way.
“While a Planned Unit De-velopment process could allowdeviation from current zoning,neighborhood compatibil-ity suggests that the buildingheight should comply withzoning limits,” the resolutionsays.
The 30-foot-wide woodedgreen space northwest of thebuilding site is “only a modestbuffer between the station’sand residential building’s ser-vice lanes and the adjacentproperty,” the resolution says.
Councilman Seth Grimessaid EYA’s recent design wasbetter, but it still needs im-provements.
Some council membersquestioned whether it might bemore effective to write a letterdirectly to WMATA and EYA,rather than pass a resolution,before the resolution passed7-0.
“It’s good advice to thinkabout [a letter] in the future,”said Mayor Bruce Williams.
WMATA is taking publiccomments on its recently re-leased report about the publichearing last June through nextMonday. The Metro board hasapproved executing an agree-ment with EYA, but still hasto vote on certain documents,such as the public hearing re-port. The issue also is expectedto go before the D.C. ZoningCommission.
At one time, EYA wanted tobuild townhomes on the site,but changed that plan to apart-ment units following neighbor-hood opposition and the GreatRecession.
Takoma Park urges revisionon design of Metro project
EYA
Developer EYA is proposing to build about 200 apartment units at theTakoma Metro station.
BY GAZETTE STAFF
Montgomery County po-lice said they are investigating aColesville man’s death as a ho-micide.
Dan Belvin, 95, was founddead at his home in the 500block of Randolph Road at about12:30 p.m. Monday, police said
in a news release. Police areconsidering his death to be sus-picious.
Police said Belvin was aretired naval officer. He hadtrauma on his upper body, thepress release said.
Police said a friend wasconcerned about not hearingfrom Belvin. A building property
manager checked his apartmentand found him dead, police said.
Police have asked anyonewith information about Belvin’sdeath to call the Major CrimesDivision at 240-777-5070. Call-ers can remain anonymous ifthey contact Crimes Solvers ofMontgomery County at 866-411-8477.
Police investigate Colesville man’s death
1932983
1931322
1934196
INJURED?
We Can Help!
Personal Injury Law FirmSince 1966
Every injury claimdeserves aggressiverepresentation. Call nowfor a free consultationwith our Attorneys.No fee until we recovermoney for you.
(240) 704-9000www.williamslawgroup.com
Located in Silver Spring on the corner ofFenton and Cameron Streets
1932944
1931974
1934087
T H E G A Z E T T EPage A-4 Wednesday, February 25, 2015 s
n Former chief operatingofficer to lead district
through June
BY LINDSAY A. POWERSSTAFFWRITER
On Larry Bowers’ first dayas Montgomery County PublicSchools’ interim superintendenton Feb. 17, the school systemclosed for a snowday.On his second day, however,
his new job heated up. Bowerswas in Annapolis with schoolboard President Patricia O’Neill,Montgomery County ExecutiveIsiah Leggett and county PTAleaders, testifying on a bill to di-rect more state school construc-tionmoney toMontgomery.Bowers was picked to tem-
porarily lead the district afterJoshua P. Starr resigned as su-perintendent Feb. 16.Starr and the board agreed
that he would leave severalmonths short of what wouldhave been the end of his four-year term, but didn’t give areason for his quick departure.O’Neill said at aFeb. 3newscon-ference that the board was look-
ing for a new person to carry outits vision.The school board recently
picked the firm Hazard, Young,Attea & Associates to help findStarr’s permanent successor.The school district is hold-
ing four community meetingsto help its search. Two will beMarch 4 in Silver Spring andBethesda.Twowill beMarch5 inGaithersburg and Burtonsville.Asked by the board to fill the
superintendent shoeswhile it se-cures a new leader, Bowers saidhe agreed, but he isn’t looking tostaybeyond June.Heplans to re-tire June 30 after about 37 yearsin the district.Bowers was making about
$205,000 as the district’s chiefoperating officer, according toDana Tofig, a school systemspokesman. Tofig wrote in anemail that Bowers’ salary waslikely to increase and had notbeen finalized as of Tuesday.Starr’s salary was about
$264,000.Bowers said he had planned
on “winding down” and helpingthe next COO, Andrew Zucker-man, move into the position.Then the school board made its
request.“It wasn’t quite what I was
expecting,” he said.Bowers said the board ex-
pects him to “keep everythingmoving forward at the appropri-ate pace.”Heandotherdistrict officials
will continue to tell schoolswhattheexpectationsareandhowthedistrict will support the schools.“I’m going to do everything
I can to communicate that mes-sage, let everybody know theexpectations haven’t changed,”he said.Bowers saidhedoesn’t know
yetwhether hewill propose any-thing new or different to theschool board. There is plenty ofother work to keep himbusy.In the next several months,
he said,hewill helpoverseework
in early literacy, math exam per-formance and social emotionallearning.Hewill helpmonitor new ef-
forts to increase teacherdiversityandchangesaimedat improvinghow the district prevents and re-sponds to child abuse.Bowers also said he will
spend “a lot of time” on the op-erating and capital budgets.The district faces ongoing
uncertainty about how muchmoney the state and county willprovide amid gloomy fiscal out-looks at both levels.He said he will work with
boardmembers, state legislatorsand other district superinten-dents to restore expected statemoney cut underGov. LarryHo-gan’s proposed budget.It would be “a very big out-
come” if the General Assemblypassed legislation to mandatethe Geographic Cost of Educa-tion Index, he said.The index is a formula that
has provided about $132millioneach year in additional moneyto counties where the cost ofliving and education are higher.The governor currently is not re-quired to fund the index. Underthe 50percent cut to the index inHogan’sbudgetplan,Montgom-
erywould lose $17.7million.Students soon will take on
the new Partnership for Assess-ment of Readiness of Collegeand Careers tests. Bowers saiddistrict officials want to ensurethat schools understand thattests are important, but they alsoneed to focus on classroom les-sons.This school year marks the
first time the tests will be fullyimplemented in the district andaround the state. Montgomerypiloted the test last school year.O’Neill called Bowers “Mr.
MCPS” — experienced, with “adepth of knowledge.”“We felt he would be a stabi-
lizing influence right now,” shesaid.Amain expectation for Bow-
ers, she said, is to lead throughthe budget cycle.“He knows the budget in-
side and out,” she said. “That’sincredibly valuable as we navi-gate through the murky budgetwaters.”
Bowers takes reins of Montgomery County schools
MONTGOMERY COUNTY PUBLIC SCHOOLS
Interim Superintendent Larry Bowerstook over this month when JoshuaP. Starr stepped down as superin-tendent.
n County Councilconsidering how
to fill funding gap
BY LINDSAY A. POWERSSTAFFWRITER
Montgomery College mayneed to figure out how to cut $2millionoutof its fiscal 2016 capi-tal budget request.Montgomery County Execu-
tive Isiah Leggett recommendeda $52.8 million capital budgetfor Montgomery College in theupcoming fiscal year, comparedto the college’s $54.8 million re-quest.College officials met with
the Montgomery County Coun-cil’s Education Committee onMonday to discuss the college’srequested $358.8millionCapitalImprovements Program for fis-cal 2015 through 2020.County Councilman Craig
L. Rice said the college’s main-tenance projects and its renova-tionproject for theGermantowncampus’ Science and AppliedStudies Building are likely can-didates for cuts.The committee likely won’t
support the budget reduction,saidRice, the chairman, andwilltry to avoid it, but it’s too early inthe budget cycle to say how.Rice said the committee
asked college officials to comeup with possible ways to cut the
$2 million, listing projects in or-der of priority.The committee likely will
meet with college officials againin March and vote on the insti-tution’s capital program. Theprogram then moves to the fullcouncil.The reduction could affect
maintenance or small-scalerenovation projects, but it’s toosoon to tell, said college spokes-man Marcus Rosano. The col-lege is analyzing where cutscould bemade, he said.Leggett is recommending a
total of $4.3 million in cuts forfiscal years 2016 to2018,withoutspecifying any projects.Besides the $2million in fis-
cal year 2016, the college would
lose about $300,000 from itsbudget request infiscal 2017and$2million in fiscal 2018.Susan Madden, the col-
lege’s chief government rela-tions officer, said in Januarythat a “bright light” in thecounty executive’s proposal isthat it keeps the renovation ofthe college’s Science and Ap-plied Studies Building on trackand approves an escalationcost increase for the project.Under Leggett’s plan, the
college would get $2.73 millionmore for the science building infiscal 2016— $1.36 million eachfrom the county and the state.Montgomery College would
get a total of about $30.8millioninfiscal 2016 for theproject, split
between the county and state.Construction is scheduled to
begin in the next fiscal year.The college decided to push
construction costs for a newRockville student services centerfrom fiscal 2016 to fiscal 2017, ashift Leggett supported.The project will cost $50.1
million, split between thecounty and the state.Leggett’s recommended plan
for thecollege’sfiscal2016budgetalso includes appropriated fundsfor a new project aimed at reno-vating the college’s physical edu-cationbuildings.Montgomery College will
pay the $4.2 million planned forthe project next fiscal year withstudent fees,Madden said.
The college plans to reno-vate a physical educationbuilding for $2.2 million at theTakoma Park/Silver Springcampus and another physi-cal education building at theGermantown campus for $2million.The school also wants to
renovate the Rockville campusphysical education building. Allthreebuildings aremore than30years old.“They’re old, they’re out-
dated,” Madden said. “Wethought this was a good use ofstudent revenue.”
Montgomery College might need to cut $2M from budget request
“I’m going to do everything I can tocommunicate that message, let everybodyknow the expectations haven’t changed.”
Larry Bowers, MCPS interim superintendent
1932103
THE GAZETTEWednesday, February 25, 2015 s Page A-5
The following is a summary of inci-dents in the Silver Spring area towhich Montgomery County policeresponded recently. The words “ar-rested” and “charged” do not implyguilt. This information was provided bythe county.
Armed robbery• Travelodge Motel, 8040 13th
St., Silver Spring, at 10:23 p.m.Feb. 6. The subjects threatenedthe victim with a weapon and tookproperty.
• 13800 block of Castle Bou-levard, Silver Spring, at 7:23 p.m.Feb. 10. The subject threatenedthe victim with a weapon and tookproperty.
Sexual assault• 800 block of University Bou-
levard, Silver Spring, at midnightFeb. 6. The subject is known to thevictim.
• 13700 block of ModradWay,Silver Spring, at 5 p.m. Feb. 7. Thesubject is known to the victim.
• 1000 block of Harding Lane,Silver Spring, on Feb. 8 or 9. Thesubject is known to the victim.
Strong-arm robbery• Fenton Street and Colesville
Road, Silver Spring, at 3 a.m. Feb. 5.The subjects forcefully took prop-erty from the victim.
• 1700 block of FeatherwoodStreet, Silver Spring, at 4:33 a.m.Feb. 7. The subjects forcefully tookproperty from the victim.
• Near the intersection of Ur-bana Drive and Sheraton Street,Silver Spring, at 11:20 p.m. Feb. 9.The subjects assaulted the victimand took property.
Aggravated assault• 11600 block of Lockwood
Drive, Silver Spring, at 6 p.m. Feb.4. The subject is known to thevictim.
• 14000 block of Punch Street,Silver Spring, on Feb. 7. The subjectis known to the victim.
• 8500 block of Glenville Road,Silver Spring, at 1:55 a.m. Feb. 8.The subject is known to the victim.
• 1500 block of Heather Hol-low Circle, Silver Spring, at 5 a.m.Feb. 9. The subject is known to thevictim.
• 8700 block of Arliss Street, Sil-ver Spring, at 9:52 p.m. Feb. 10. Thesubject is known to the victim.
Church burglary• Faith Baptist Church, 12907
Connecticut Ave., Silver Spring,between Feb. 4 and 7. Forced entry,took property.
• Sligo Baptist Church, 1610Dennis Ave., Silver Spring, at 11:48a.m. Feb. 7.
Residential burglary• 13000 block of Overton Lane,
Silver Spring, between Jan. 25 andFeb. 7. Took property from a de-tached unlocked shed.
• 3500 block of Childress Ter-race, Silver Spring, between 11 and11:50 a.m. Feb. 2. No forced entry,took property.
• 13600 block of ColgateWay,Silver Spring, between 7:30 a.m.and 4:15 p.m. Feb. 3. Forced entry,took property.
• 13900 block of Castle Boule-vard, Silver Spring, at 2:14 p.m. Feb.3. Attempted entry, took nothing.
The subject is known to the victim.• 100 block of Fleetwood Ter-
race, Silver Spring, at 7 a.m. Feb. 4.Forced entry, took nothing.
• 600 block of Concerto Lane,Silver Spring, between 9:30 a.m.and noon Feb. 4. Attempted forcedentry, took nothing.
• 600 block of Sligo Avenue, Sil-ver Spring, at 10:30 a.m. Feb. 4. Noforced entry, took property.
• 600 block of Silver springAvenue, Silver Spring, at 11:50 a.m.Feb. 4. Forced entry, took nothing.
• 3200 block of HollyhockDrive, Silver Spring, at 11:30 p.m.Feb. 4. No forced entry, took prop-erty. The subject is known to thevictim.
• 3500 block of Sheffield ManorTerrace, Silver Spring, at 12: 12 a.m.Feb. 5. Forced entry, took nothing.
• 11000 block of Newport MillRoad, Silver Spring, at 2:50 a.m.Feb. 5. Attempted entry, took noth-ing.
• 10900 block of Jarboe Avenue,Silver Spring, at midnight Feb. 6.Attempted entry, took nothing.
• 3600 block of Castle Terrace,Silver Spring, between 7:45 a.m.and 6:15 p.m. Feb. 9. No forced en-try, took property.
• 13800 block of Castle Bou-levard, Silver Spring, at 12:26 a.m.Feb. 11. No forced entry, took noth-ing.
Vehicle larceny• Six incidents in Silver spring
on Feb. 2. Took a cellphone, tools,a purse, a vehicle part and otherloose items.
• Six incidents on DartmouthAvenue, Silver spring, between Feb.2 and 10. Took cellphones, cash, apurse and dog treats.
• Four incidents in SilverSpring between Feb. 2 and 10. Tookcash, a phone charger and otherpieces of electronics. Affectedstreets include Cottrell Terrace.
POLICE BLOTTERn Part of hundredsof ‘green bag’ picks
BY KATE S. ALEXANDERSTAFFWRITER
Montgomery County Re-publican Central CommitteeChairman Michael L. Higgs Jr.hasbeenappointed to theMary-land Public Service Commissionby Gov. Larry Hogan, pendingSenate confirmation.
Higgs—anattorney special-izing in telecommunications,entertainment and sports lawwith the Potomac law firm ofShulman Rogers — would re-place Commissioner LawrenceBrenner, whose term expiresJune 30, PSC spokeswoman Re-gina L. Davis said. Commission-ers servefive-year terms.
“I’m thrilled with the trustthat the governor has placed inme and I look forward to serving
thepeople ofMarylandonce I’mconfirmed,” Higgs said Friday.Hedeclinedtospeak inmorede-tail about the appointment untilhe’s confirmed.
Maryland’s Public ServiceCommission regulates publicutilities in the state, as well astelecommunicationsandcertain
transportation services.Itsoperationshavedrawnat-
tention in Montgomery Countythroughtheratecasesandpend-ing acquisition of the local elec-tric utility, Pepco, as well as the2012 derecho that knocked outpower to the region for abouteightdays.
Higgs’ appointmentwasoneof331“greenbag”appointmentsmadebyHoganonFriday.
By tradition, the “green bag”is a satchel the governor’s officeusesoncea year todelivernomi-nations to the Senate for its ap-proval.
Hogan (R) also appointedJim Shalleck, a former Republi-can candidate for MontgomeryCounty executive, to the Mont-gomery County Board of Elec-tions, along with Alexander C.Vincent and current membersNahid Khozeimeh, Jacqueline L.Phillips, David A. Naimon, Gra-ciela Rivera-Oven andMary AnnKeeffe, theboard’s president.
County GOP chairman named to PSC
2013 FILE PHOTO
Michael L. Higgs Jr. has been appointed to the Maryland Public ServiceCommission.
n Police say victim,a D.C. woman, was
standing near bus stop
BY VIRGINIA TERHUNESTAFFWRITER
A pedes trian was killedwhile standing near a bus stopin White Oak on Feb. 18 aftershe was hit by a vehicle drivenby aSilver Springman, authori-ties said.
The victim was VanessaDixon, 49, of Ingraham StreetinWashington, D.C., accordingto police.
Police identified the driverof the vehicle as David Rodri-guez, 22, of Cannon Road inSilver Spring.
Montgomery Police Capt.John Starks, a departmentspokesman, saidFeb. 19 thatnocharges had been filed againstRodriguez. An investigation isstill underway, he said.
Fire & Rescue personnel
responded at about 11:17 a.m.to the crash in the 1000 blockof Cresthaven Drive and tookDixon to a nearby hospital,where she died.
Witnesses reported a 2005red Nissan X-Terra moving er-ratically on New HampshireAvenue and on CresthavenDrive, police said in a postingon the department’s website,mymcpnews.com.
The vehicle crossed to theleft side of Cresthaven Drive,hitting the victim, according to
preliminary reports to policefromwitnesses.
TheNissanX-Terra thenhita black 1999 Buick Park Avenueparked on the street and a 2010gold Ford Fusion in a driveway,according to police.
Police have asked anyonewith information about thefatal crash to contact the Col-lision Reconstruction Unit at240-773-6620. Callers may re-main anonymous.
Pedestrian killed in White Oak car crash
See list of Montgomeryappointments online.
n Gazette.net
1934202
1934101
TMT A/C & HEATING
24/7 EMERGENCY SERVICE*All Brands Available
*Free Estimates!
Cell: 240-423-3274Office: 301-933-1526
• 20% Off Repairs• 30% Off Replacement& Installation
• 40% Off Air Duct Cleaning• Check Up or Cleaning SpecialONLY $49.99
• HVAC Contractors & CustomDuct Work
1932076
THE GAZETTEPage A-6 Wednesday, February 25, 2015 s
n Pay increases wouldtake effect July 1
BY BILL TURQUE
THEWASHINGTON POST
Montgomery County’s7,600 unionized police, careerfirefighters and other countyemployees would receive payincreases of up to 5.5 percentthis year under new laboragreements announced Thurs-day.
The total cost of the one-year financial package, sub-ject to final approval by theCounty Council, is estimatedat $25 million. The pay boostswould take effect July 1, thebeginning of fiscal 2016. Theyinclude a 2 percent wage hike
and 3.5 percent longevity in-creases for many employees.
The increases are moremodest than those negotiatedin 2013, when most unionmembers received hikes inwages and longevity pay of6.75 to 9.75 percent annuallyover two years. Those boostsincluded retroactive “catch-up” payments after wages hadbeen frozen for three yearsduring the recession. The an-nual cost was about $32 mil-lion.
County Executive IsiahLeggett said the relativelymodest new pacts reflectchallenges posed by cuts instate funding, a sluggish re-gional economic recovery andpotentially tens of millions ofdollars in payments under atax case pending before the
U.S. Supreme Court.“It’s the reality and the
uncertainty we face,” saidLeggett, who has said he maypropose a significant prop-erty tax increase as part of the2016 budget he will send to thecouncil next month. “Whenyou look at it, I thought it wasthe most reasonable range wecould afford to go to.”
Presidents of the threeunions who came to termswith the county — Jeff Buddleof the International Asso-ciation of Fire Fighters Local1664, Torrie Cooke of the Fra-ternal Order of Police Lodge 35and Gino Renne of the UnitedFood and Commercial Work-ers Local 1994, Municipaland County Government Em-ployees Organization — didnot return calls for comment
Thursday.The agreement with Local
1994 was signed by the countyJan. 30. Accords with the othertwo unions were completedlate last year.
Leggett says his approachto collective-bargaining strat-egy has historically been lim-ited by the unions’ right toseek binding arbitration ifthey think talks have reachedan impasse. Leggett has losta series of court challenges toarbitrators’ decisions, whichtend to be favorable to theunion side.
It means, Leggett said, thatthe county will make someconcessions in an effort tosteer clear of possibly more-costly arbitrated agreements.
Under the pact with Local1994, for example, about 440
sheriff’s deputies and correc-tions officers could enter theDROP (Deferred RetirementOption Plan), which allowsretiring employees to work forup to three additional yearsafter they start collecting theirmonthly pension payments.The pension money goes intoa special account that accruesat a certain interest rate.
The program had previ-ously been open only to policeand career firefighters. Add-ing deputies and correctionsofficers will cost an estimated$375,000 more a year, countyofficials said.
All three unions will beginto negotiate new three-yearcontracts with the county thisfall.
Council President GeorgeL. Leventhal (D-At Large) said
it was difficult to ascertainwhether the new financialagreements are affordablewithout seeing new revenueforecasts, which are expectedin the next few weeks. It alsodepends, he said, on the restof Leggett’s proposed budgetand whether he will include aproperty tax increase that ex-ceeds charter limits.
Leventhal said, as he hasbefore, that a budget break-ing the charter cap is unlikelyto receive the required unani-mous approval by the nine-member council.
“It is my strong belief thatyou would not get nine votesin favor of exceeding the char-ter limit,” he said.
Montgomery, employee unions negotiate new contracts
n Johnson has heldposition since 2009
BY KATHERINE SHAVERTHEWASHINGTON POST
Jerry N. Johnson, general manager of theWashington Suburban Sanitary Commission,said Thursday that he plans to retire from theMarylandwater and sewerutility in June.
Johnson,67,hasservedastheutility’schieffor 5 1/2 years, overseeing services fornearly 2million people in Prince George’s andMont-gomery counties.
Asked why he’s retiring now, Johnsonlaughed and said: “I’ve been working all mylife. It’s just time.”
When Johnson took over the job in 2009,the WSSC was experiencing record numbersof brokenwatermains, including one that re-quiredmotorists tobe rescued fromaflooded
RiverRoad inBethesda in2007.Johnson’s tenure included increasing the
amount of aging water mains replaced an-nually from six miles to 55 miles, examiningnew ways to finance expensive constructionprojects, maintaining the agency’s AAA-bondrating and enacting a newMinority BusinessEnterprise program, WSSC officials said. Theutility also began using solar power and hasbeen working on a plan to charge customersadditional flat fees to level out the trajectoryof future rate increases. Like other water utili-ties, theWSSChasstruggledwithitsuse-basedrevenueaswaterconservationmeasures,suchas low-flow toilets and shower heads, havekicked in.
“We’re looking strategically at the organi-zationandwhereweneed togo in the future,”Johnson said. “That’s abig change.”
Johnson has told theWSSC’s six-memberboardof commissioners thatheplans to retirewhenhis contract expires at theendof June.A
WSSC spokesman said the utilitywill conductanationwide search forhis replacement.
TheWSSChas1,600employeesanda$1.3billionannual budget.
Johnson previously served 12 years asgeneral manager at D.C. Water, which wasthen called theD.C.Water and Sewer Author-ity (WASA), includingwhenhigh levels of leadwere found in the city’s tapwater.
JohnsoncametopersonifyWASA’s failureto alert customers to the lead risk in tap wa-ter from 2001 to 2004. Most District residentslearned that the lead levels were dangerouslyhigh inaWashingtonPost article in 2004.
Johnsonsaidheplans to spendmore timewith his family, including his wife, Laverne, aretired teacher.
He said he has considered retiring severaltimes before. “I didn’t quite get out the door,”hesaid. “This time, I’mactuallygoing todo it.”
WSSC chief announces his retirement
1931982
Date: March 12, 2015Time: 11:00am - 3:30pmLocation:Lakewood Country Club,13901 Glen Mill Road,Rockville, MD 20850Cost: $59 Non-members
$49 Members
Display Tables Available
Contact: Carol [email protected] 301-529-9948
More Information:Upcoming Events atwww.ewomenNetwork.com/chapter/montgomery
1934208
Tax Guide 2015
TAX SEASONHAS ARRIVED!!!
Place YourAdvertisement Today!
Call: 301-670-7100
1934109
1931893
JOHN F. KYBER, EAOffenbacher & Kyber, Inc.
[email protected] • www.offenbacher.net
Tax Consulting Accounting Services
world building - suite 803 • 8121 Georgia AvenueSilver Spring, MD 20910
phone (301) 565-3000 • fax (301) 565-9768cell (301) 928-1398
19341091934109
1932950A
ROBERT BEATSON IIAttorney/Accountant, Former IRS Attorney
Admitted to DC, MD, VA & NY Bars
www.beatsonlaw.com • 301-340-2951
All Types of Federal, State, Local & Foreign TaxesIndividual • Business • Partnerships • Trusts • Estates • Wills
Amended & Late Returns • Back TaxesIRS Audits • Business Law • Civil Litigation
19341091934109
1934100
Same Quality Tax Service, New Location!!!E-File Your Return For A Rapid Refund within 15 days!
Bonnie Costley438 N. Frederick Avenue, Suite 215
Gaithersburg, MD 20877Monday-Friday, 9am-9pmSaturdays, 9am-5pm
240-720-3540
We are officially open for business!! Come stop by!
Your taxes done timely with accuracy by aprofessional with 18 years of experience.
Coming March 25, 2015!Be sure your summer camp
or program is included.Call today 301-670-7100
or email [email protected] our online Camp Directorywww.gazette.net/section/camps
SSuummermmerSSuummermmerSummerCCamamPPCCamamPPCamP
20152015201520152015
guideguideguideguideguide
The Gazette’s
THE GAZETTEWednesday, February 25, 2015 s Page A-7
n Chef to competeon ‘Hell’s Kitchen’
BY TERRI HOGANSTAFF WRITER
Michelle “Mieka” Housercredits the truffles.
The Olney chef says her firsttaste of the exotic fungus in aFrench cooking school set heron the path that will lead to herappearance Tuesday night asa contestant on the premiereof the 14th season of “Hell’sKitchen” on Fox.
Housergrewup inOlney,be-fore her family moved to Pennsl-vania. There, she worked in afew “dumpy” restaurants, whichpiqued her interest in cooking,and led her to go to a cookingclass presented by L’Academiede Cuisine of Gaithersburg.
“It was everything I couldhave possibly wanted,” she said.“I decided then that I wanted togo to culinary school.”
Houser moved back to Ol-ney to attend the L’Academie deCuisine, which she described as“a crazy experience.”
“I had never had ‘real’ foodbefore,” she said. “When askedwhatmy favorite restaurantwas,I no idea what to say. I was just asmall-town gal.”
Houser soon was workingwith ingredients sheneverheardof.
“I had truffles for the firsttime, and that completelychanged my life,” she said.
After graduating, Houserworked at the Oval Room inWashington, D.C.
“It was the perfect place tostart,” she said. “The kitchenwas clean and in order, and ev-eryone knew what the chef’s ex-pectations were. Nothing couldgo wrong there; it was a fairy talekitchen.”
Houser then took a job at itssister restaurant, Ardeo+Bardeoin Woodley Park, also in Wash-ington.
She enjoyed new opportu-nities there, such as learning tomake and toss pizza dough, andto fillet and cook fish.
“Chefs starting out makelittle money,” she said. “Thepassion was there, but not themoney.”
With commuting costs add-ing up, she realized she couldn’tafford towork inD.C. She lookedat local places, and landed a jobat Ricciuti’s in Olney, a restau-rant she had not been to.
“Working there was a greatexperience. I started as a linecook and worked up to sous-chef,” Houser said.
After a break from work totend to family responsibilities,she was approached by KyleBissett, a friend and former co-worker who told her about anopportunity at FullOnCraft Eats& Drinks at Norbeck Road andGeorgia Avenue in Olney.
Houser was hired as theback of the house manager/head chef, and has worked theresince it opened last summer.
“It is so cool because itstarted out as my kitchen, andI got decide the direction,” shesaid. “I wouldn’t trade this jobfor anything or for any amountof money, because I love every-thing about it. I am only 27, buthave everything I want.”
About a year ago, she andher fiancée, Jenny Giganti, werewatching “Hell’s Kitchen.
“I said I could do that, andprobably better than they are,”Houser said. Giganti encour-aged her to apply.
“I am one who usually staysin my comfort zone, but in aburst of confidence, I filled outthe application,” Houser said.“I didn’t think anything wouldcome of it, but I got a phone callandbefore I knew it, Iwasonmyway to ‘Hell’s Kitchen.’”
She said she loves the quiet-ness of Olney, and admits thatwhile not much exciting hap-pens here, that is what endearsher to her hometown.
“I never thought I’d be infront of Gordon Ramsay, andI still can’t believe it,” Housersaid. “It was the experience ofa lifetime, and I am so glad thatmy fiancée pushed me. All ittook was five minutes filling outanapplication, and that changedme completely, for the better.”
On the show, Houser joins17 chefs from across the countryas Ramsay puts them through
grueling challenges and dinnerservices. The grand prize is the“Hell’s Kitchen” title and a headchef position, a total prize valueof $250,000.
Her contestant profile is attinyurl.com/pfuayu7.
Houser and the other con-testants will face challengesthat include crabbing, servinga speed lunch for motorcyclistsand preparing dishes for a highschool homecoming. This sea-son will also feature celebritiesincluding Fran Drescher, Wil-liam Shatner, Tatum O’Neal andWolfgang Puck.
Contestants will be elimi-nated until only two remain.
In the first episode, Ramsaysplits the chefs into two teams— men vs. women — and asksthem to present their signaturedishes in front of a live audience.Later, during their first dinnerservice, the contestants struggleto work together, with Ramsayultimately kicking one team outof the kitchen.
Bissett, the manager at FullOn, described Houser as “awe-some, energetic and realy pas-sionate.”
“Hell’s Kitchen was a perfectfit for her,” Bissett said. “She cantake random ingredients andmake something that is reallyawesome, like an artist.”
‘Small-town gal’ hits culinary big time, to be on TV
GREG GAYNE/FOX
Michelle “Mieka” Houser, a chef atFull On Craft Eats & Drinks in Olney,is a contestant on this season of“Hell’s Kitchen,” which premieresTuesday.
1934201
1933040
1934083
1933188
154012G
THE GAZETTEPage A-8 Wednesday, February 25, 2015 s
154013G
THE LAW OFFICES OF
CHAIRMAN OF THE MD BANKRUPTCY BAR ASSOCIATION 1998-1999
• Chapter 7, 11 & 13• General Litigation• Tax Debt• Divorce• Traffic/DUI-MVA• Criminal
LOAN MODIFICATION
RICHARD B. ROSENBLATT, PCBANKRUPTCY
www.rosenblattlaw.com
301-838-0098
FREE CONSULTATIONPAYMENT PLANS
SE HABLA ESPAÑOL
GD27930
Attorneys ClinicalResearch/Studies
SAVE $250 ONSETTLEMENT
COSTSWe Serve Your Corporate, Real Estate,
Family & Business Law Needs
LAW OFFICE OFLARRY H. KIRSCH
402 Long Trail Terrace, Rockville, MD 20850 [email protected] Parking Language Line
CLOSING DAY SETTLEMENTS
MENTION THIS AD AND
FREE15 MINUTECONSULTATION
NEED LEGAL ADVICE?
1931329
GD27966
Rockville
Call 301-670-7106
ProfessionalServices
Attorneys ClinicalResearch/Studies
THE GAZETTEWednesday, February 25, 2015 s Page A-9
1909007
THE GAZETTEPage A-10 Wednesday, February 25, 2015 s
the county’s relianceonstate aidto fund the school district.
“It’s my hope that not onlyour representatives in An-napolis, but also our governor,certainly understands that thelargest school system in thestate, and one of the best schoolsystems in the nation, is at risk,and it’s at risk of really losingground when it comes to mak-ing sure that we’re continuingto be able to meet the need ofour constituency,” said Rice, thecouncil committee’s chair.
If the Maryland General As-sembly doesn’t pass the schoolconstruction bill in the currentlegislative session, the countyschool district could face a cut of$213.3million fromits requestedsix-year capital program.
The school board has askedfor an amended capital pro-gram totaling $1.74 billion. Theboard’s request is $223.3millionhigher than the previously ap-proved program of $1.53 billion.
School board President Pa-tricia O’Neill said Monday thatif the district doesn’t get thecapital money it requested, itmight need to delay revitaliza-tion and expansion projects,additions and projects such asroof replacements and HVACequipment.
In Annapolis, Leggett,O’Neill and interim Superinten-dent Larry Bowers urged statelawmakers onFeb. 18 to supporta bill to establish a Supplemen-tal Public School ConstructionMatching Fund Program.
The school constructionprogram would direct up to $20million a year to countieswith atleast 140,000 students andaAAAbond rating from two credit-rat-
ing agencies. Only MontgomeryCountymeets those criteria.
Montgomery would needto match state money 2-to-1,meaning the district would putup $40 million if it gets $20 mil-lion. State money would let thecounty issue bonds to get morefinancing for construction proj-ects.
A similar bill failed in An-napolis last year.
While the county hassteppedup in thepast toprovideneededmoney, it nowneeds thestate to take a larger role in fund-ing school projects, Leggett toldthe Senate Budget and TaxationCommittee in Annapolis.
Sen. Nancy J. King said af-ter the hearing she doesn’tthink the bill will pass this year,but it could spark a conversa-tion about school constructionmoney.
If the district’s capital pro-gram needs to be adjusted,Lacefield said Monday, thecountywillworkwith thedistrict“to mitigate that to the greatestextent possible.”
The county is looking at un-certain state school constructionfunding. The state has allocated$18.6 million to Montgomery,about half of what Leggett isexpecting for fiscal 2016, ac-cording to a Feb. 19 educationcommitteememo.
The county could get moremoney from an unallocatedpool of $92.5million.
Amid the county’s calls forincreased state aid, the schoolsystem on Monday released areport on how the district’s 2016capital and operating budgetsaffect the county and the stateeconomies.
The district’s budgets wouldcontribute $3.26 billion to thecounty economy and about$4.12 billion to the state econ-
omy, according to the January2015 report. This was basedon about $2.74 billion in dis-trict spending, adding togetherStarr’s original proposal for theoperating budget — which hassince been reduced — and thecapital budget the school boardapproved inNovember.
The budgets would supportthousands of jobs, includingnearly 9,300 in the county andabout 20,600 in the state, the re-port said.
Bowers said Monday in aninterview that the report, whichwill be given to state legislatorsand county officials, shows thedistrict has “a significant eco-nomic impact” on the countyand state.
The district paid StephenS. Fuller, a professor and theDwight Schar Faculty Chairat George Mason University,$6,500 to do the study. Fuller isthe director of the university’sCenter for Regional Analysis.
O’Neill said the report prob-ably won’t sway legislators out-side the county, but it will helplocal officials understand howschools affect the economy.
State Sen. Richard S. Ma-daleno Jr., who had not seenthe report as of Monday, said itcould help build on a topic notoften talked about—the “multi-plier effect” of education invest-ments.
The report’s findings on thecapital budget could contributeto the momentum of the schoolconstruction bill, he said.
“I think anything that helpsbuild the case helps move thelegislation forward,” Madalenosaid.
AIDContinued from Page A-1
on Layhill, especially when stu-dents are arriving and departingfrom school, Abelmann said.
In recent months, studentsattendedmeetings, developed avideo, and wrote and contactedstate senators, delegates and
other politicians.“We feel our efforts have
been worth it,” said Zoe Adam,a Barrie freshman.
Winchester’s 308-acre Pop-lar Run community includesgenerous sections of greenspace, with more than 70 acresdedicated to the expansion ofthe Northwest Branch StreamValley Park. Townhouses start
at $399,900 and single-familyhomes at $569,900.
Winchester also recently ac-quired89 lotsnear theGlenmontMetro station in Silver Spring.The builder plans to constructtownhouses there starting in themid-$400,000 range, with salesexpected to begin next January.
SIGNALContinued from Page A-1
healthy living and improvecommunity wellness,” WAUPresident Weymouth Spencesaid in a statement.
About $2.4 million instate grants have been se-cured for the center, and alittle more than $1 million inprivate donations have beenraised, said Angie Crews, auniversity spokeswoman.
The bulk of the donationscame from Frederick healthcare executive and Board ofTrustees member Bruce E.Boyer, who presented a $1million check for the projectat a recent board meeting.
Boyer spent time on cam-pus as a child in the 1950s,
when his parents attendedthe university, known asWashington Missionary Col-lege. In the 1960s, he wasa psychology major at theschool, then called Colum-bia Union College. He joinedthe board in the 1970s.
In 2009, the college at-tained university status andchanged its name to thepresent version.
The 19-acre university’sroots date to the establish-ment in 1904 of the coeduca-tional Washington TrainingCollege. It now has about1,100 students in 32 under-graduate and eight graduateprograms.
Adventist HealthCare,the parent of WashingtonAdventist Hospital, has ap-plied with the state to build
a modern campus on land itowns in White Oak. Officialshope the new facility wouldopen by early 2019, if stateapproval is granted by thissummer.
The Takoma Park cam-pus is 13 acres, much smallerthan the proposed 49-acreWhite Oak campus. TakomaPark would retain a behav-ioral unit, an urgent carecenter, a rehabilitation cen-ter, a clinic for low-incomewomen and a center oper-ated by partner CommunityClinic. There also would beoutpatient services and phy-sician offices, and the hospi-tal would lease about 55,000square feet to WashingtonAdventist University.
COLLEGEContinued from Page A-1
primarily due to delays anduncertainty. The county andthe arts center — which offersclasses and other programsin printmaking, screenprint-ing, papermaking and relatedfields — had been working ona deal for Pyramid to use spacein the new $69.5million libraryat Wayne Avenue and FentonStreet for about five years.
Hucker said the Kefa dealis something planned sepa-rately from the Pyramid situa-tion. There are still discussionsabout finding another partnertodosomething similar towhat
Pyramidwanted to do, he said.Pyramid would have used
about 15,500 square feet in ex-change for free community artclasses andotherprogramsun-der theproposal. Thenonprofitalso would have built out thelibrary space at an estimatedcost of $1.3million.
The new library is plannedto open this spring, said Bon-nie Ayers, a spokeswoman forMontgomery County. Officialsare working on firming up aclosing date for the library onColesville Road and will pro-vide a specific opening esti-mate for the new library afterthe closing date is settled, shesaid.
The new library is slated
to be about 63,000 square feet,with the entire building some90,000 square feet.
Hucker said he hasn’theard about any unusual de-lays with the new library.
“From what I’m told, it’sproceeding as planned,” hesaid.
Montgomery County saidin a press release on Tuesdaythat the current library branchat 8901 Colesville Road willclose at 5 p.m. March 15. Acommunity closing event willstart at 3:30 p.m.
StaffWriter Andrew Schotzcontributed to this report.
CAFEContinued from Page A-1
ers and create jobs for hard-pressedMarylanders. The timefor Governor Hogan to get thisproject moving is now,” thestatement read.
The state has delayed thebid deadline once before, afterMarylandGov. LarryHogan (R)wonelection inNovember. Theinitial January deadline waspushed back to March afterstate transit officials said they
wanted to give the new gov-ernor more time to evaluatethe proposal championed byhis predecessor, Gov. MartinO’Malley (D).
Hogan criticized the proj-ect during the gubernatorialrace as being too expensivebut asked Pete K. Rahn, hisnominee for Maryland trans-portation secretary, to analyzewhether it could be donemorecheaply. Rahn told The Wash-ingtonPost in an interviewFeb.12 that he was meeting withbidders to see if they wanted
more time and “flexibility” toreduce costs. The state is pur-suing a 35-year public-privatepartnership in which a teamof private companies woulddesign, build and operate theline, as well as help finance itsconstruction.
Gazette StaffWriters KevinJames Shay and Robert Randcontributed to this report.
BIDContinued from Page A-1
ForumForumThe GazetteWednesday, February 25, 2015 | Page A-11
We are often proud of our coun-ty’s willingness to stand alone on animportant issue. In the case of liquorcontrol, our solitary stance does us adisservice.
MontgomeryCounty is literally theonly local government in America thatpre-empts private-sector distributorsfrom selling beer, wine and spirits. Allrestaurants and stores in the countymust buy alcohol directly from thecounty government, while restaurantsand stores in all other Maryland andregional jurisdictions enjoy a less rig-orous, more business-friendly liquor-control policy.
Even with good people, with thebest of intentions, trying to serve theconsumer preferences of a millionresidentswith onemonopoly distribu-tor is destined to fail. By almost everymeasure, our monopoly fails us. Resi-dents drive to Virginia to buy alcohol;our restaurants complain of poor ser-vice and poor choice; microbrewerieshesitate to locate here; and young andold spend entertainment dollars else-where that could be spent at home.These aren’t insignificant impacts.
The quality of restaurants, en-tertainment and nightlife has a bigimpact on this county’s economiccompetitiveness. These amenitiessupport the new urban quality of life
that both younger workers and emptynesters are seeking, and can be easilyfound elsewhere in the region. In thedynamic social and economic envi-ronmentwe seek to foster, theDepart-ment of Liquor Control is regrettably amodel borne of a different era, one notwell suited for the future.
Given these factors, you may askwhat prevents us from making re-forms? The answer is twofold: Ourcounty derives a net profit of approxi-mately $30 million a year from its mo-nopoly control. That’s realmoneyusedfor many good purposes. Options forreform could affect county employees,
which is a serious consideration.I believe there are answers to
those concerns, and I am grateful thatCouncil President George Leventhalhas formed an ad hoc committee un-der the leadership of CouncilmemberHans Riemer to review these issues, aswell as public health and public safetyconcerns. That work will begin Feb. 27with a review of the recently releasedassessment by our Office of Legisla-tive Oversight of our current system,an assessment that includes a range ofreform options.
Assuming our council can reachconsensus on a positive path towardreform, we’ll need our state delegationto support reform, as well. Our countydoesn’t have the legal authority tomake reforms on our own. Liquor lawsare the domain of the state.
Nonetheless, I remain convincedthat, working togetherwith all affectedstakeholders, we can bring about amoreprosperous, enlivened, andcom-petitive Montgomery County, a futurein which our county is made wholefinancially and where more jobs, notless, are created. That’s a future worthfighting for.
Roger Berliner, BethesdaThe writer is a Montgomery
County councilman.
Montgomery’s liquor monopoly is a failureLET TERS TOTHEEDITOR
In my opinion, both sides of theRockville APFO argument are deficientfor a couple of reasons.
The pro APFO side has not shownany proof for their position. Coun-cilman [Tom] Moore is correct thatmost new students come from exist-ing homes; a recent public report con-firmed this. In addition, no one hasshown evidence that kids are nega-tively impactedbyportable classrooms;if they were, parents would expressconcerns with the school board. His-torically, class size has had impacts onlearning, not the locationof instruction.
As for the opposition, the APFO hasdone little to stop development in thecity. It has impacted the type and sizeof new buildings in Town Center nearBeall Avenue and North WashingtonStreet. Some would argue that we’regetting poorer building uses as a resultof the APFO. I’d be happy if the APFOwould limit the massive developmentproposed by the Rockville Pike Plan,but it won’t. That’s a whole other issue.
School size concern is the broadercontrolling issue — a legitimate con-cern for families in the school system.However, improving school infra-structure in the long term is difficultand is a moving target for the county.Schools have been closed and bound-aries changed over the years to meetdemands. I can citemany schools sincemy time in Rockville (34 years) that hadportable classrooms for a while, then,due to declining enrollment, were re-moved. Schools were closed only to bereopened years later due to ups anddownsof studentpopulations.Hunger-ford-Stoneridge will see a grade schoolafter being closedmany years.
The bottom-line truth is that thecity has little legal standing with schoolissues. In the early 1980s, the courtsdeclared this. However, the court en-couraged the county to give the city op-portunities to comment on their plans.The city did this well for many years.In my time on the mayor and council,we avoided contentious school issues,as best as possible, since city involve-ment had the effect of “pitting” neigh-borhoods against eachother on variousschool challenges. It also created falsehopes that the city could directly im-pact county school decisions.
The people who should be directlyinvolved with school issues are parentsand futureparents.They shoulddirectlyaddress issues with county elected of-ficials and administrators. This is whatPTAs and similar parent organizationsare all about.
By the city being involved throughadetrimental APFO requirement,we’resimply making a local emotional andpolitical issue out of this, with no abilityto really impact county decisions.
It’s time to be honestwith residentsby informing them of the city’s limitedrole in county school issues and lowerexpectations for what the city can im-pact. While we’re at it, why not deletethe APFO requirement altogether tomake this clear.
Jim Coyle, RockvilleThe writer is a former Rockville
councilman and mayor.
Rockvilledoesn’t dictateschool issues
I recently wrote a reflection onMontgomery County Public Schoolsfor the advocacy group One Mont-gomery and was instantly amazedwith the groundswell of positive feed-backpeople had for thepiece. Thefirstday, the article was shared over 1,000times on social media and numerouspeople reached out to me and let meknow how they have been eager forsomeone to tell this story.
I wrote about how, as a Yale se-nior months from graduation, I havecome to understand “A Tale of TwoMontgomerys.” My peers at Yale whograduated fromMCPS talk of a Mont-gomery County — the wealthier partwith “W” schools ormagnet programs—where schools are full of resources,happy employees, and have academicsuccess outpacing the average.
Being a first-generation blackAmerican from a low-income house-
hold, I’ve experienced the “other”Montgomery County at places likemyold school, Springbrook High School.In this Montgomery County, schoolsare fundamentally failing our com-munity. In these high-needs schools,which have a high percentage of mi-norities and low-income students, itseems that many have accepted thatthe academic and behavioral prob-lems present cannot be solved.
They say academic performancedepends on parents and student per-sonal responsibility and point to myacademic success and others like meas vindicationof their viewpoint. But ifone accepts that students across racesand economic statuses were bornequal, logically these differences in ac-ademic achievement must be causedby factors outside the individual. Hav-ing twoMontgomerys cannot be justi-fied and is undesirable and unstable.
The necessity of demandingchange can come from two views.
From a progressive social justiceview, having two Montgomerys rein-forces racial and socioeconomic sta-tistical predictions that students willfail — that skin color and residentialareas are determinants for where youwill go in life.
From a fiscally responsible or eco-nomic view, having twoMontgomeryswill bring ourwhole county down. Theproblems in one side of the countywill eventually affect other parts of thecounty as budgets will rise, causingcuts in other programs and propertyvaluesmay fall.Whatever one’s stanceis ideologically, it makes sense to fightto change this status quo.
During the State of the Union,President Obama spoke about a “bet-ter politics,” where we break monop-olies of thought in dealing with our
most difficult problems. Indeed, onepossible silver lining from our stateelecting a Republican governor in aDemocrat-favored election is it showspeople are ready for this better poli-tics.
We must innovatively think andrethink our approach to the achieve-ment gap because the educationalexperience for a rich white child atWhitman High School should be nodifferent than the experience for apoor black or Latino child at Spring-brook High School. If our public of-ficials, from the school level to thecounty level, cannot deliver the edu-cation results we need, we must in-state those that can. It is an economicimperative. Our better politics — ourcounty’s future — depends on build-ing oneMontgomery.
Michael Robinson, Silver Spring
Having two Montgomerys brings the whole county down
As demonstrated by the recenttragedy where two innocent fami-lies had their lives ended or dis-rupted, and their homes destroyed,the future of the MontgomeryCounty airport needs to be publiclyexamined and discussed.
First, there is the danger fromincidents due to planes using thisfacility. Although the county hasbeen lucky that such incidentshave been rare, the presence of theairport in what is now a congestedresidential area guarantees furthertragedies of this story.
Whatever the reasons were forlocating this airportwhere it is, they
are no longer valid given the growththat has changed the nature of thesurrounding area.
Secondly, the airport appearsto be totally inappropriate for usfor landing/takeoff training. If thepilots aren’t trained, they shouldnot be practicing in a congestedresidential area. Iwouldnot disputethe need for training, which is obvi-ous from themanypilotswhofly fartoo lowover the houses in this area.
Further, the airport provides nobenefit to most of the people of thecounty. I have heard that our taxmoney subsidizes the airport, whilethe only users are rich business
people wishing to avoid the con-gestion at the area’s major airportsand wealthy hobbyists. Certainly,the residents living near the airportreceive no benefit.
Public meetings are needed toaddress the issue of the existenceof the airport and whether is ap-propriate for it to be located in acongested residential and businessarea.
We presume that The Gazettewill provide prominent notice andcoverage of such meetings as theyoccur.
Tom Umbreit, Montgomery County
Public should have input into future of the airport WRITE TO USThe Gazette welcomes letters on Mont-gomery County topics. They should be nomore than 300 words, although up to 500words may be allowed, as space permits.Letters on timely issues may get prefer-ence. Include a full name and hometownfor publication, plus a daytime phone num-ber for verification. No anonymous lettersare printed. Election-related letters will notrun in the two editions before the election.Mail to The Gazette, Forum editor, 9030Comprint Court, Gaithersburg, MD 20877;fax to 301-670-7183; or email to [email protected].
Montgomery County, like therest of the United States, is seeinga big increase in its senior citizenpopulation.
The county, citing aMarylandDepartment of Planning estimate,has said the number of residents atleast 60 years old was expected tojump 74 percent from 2000 to 2020.The rest of the populationwas ex-pected to increase 10 percent dur-ing that period.
There are broad social implica-tions with such a population shift,as we figure out how to care for anaging America.
We commend the work of gov-ernment and private partners inMontgomery County addressingan important, little publicized chal-lenge: elder abuse.
An ElderSAFE Center has beenopen since September at Charles E.Smith Life Communities in Rock-ville, a campus offering senior citi-zens a range of living arrangements.The center offers shelter to abusedsenior citizens, and services such ascounseling, therapy and referrals.
As of several weeks ago, threesenior citizens whowere thought toneed help had been invited to stay
at the center,but noneaccepted.It mighttakemoreeducation,publicity andacceptancefor victimsto considerrefuge of this
sort, but it’s an important resource.Marilyn Feldman, director of
communications for Charles E.Smith Life Communities, said thatasmany as 10 percent of people at
least 60 years oldmight be victimsof abuse.
“I think awareness of elderabuse is probably about 40 yearsbehindwhere awareness of childabuse ormarital abuse is,” Feldmansaid.
Partners involved in the centerinclude religious organizationsandHoly Cross Hospital, as well asMontgomery County’s health andpolice departments, Adult Protec-tive Services department and state’sattorney’s office.
“Only four percent of reportedelder abuse cases come from the
elder person; 96 percent of the re-ports come from somewhere else,”Debbie Feinstein, a prosecutor whois chief of the Family Violence Divi-sion of theMontgomery Countystate’s attorney’s office, said in astatement. “Thatmakes us—phy-sicians, law enforcement, careproviders— so important. We needto recognize the red flags of elderabuse, act as ambassadors, andeducate the community.”
Montgomery County will ben-efit from this cooperative effort tocounteract unseemly acts againstvulnerable victims.
ElderSAFE is soundSHELTER
FOR ABUSEDSENIOR
CITIZENSCAN BE AN
IMPORTANTRESOURCE
OUROPINION
2011 FILE PHOTO
Jimmy Creegan of Damascus shops for alcohol at the Milestone Montgomery County Liquorand Wine Store in Germantown.
9030 Comprint Court, Gaithersburg, MD 20877 | Phone: 301-948-3120 | Fax: 301-670-7183 | Email: [email protected] letters appear online at www.gazette.net/opinionTheGazette
Karen Acton, Chief Executive OfficerMichael T. McIntyre, ControllerDonna Johnson, Vice President of Human ResourcesMaxine Minar, President, Comprint Military
Dennis Wilston, Corporate Advertising DirectorMona Bass, Inside Classifieds DirectorAnna Joyce, Creative Director, Special Pubs/InternetEllen Pankake, Director of Creative Services
Leah Arnold, Information Technology ManagerDavid Varndell, Digital Media ManagerCathy Kim, Director of Marketing
and Community Outreach
Vanessa Harrington, Senior EditorAndrew Schotz, Managing EditorGlen C. Cullen, Senior Editor Copy/DesignWill C. Franklin, A&E Editor
Ken Sain, Sports EditorDan Gross, Photo EditorJessica Loder, Web Editor
POST COMMUNITY MEDIA
Karen Acton,President/Publisher
Arts & Entertainmentwww.gazette.net | Wednesday, February 25, 2015 | Page A-12
n Investors bring newtechniques, rich flavorsto South African wines
South Africa appears poisedfor wine greatness. This issomewhat surprising since thecountry’s winemaking indus-try languished during the 50plus-years-long internationalboycott of the apartheid gov-ernment. Thewinesmadeduring those decades wereuninspiring andmeant to beshipped in large bulk contain-ers rather than bottles. After therevocation of apartheid in 1994,South Africanwinemakers hada lot of catching up to do.
They did have some advan-tages, including amore than350-year history of winemak-ing. The East India TradingCompany established away-station for their ships in what isnowCape Town that includedvineyards with the first harvestoccurring in 1659. The secondgovernor of the region foundedthe ConstantiaWine Estate(named after his wife) on 1,900acres outside the town.
The estate was purchasedin 1778 byHendrik Cloete, whorevitalized the property andcreated a blended sweet winethat becamewildly popularamong European aristocracy(including Napoleon, Fredrickthe Great and King Louis Phil-lipe of France) as well as poetssuch as Baudelaire, who com-pared Constantia wine to thelips of his lover.
The end of isolationmeantthat South Africanwinemakerscould travel and learn aboutmodern techniques while extol-ling the virtues of their terroir.During this time, the country’scontrolling wine cooperative
shifted focus to private enter-prise, whichmade South Afri-canwineriesmore attractive tooutside investors. The recentacquisition ofMont RochelleWinery in theWestern Capeby Sir Richard Branson (VirginGroup) and the purchases ofthe venerableMulderboschWinery and FableMountainVineyards by the former ownerof California’s Screaming EagleWinery, Charles Banks, are justa few examples.
The result is a South Africanwine renaissance with exportsgrowing alongwith criticalacclaim.While occasionallythe names are difficult to pro-nounce, the wines are worth thesearch, especially sincemanyare value-priced.
Neil Ellis was among thefirst to appreciate the impactof the various South Africanmicro-climates and createdwine from specific sites. Hisson,Warren, is now thewine-maker and their Neil Ellis Sau-vignon Blanc Groenekloof 2014is bright and refreshing withcitrus, gooseberry andwhitepeach flavors alongwith a crisp,balanced finish. Also enjoyableis the Neil Ellis Sauvignon BlancWestern Cape Sincerely 2014,which showsmore tropicalfruit alongwith lime and grassynotes.
South African golfer ErnieEls released the first vintagefromhis eponymouswinery in2000. His 100 percent CheninBlanc Ernie Els Big EasyWhite2014 has honeyed apple, apri-cot and guava flavors within a
Poised for a renaissanceGRAPELINESB Y L O U I S M A R M O N
n Music, script combinefor unique Shakespearean
performance
BY KIRSTY GROFF
STAFFWRITER
Folger Consort will bringShakespeare’s “The Merchantof Venice” together with pe-riod-appropriate music for agenre-spanning experience attheMusicCenter at Strathmore.
Directed by Richard Clif-ford, the production will in-clude music by the BassanoFamily, well-known 16th cen-tury musicians, and othersfrom the period interspersedwith readings from the play byClifford as well as renownedShakespearean actor Derek Ja-cobi and others.
It’s not quite a concert ortheatrical production—but thecombination of formats allowsfor a wider span of potentialaudience members to latch onto an interesting aspect of theevent.
“There are infinite varietiesin the way things can be donenowadays,” said Clifford. “Itencourages music lovers to seethe play, it encourages peoplewho love the play to hear themusic — it brings in new audi-ences, and I think that’s impor-tant. We need new audiences,for goodness sake.”
Clifford’s a veteran of thefield, directing for Folger Con-cert three times prior as wellas for Folger Theatre, and per-forming in productions withProspect Theatre Company,Royal Shakespeare Companyand Renaissance Theatre Com-pany among others.
This is his second timeworking on “The Merchantof Venice” in some capacity,with help from the resourcesafforded through working withFolger Shakespeare Library’sperformance groups.
“I’ve always had a pas-
sion and a love for the playsof Shakespeare — and the po-ems, the sonnets,”Clifford said.“Coming to work at the Folger,not only is it actor-friendlyand director-friendly, it hasthat wealth of material behindit. They have original scenicdesigns, original costume de-
signs, and theyhave generouslyopened up their collection forme to study. It’s aneducation initself, which is why I love work-ing there.”
He first caught the actingbug at the age of 6 performingin a play in India, where he wasborn. He continued acting dur-ing his schooling in England,andhasn’twanted to stopsince.
“It’s a funny thing, isn’tit,” he said, “suddenly you dosomething and you realize,‘This is it.’ I felt lucky in that re-spect.”
His first foray into directingwas “Playing the Wife” in 1995,andwhile he still primarily con-siders himself an actor he hasregularly alternated betweenperforming and directing eversince.
Not surprisingly, Cliffordfeels he can better relate as anactor to directors who are fa-miliarwith everything that goesinto aperformer’s dutieswithina show.
“A director who’s been anactor knows what it’s like to doa performance every night, todoeight showsaweek,” he said,“and they can see how a playwill evolve and how the perfor-mance will expand and changein subtle ways. You learn a lotfrom thembecause theyunder-stand the acting process.”
For this production, theformat makes the task of di-recting slightly different than astraightforward theatrical pro-duction. Since all of the play’smaterial could not be used,Clifford had to choose certainreadings based on what he sawthe most pertinent message tobe.
The human connection
PHOTO BY MIG DOOLEY
Derek Jacobi, seen here in a 2010 production of “The Tempest,” will appearthe upcoming production of “The Merchant of Venice” presented by theFolger Consort on Friday at the Music Center at Strathmore.
See WINE, Page A-13See PERFORMANCE, Page A-13
1934044
1934043
1931326 1934036
Victorian LyricOpera Company
Sir Arthur Sullivan &Sydney Grundy’s
HADDON HALLThursday, Feb. 26 at 8:00 p.m.
(Preview Night)Fridays, Feb. 27 and March 6
at 8:00 p.m.Saturdays, Feb. 28 and March 7
at 8:00 p.m.Sundays, March 1 and 8
at 2:00 p.m.Tickets: Adult - $24;
Senior (65+) - $20; Student - $16
F. ScottFitzgeraldTheatre
603 Edmonston Dr.Rockville, MD 20851
240-314-8690www.rockvillemd.gov/theatre
1930
879
1931328
1931975
“I’ve picked out what Ithought was the main theme of‘Merchant of Venice,’ and whichrelates to the story of Portia, Shy-lock and Antonia, and the themeis really justice and mercy,” hesaid. “I think justice is a debatein this piece. Justice is a choice insome funnyway, amoral choice.”
He believes that separat-ing the readings and includ-ing the musical selections fromthe Bassanos as well as JohnDowland, Salamone Rossi andClaudio Monteverdi to furtherShakespeare’s writing will makethe play more accessible to thosetypically disinclined to see a fullplay, as well as create a clear arcfrombeginning to end.
By bringing in audiences thatare interested in the music of thetime as well as theater fans drawnin by the take on the text, FolgerConsort’s presentation of “TheMerchant of Venice” should bringShakespeare’s message to new
viewers who, hopefully, will re-turn to see one of his works in itsentirety.
“His plays are about the hu-man condition,” Clifford said.“The Hamlet speech, ‘to be ornot to be,’ is the most fascinat-ing moral intellectual question tohimself, and I think when it’s ex-plained properly, when it’s actedwell, people discover somethingabout Hamlet the man but alsothemselves. I think that’s whatpeople get out of seeing Shake-speare.”
PERFORMANCEContinued from Page A-12
T H E G A Z E T T EWednesday, February 25, 2015 s Page A-13
For a free listing, please submit completeinformation to [email protected] at
least 10 days in advance of desired publi-cation date. High-resolution color images(500KB minimum) in jpg format should
be submitted when available.
DANCESSocial Ballroom Dance, 2126 Industrial
Highway, Silver Spring, 301-326-1181, holly-woodballroomdc.com.
Scottish Country Dancing, 8 to 10 p.m.Mondays, steps and formations taught. Noexperience, partner necessary, T-39 Build-ing onNIH campus,Wisconsin Avenue andSouthDrive, Bethesda, 240-505-0339.
Glen Echo Park is at 7300 MacArthurBlvd.
Blues, Capital Blues: Thursdays, 8:15 p.m.beginner lesson, 9 to 11:30 p.m. dancing toDJs, Glen Echo Park’s Spanish BallroomAn-nex, $8, capitalblues.org.
Contra, Feb. 27, TedHodapp calls to Con-tratopiawith Erik Sessions on fiddle, PatricePakiz on piano, oboe and percussion, PatO’Loughlin on English concertina and banjo,and JohnGoodin onmandolin and guitar,7:30 p.m., $10, fridaynightdance.org.
English Country, Feb. 25, CarolMarshcaller, 8 p.m., Glen Echo TownHall (upstairs),fsgw.org.
Swing and Lindy, March 14, Natty Beaux,$18, $12, 17 and younger. Glen Echo ParkSpanish Ballroom, flyingfeet.org.
Waltz, March 1, Taylor Among theDevilswithMarty Taylor (winds, concertina), SteveHickman (fiddle), AlexanderMitchell (fiddle,mandolin), Jonathan Jensen (piano, vocals);waltztimedances.org.
Ring of Kerry Irish Dance class, groupmeets on Tuesday’s until lateMay at Rid-geviewMiddle School. Beginning class startsat 7 p.m., followed by the experienced class at8:05 p.m. The cost is $50. Ceili and set dancesare performed, and no partner is requiredfor the lessons. For information, email Jeanat [email protected] visit ringofkerry-dancers.org. Dancersmust be at least 8 yearsold to senior. Anyone younger than 16mustbe accompanied by an adult.
MUSICArts Barn, 311 Kent Square Road, 301-258-
6394.Bethesda Blues & Jazz Supper Club,
“Touch theWall”Movie Viewing, Feb. 25;Cathy PontonKingBandFeaturing TrumpeterCurtis Pope, Feb. 26; The FabulousHubcaps,Feb. 27; TomPrincipato Band, Feb. 28; call forprices, times, 7719Wisconsin Ave., Bethesda.240-330-4500, bethesdabluesjazz.com.
BlackRock Center for the Arts, Le VentduNord, Feb. 28;Upright Citizens Brigade,March 6;Upright Citizens Brigade,March 7;Still Dreaming,March 8; SwingDance Party,March 13; Lunasa,March 14; 12901 Town
CommonsDrive, Germantown. 301-528-2260,blackrockcenter.org.
Hershey’s At The Grove, Chuggalug, Feb.27; TheBilly ThompsonBand, Feb. 28; callfor times, 17030Oakmont Ave., Gaithersburg.301-948-9893; hersheysatthegrove.com.
Fillmore Silver Spring, JoeNichols, Feb. 26;Ra TheMC, Feb. 27; TheBlackGenius Project,Feb. 28; Behemoth&Cannibal Corpse,March2; Bush,March 3; Logic,March 4; Logic,March 5; Kalin andMyles,March 13; AndyGrammer andAlex& Sierra, Artists Tea, Feb.25; Cristian Perez, Feb. 25; TangoBuenos Ai-res: Song of Eva Peron, Feb. 25; Jenny Lin, Feb.26; DianaKrall, Feb. 26; TimWhalenQuintet,Feb. 27; TheMerchant of Venice, Feb. 27; BSO:The Firebird Suite, Feb. 28; call for venue,times. Locations:Mansion, 10701RockvillePike, North Bethesda;Music Center at Strath-more, 5301 TuckermanLane,North Bethesda,301-581-5100, strathmore.org.
ON STAGEArts Barn, “Boeing, Boeing,” through
March 1, $20; “Honest Abe: TheWit &Wis-domof AbrahamLincoln,” Feb. 18, $20; 311Kent Square Road, 301-258-6394
Adventure Theatre-MTC, “Petite Rouge—ACajun Red RidingHood,” throughMarch 8,call for prices, times, Adventure TheatreMTC,7300MacArthur Blvd., Glen Echo, 301-634-2270, adventuretheatre-mtc.org.
Imagination Stage, “Wiley and theHairyMan,” throughMarch 15, call for prices,times, Imagination Stage, 4908 Auburn Ave.,Bethesda, imaginationstage.org.
Highwood Theatre, “The Importance ofBeing Earnest,”March 20-March 22; “August:Osage County,”March 27-March 29; 914Silver Spring Ave., thehighwoodtheatre.org,301-587-0697.
Olney Theatre Center, “Godspell,”throughMarch 1, call for prices, times, 2001Olney-Sandy Spring Road, Olney, 301-924-3400, olneytheatre.org.
The Puppet Co., “Aladdin andHisWon-derful Lamp,” Feb. 19 throughMarch 15; TinyTots@ 10, selectWednesdays, Saturdays andSundays, call for shows and show times, Pup-pet Co. Playhouse, Glen Echo Park’s NorthArcade Building, 7300MacArthur Blvd., $5,301-634-5380, thepuppetco.org.
Rockville Musical Theatre, “Next toNor-mal,” April 10 through 26, Fitzgerald Theatre,603 EdmonstonDrive, Rockville, 240-314-8690, r-m-t.org.
Round House Theatre, “Chatroom,”March 13 throughMarch 16, “Uncle Vanya,”April 8 throughMay 3, call for show times,4545 East-West Highway, Bethesda. Ticketsrange in price from$10 to $45 and seating isreserved. 240-644-1100, roundhousetheatre.org.
Lumina Studio Theatre, Silver Spring BlackBox Theatre, 8641 Colesville Road, SilverSpring, 301-588-8277, luminastudio.org; [email protected].
Silver Spring Stage, “33 Variations,” Feb.27 throughMarch 21,Woodmoor ShoppingCenter, 10145 Colesville Road, Silver Spring,seeWeb site for show times, ssstage.org.
Randolph Road Theater, 4010 RandolphRoad, Silver Spring, belcantanti.com,
Cafe Muse, FriendshipHeights VillageCenter, 4433 South Park Ave., Chevy Chase;301-656-2797.
VISUAL ARTAdah Rose Gallery, “YourMemories, Your
Sentiments, YourWishes, Your Secrets,” JimCondron andKristen Liu, through Feb. 28,3766Howard Ave., Kensington, 301-922-0162,adahrosegallery.com
Glenview Mansion, F/1.4 PhotographyGroup exhibit, “Richly Black andWhite,” fea-turing JareeDonnelly, CraigHiggins, TimothyLynch, andMargeWasson. Rockville CivicCenter Park, 503 EdmonstonDrive, Rockville.rockvillemd.gov.
Marin-Price Galleries, Gallery Exhibit,through Feb. 28, 10:30 a.m. to 7 p.m.Mondaythrough Saturday, noon to 5 p.m. Sunday,7022Wisconsin Ave., 301-718-0622,marin-price.com.
Montgomery Art Association, GalleryShow, throughMarch 2,WestfieldWheatonMall, 11160 ViersMill Road,Wheaton,mont-gomeryart.org.
VisArts, Suspension, throughMarch 1;Laini Nemett, throughMarch 1; Gibbs StreetGallery, 155Gibbs St., Rockville, 301-315-8200, visartsatrockville.org.
Washington Printmakers Gallery, PyramidAtlantic Art Center, second floor, 8230Geor-gia Ave., Silver Spring, washingtonprintmak-ers.com.
Kentlands Mansion, Bridal GownRetro-spective, through Feb. 26; Artwork of the ArtLeague of Germantown, throughMarch 27,320 Kent Square Road, Gaithersburg, 301-258-6425.
Arts Barn, Howard Cohen – Seventy Yearsan Artist, throughMarch 8, 311 Kent SquareRoad, Gaithersburg, 301-258-6394
Rough Around the Edges: Inspirations inPaper by Ronni Jolles, throughMarch 15;reception 2 to 4 p.m.March 8; GoldmanArtGallery, 6125Montrose Road, Rockville. 301-348-3770; jccgw.org. Openwhen JCCGW isopen; free admission.
Village of Friendship Heights Gallery, “TheInfluence of Our Elders,” the exhibit includesculpture, collages, paintings, watercolors,and photography. On exhibit untilMarch 1.FriendshipHeights Village Center, 4433 SouthPark Ave., Chevy Chase. 301-656-2797
Gallery B, “Coaxing the Elements,” featur-ing sculptor Lynda Smith-Bügge and jewelryartist Katja Toporski, through Feb. 28. 7700Wisconsin Ave., Suite E, Bethesda, bethesda.org.
ET CETERAThe Writer’s Center, 4508Walsh Street,
Bethesda, 301-654-8664, writer.org.
IN THE ARTS
‘THE MERCHANTOF VENICE’n When: 8 p.m. Friday
n Where: Music Center atStrathmore, 5301 TuckermanLane, North Bethesda
n Tickets: $35-$85
n More information: Strathmore.org; 301-581-5100
Richard Clifford,seen here in a2010 productionof “The Tempest,”will direct andappear in “TheMerchant ofVenice” presentedby the FolgerConsort at theMusic Center atStrathmore.PHOTO BY MIG DOOLEY
amedium frame that has somepineapple notes in the finish.
South African blendedwhitewines are particularly compellingespecially the Alheit CartologyWestern Cape 2013, a combina-tion of Chenin Blanc and Semil-lion that displays richmelon,apple, quince and peach flavorsaccentedwith fennel, citrus andhoney leading into a prolonged,concentrated finish. The 2013Sadie Family Skerpioen ismadefromChenin Blanc grown on70 year old vines blendedwithPalomino. It opens with strawand stone fruit aromas that lead
into complex apple, melon, hon-eysuckle and some slight grassyflavors alongwith notes of al-monds, Asian spice andmineralsthat persist throughout the long,balanced finish.
Also, look for the South Afri-can reds including theMeerlustEstate Rubicon 2009, a red blenddisplaying smoky floral and cur-rant scents that persist alongwith blackberry, boysenberry andmocha flavors with hints of redfruit, cinnamon and sage leadinginto a well-balanced finish. Alsoconsider the plum and herbalscented Kanonkop Kadette2012, a Pinotage based blendwith black cherry, raspberry,and cranberry flavors with someherbal and earthy notes.
WINEContinued from Page A-12
1934045
1931327
1934037
1934192
00 DODGE CARAVAN SE ...............................$1,350#KN71331A, PW/PLC/PMR, “SAVE!” “HANDYMAN”04 SATURN ION ............................................$4,990#KP59456A, 3 QUAD CPE “GAS SAVER!” 5SPD, AC, PW, CD03 CHEVY TAHOE Z-71 .................................$5,250#KA97275A, LTHR, MNRF, DVD “BEST BUY!” “HANDYMAN”06 CHEVY AVEO LS ......................................$5,450#KP73917, “H/BK, SUPER CLEAN, 71K! AUTO, AC, WE FINANCE!
09 CHRYLSER PT CRUISER............................$6,988#KR61654, “WELL KEPT!” AT, AC, PW, PLC, CD03 SUBARU FORESTER 2.5 XS......................$7,988#KP0535, AUTO, HTD SEAS, P/OPTIONS06 DODGE GR CARAVAN SXT.........................$7,990#KX85081, DVD/MNRF/NAV/LTHR, EZ FINANCING07 TOYOTA CAMRY SE...................................$9,997#KP19276A, “STRIKING!” ALLOYS, SPLR, P/OPTIONS, CD
10 HONDA FIT H/B SPORT $11,988
#KP32166, ALLOYS, SPL, FOG LTS, AT, PW, CD, EASY TERMS
07 MITSUBISHI OUTLANDER XLS $11,630
#KP10452, AWD “PAMPERED” 3RD SEAT, P/OPTIONS
02 CADILLAC DEVILLE $6,990
#KR47674, “RARE FIND” 62K!! MNRF, LTHR/PWR SEAT
09 TOYOTA VENZA $16,490
#KA09382, ALLOYS, CD CHGR, STABILITY, P/OPTIONS, REDUCED!
12 NISSAN ALTIMA CPE 2.5S $13,745
#KP33098, “BEAUTY!” ALLOYS, STABILITY, AUTO, CD
07 JEEP COMMANDER SPORT .....................$11,735#KR90201, 4WD, PW/PLC/PMR, CC, CD, DON’T MISS!12 FORD FOCUS SE ......................................$11,890#KN80896, AT, PW/PLC, CD EXCELLENT TERMS!08 HYUNDAI SANTA FE LIMITED...................$14,335#KP24334, AWD, MNRF, LTHR/PWR SEAT, P/OPTIONS10 HYUNDAI GENESIS...................................$14,988#KP08708, “GORGEOUS” MNRF, LTHR, 0% FINANCING AVAIL!
08 ACURA RDX.............................................$15,488#KP00179, TECH, AWD “BEAUTY!” NAV, MNRF, MEMORY13 DODGE GR CARAVAN SXT.........................$16,888#KN19031, QUAD/STO&GO, PARK SENSE, PWR DRS11 FORD ECONOLINE XLT..............................$16,988#KN75845, 12 PASS VAN, SUPER CLEAN! DON’T MISS!12 DODGE JOURNEY SXT..............................$16,995#KX9194, SHOWROOM COND, 23K “FAC WARR!” BEST BUY!
THE GAZETTEPage A-14 Wednesday, February 25, 2015 s
1909733
www.gazette.net | Wednesday, February 25, 2015 | Page B-1
SPORTSSPORTSGAMES GAZETTE.NET IS STAFFINGPosted online by 8 a.m. the following day.
St. Andrew’s boys basketball wins first conference title. B-3
SWIMMING: Hannah Lindsey (pictured) leads theChurchill High School swimming and diving team intoTuesday’s state championship meet in College Park.
BOYS AND GIRLS BASKETBALL: Playoffs begin, TBD
WRESTLING: Region tournaments, Friday-Saturday.
If there’s one regret I have in life, it isnot playing college football. As a senior atMagruderHigh School, I explored the op-portunity to playfor several Divi-sion III schoolsand a couple ofDivision II pro-grams. In theend — even af-ter sending outnumerous gamefilms and tak-ing campus visits— I decided to“retire” from thegame and move on to the next phase ofmy life.
But by the time August came and Iheaded off to Penn State — I was eithergoing to play football at a small school orgo some place where football mattered— I already regretted my decision. Andthere hasn’t been a day that has gone byover the past 10½ years that I don’t wish Icould suitupandplayone last timeunderthe Friday night lights.
I found myself reminiscing (in myhead)aboutmyglorydays lastweekwhenI had a conversationwith 2013DamascusHigh School graduate Alex Salem.
The former Swarmin’ Hornet was asolid baseball outfielder in high school,earning All-Gazette honorable mentionselections following his junior and seniorseasons. But entering his senior year, Sa-lem had decided not to pursue playing atthe next level.
“I wasn’t really sure since [recruit-ing] is a lot of work and I didn’t want togo to showcase events every weekend,”said Salem, who added that his favoriteMajor League Baseball players are RyanZimmerman and Robinson Cano. “I justwanted to playwithmy friends.”
Upon graduation, Salem was all setto attend Bucknell University (Pa.) on aPresidential Fellowship and focus on aca-demics (hewants tobea lawyer).Butaftera strong2013summerwith theDamascusAmerican Legion Post 171 team that fin-ished as the state runner-up, he began torethink his future.
“He hadmade a decision that he hadreached his goals in baseball and justwanted to focusonacademics,” saidSteveSalem, Alex’s father. The elder Salemplayedbaseball at AmericanUniversity inthe 1980s. “He had so much fun playingfor [Post 171] and I think he realized howmuchhewasgoing tomiss it. I think that’swhat happened.”
“Alex is just a real baseball kid,” saidBill Murray, one of Salem’s longtimeyouth and high school coaches. “He’s agreat athlete and even a better kid that ...has a lot of sticktoitiveness.”
Salem, who had been recruited by ahandful of Division I schools, then con-tacted Bucknell coach Scott Heather andwas invited to try out for the team. Salemwas among the final cuts prior to last sea-son, but Heather encouraged him to playfor Bucknell’s club team, keep workingout and comeback the following year.
It worked.“I honedmy skills, but themain thing
was to get into the weight room and getbigger, stronger, faster,” Salem said.
Salem, 5-foot-9 and 165 pounds,made the team this spring as a walk-on.He isn’t expected to play much this year,but that may change in the future. Rightnow, Salem, who has played for Dig-Inand is expected to suit up for theMCBL’sGaithersburg Giants this summer, is justhappy to be playing the sport he loveswithout regrets.
“Once you stop playing— I didn’t re-alize I’dmiss it asmuch—ithurts,”Salemsaid. “But I think everything has workedout better. I chose a school that I love foracademics and life, not baseball. Beingable to play baseball on top of that is thatmuchbetter.”
Play for as longas possible
ASSISTANT SPORTSEDITOR
KENT ZAKOUR
n Approaches differwhen protecting smalllead with just seconds
remaining
BY ADAM GUTEKUNSTSTAFF WRITER
As the final seconds wounddown in a Feb. 3 girls basket-ball game between PoolesvilleHigh School and Damascus,Swarmin’ Hornets coach StevePisarski was not making anyattempt to mask his game planas his girls nursed a three-point lead with just under 20seconds remaining.
The longtime Damascuscoach was quite vocal in hisinstructions to foul. The Hor-nets had four personal fouls tospare before Poolesville wouldbegin shooting one-and-onefree throws. But even then,Pisarski’s approach was notabout to change. The Hornetswent on to secure a 39-36 winover the Falcons in the finalminutes thanks to a late-gameapproach they failed to ex-ecute in the same situationagainst the very same team 15years before.
“I’ll never forget it,” Pisar-ski said. “We had a gameagainst Poolesville where Ilined people up to foul. Theywere throwing it in and weknew who they were throwingit in to. We went to foul — wedidn’t. We didn’t foul themat the top of they key comingup the court. We didn’t foulthem at half court. We did foul[her] as she made her layup.We ended up going to over-time and losing. That was notgood.”
While Pisarski is a firm be-liever of fouling in that situa-tion, others aren’t so sure. Thescenario — playing defense,up three points with under10 seconds remaining — haslong been one of the mosthotly contested debates inbasketball. Do you foul, forc-ing the opponent to make afree throw, intentionally missthe second and score an im-probable putback all in onesequence? Or do you choosenot to foul, placing your hopeswith the odds that the oppo-nent won’t sink a tightly de
To foul ornot to foul?
n Jaguars and Coyotescomplete postseason sweep
BY JENNIFER BEEKMANSTAFF WRITER
Two events remained in Monday’sClass 4A state championship indoortrack meet held at the Prince George’sSports and Learning Complex followingthe 800-meter relay but the ClarksburgHigh School girls were finished for thenight. The Coyotes’ third-place result inthe race, during which the Alexus Pyles-anchored squad dropped nearly two sec-onds off its seed time, was the proverbialexclamation point at the end of aboutas complete a meet as Clarksburg couldhave contested. The team had done ev-erything in its power to put itself in aposition to win, longtime coach ScottMathias said.
“We came in feeling like we wanted tocontrol our own destiny,” Mathias said.“The 4x2 was just lights out, it was phe-nomenal. After that wewere done. But wehad done everything we could have, weeven outperformed what we expected.”
While this wasn’t the first teamMathias truly believed had state cham-pionship potential, he said, it was thefirst time the Coyotes were able to breakthrough on the biggest stage. Clarksburggot points from nearly every person whoqualified for the state competition andthe result was a 46-35 advantage overthe 2013 and 2014 championship. Bowieand South River tied for second placewith 35 points. Paint Branch finishedfourth with 34 points and Northwest(31.50 points) rounded out the top 5.
Monday marked the first state titlewon by any girls sports team in Clarks
Northwest boys, Clarksburg girls win state track championships
BILL RYAN/THE GAZETTE
Clarksburg High School’s Alexus Pyles performs in the high jump duringMonday’s 4A/3A state meet.
See FOUL, Page B-2
See TRACK, Page B-2
SILVER SPRING | TAKOMA PARK | WHEATON | BURTONSVILLE
TOM FEDOR/THE GAZETTE
Blake High School boys basketball player Jack Tempchin drives to the hoop during Thursday’s practice.
n After a disappointing startto the season, Bengals have
found success
BY ADAM GUTEKUNSTSTAFF WRITER
As a freshman, Blake HighSchool boys basketball player JackTempchin could barely find his wayoff the bench for the Bengals’ juniorvarsity team. The 5-foot-6 now-ju-nior struggled to record significantminutes on the court, and started tobecome frustrated with his lack ofplaying time.
“I thought I was a lot better thanI was,” Tempchin said Thursday dur-ing a brief respite from directing theBengals’ offense. Two years removedfrom riding the pine, the junior pointguard has grown into a player thatcoach Marcus Wiggins trusts withdirecting his team.
“He is the heart and soul of theteam,” Wiggins said. “He’s con-stantly running the team. He hits thebig shot — he’s a big shot artist.”
While Tempchin’s role reversalcertainly has been drastic, it’s a mi-
crocosm of the transformation theentire Blake team has undergonejust a season removed from reach-ing the sectional finals. Everyone, itseems, has new roles.
Last year’s team had a luxury fewteams were afforded in then-seniorguard Demonte Ojinnaka, who av-eraged more than his share of thescoring load for the Bengals. Ojin-naka was responsible for 18 points,eight rebounds and three assists agame, and by many accounts wasthe straw that stirred the drink fora Blake team that finished 15-9. Theroles of players around the Bengalsstar came quite easily.
“Everybody knew their role,”Tempchin said. “Everybody knewwhat they had to do. We knew [De-monte] was the scorer. I knew I hadto come off the bench, facilitate andshoot when I was open.”
This season’s roles, however,came less naturally for Wiggins’group. The Bengals were comprisedlargely of unproven pieces and noserious scoring threats. Sure, Blakereturned three seniors from last sea-son’s sectional runner-up, but thoseplayers weren’t necessarily relied onto scoremuch, according toWiggins.
There were roles waiting to be filled,as Blake searched for their identity.
“We knew coming in that this isone of the years where we’re goingto have to be a team,” Wiggins said.“We’re going to be able to have torun our systems. Our systems [were]going to be more important than thetalent that’s on the floor until we[started] to figure out our offensiveroles — particularly where we’re go-ing to get our points from.”
Points were hard to come by forBlake in its first two games — lossesto Wheaton (48-46 on Dec. 5) andQuince Orchard (60-56 on Dec. 9)that Wiggins said “kind of deflatedus.” Life without a go-to scorer wasproving to be more difficult than theteam had first imagined.
“[The losses] definitely madeus come closer together,” Wigginssaid. “There was a purpose behindit because we had to look at our-selves, and quickly we stopped tak-ing things for granted. I think thekids and the coaching staff realizedwe weren’t necessarily as good as wethought we were. So, to experiencethat 0-2 start to the season, kind of
Blake’s balancing act
SILVER SPRING | TAKOMA PARK | WHEATON | BURTONSVILLE
See BLAKE, Page B-2
1930876FEATURED LENDER/BROKERCall this provider today for your mortgage needs!
HELIO SOUZANMLS #13003
***OTHER LENDERS PROMISE GREATSERVICE, AMERICA TRUST FUNDING
GUARANTEES IT***
CALL
(301) 881-5555FOR FREE CONSULTATION
NMLS
1522
SPECIAL - 30 YEARS GOVERNMENT LOANS - 3.250%~APR 3.398%
100% FINANCE - VA LOAN - 30 YEARS - 3.250%-APR 3.398%97% FINANCE AND NO MORTGAGE INSURANCE
CONVENTIONAL LOAN AMOUNT TO $417,00030 YEARS @ 3.625%-APR 3.798%15 YEARS @ 2.875%-APR 2.998%
AND 5/1 ARM @ 2.50%-APR 2.673%
LOANS FROM $417,001 TO $625,00030 YEARS @ 3.750%-APR 3.997%15 YEARS @ 2.875%-APR 3.047%
Rates subject to change without further noticeNOW OFFERING 95% FINANCE ON LOANS TO $625,500 AND NO MI
http://www.nmlsconsumeraccess.org
www.americatrustfunding.com
1909
729
T H E G A Z E T T EPage B-2 Wednesday, February 25, 2015 s
burg school history and it com-pleted the Coyotes’ sweep ofchampionship season. Satisfy-ingly, Mathias said, Clarksburgovercame a strong field to claimit.
“There’s no asterisk, soto speak, no, ‘You guys won,but...,’” Mathias said. “We wentout and won the largest classi-fication and we did it by step-ping up and performing. I’m soproud of the girls. This, in thewhole history of the school, thisis something that will always beremembered.”
Per the optic yellow t-shirtsthe Northwest boys have beensporting all season, the Jaguarswere on a mission this winterand it was to prove that lastyear’s first state indoor tracktitle was not a fluke, coach Rob-ert Youngblood said. Northwestfinished with 73 points, ahead ofBowie in second place with 55.The Bulldogs moved up fromoutside the top 5 with a strongsecond half of the meet. Flow-ers (40 points), Paint Branch(39) and Oxon Hill (36) finishedthird through fifth.
After solidifying their vic-
tory, Northwest athletes, whohad been wearing their shirtsinside out with the front read-ing, “Mission...,” flipped theirshirts back the right way to re-
veal the message, “Mission ac-complished.”
“We wanted to go whereother teams didn’t have any-one,” Youngblood said. “Wewanted to attack the spaces.”
The key to winning a 4Achampionship is quite simple,in theory, Mathias said: all thestar athletes have to show upand perform to the best of theirability. It’s not just about win-ning events, either, Mathiassaid. Every single scoring posi-tion, every single point, matters.
Five Clarksburg athletesscored four points or more,Monday. The Coyotes were ledby two-time reigning 55-meterhurdles champion Alexus Pyles,who also finished second in thehigh jump. Her younger sister,Cierra, finished fourth in thehurdles and seventh in the highjump, in addition to runningthe third leg of the 800 relay.Northwest senior Diego Zaratewon the 800 and 1,600 runs andjunior Shyheim Wright won the55 hurdles and finished third inthe high jump; teammate AaronBeidleman won the latter.
While those teams that havethe capacity to compete for anoverall championship certainlypride themselves on doingso, the state track meet is also
an opportunity for individualstandouts on less competitiveteams to shine.
Monday featured a numberof top-notch races and perfor-mances. Individual event win-ners from Montgomery andPrince George’s counties, in-cluded, Paint Branch’s AdassaPhillips (55 dash), Blake’s Mar-tha Sam (300 dash), Bowie’sTaylor Williams (500 run),Whitman’s Clare Severe (800run), Walter Johnson’s KiernanKeller (1,600 run), B-CC’s NoraMcUmber (3,200 run), BrenenGarrett (55 dash), Wootton’s Ja-ron Woodyard (300 dash), OxonHill’s Aaron Robinson (500 run)and Quince Orchard’s NoahVernick (shot put).
“This was the first statechampionship won by a girlsteam at our school and obvi-ously it’s been a goal of oursfor a long time,” Mathias said.“The girls were really phenom-enal [Monday]. I’ve always hadteams I thought could win butthey were never able to makethat breakthrough [before Mon-day].”
For complete results go towww.mpssaa.org.
TRACKContinued from Page B-1
fended 3-pointer?For some coaches, the de-
cision is relative to circum-stances. How good of a freethrow shooting team is theopponent? How much time isleft? Where are they inbound-ing the ball?
Longtime Kennedy boysbasketball coach Diallo Nel-son has mixed it up over his15 years at the Silver Springschool.
“If they’re going the lengthof the floor with three secondsleft on the clock, I’ve alwaysbeen a proponent of runninga zone press,” Nelson said.“... If there’s a situation wherethey’re taking the ball out athalf court and I’m up three andthere’s five seconds left whenthey catch it, I’m fouling.”
For others, like RiverdaleBaptist boys basketball coachLou Wilson, defense is theonly option. Over his 29 yearsof coaching, Wilson estimatesthat only two times has hismethod of locking down de-fensively and not fouling theopponent failed him.
“My approach to the situ-ation would be to play soliddefense and not foul — makethe other team make a toughshot,” Wilson said. “... I justtotally believe in my defense.I don’t really go into tryingto foul another team on pur-pose so they can’t get off a3-pointer. So I’d rather rely onthings that we work on daily,and that’s [playing] funda-mentally sound, man-to-mandefense.”
If a coach, like Wilson,elects to play defense, the se-quence often plays itself outlike any other throughout abasketball game — it comesdown to execution. But if acoach does elect to foul, anumber of other factors comeinto play.
Bowie girls basketballcoach Chris Ferguson beganthe 2014-15 season startingthree freshman, as injurieshad ravaged his lineup. In theBulldogs’ first home game ofthe season against Suitland,Ferguson instructed his teamto foul while going for the ball,but soon found out that it waseasier said than done. Someof his younger players didn’tknow how to intentionally
foul.“Our girls were actually
pushing instead of smackingdown at the ball,” Fergusonsaid. “I guess it’s one of thosethings like, ‘Hey, you’re in highschool. Even though you’re afreshman, someone should’vetaught you that when you foul,go for the ball.’”
A blatantly aggressive foul,particularly ones where thedefender neglects to go forthe ball and simply wraps upthe ballhandler in a bear hugof sorts, run the risk of beingwhistled as an intentional foul.That’s why Nelson, Pisarskiand most coaches inclined tofoul say they teach the properway to commit a foul in thosehigh-pressure situations. Nel-son said he will even let thereferees know prior to the in-bounds pass that his team istrying to foul.
In the end, some foul,some don’t. Some even foulup two points, like Ferguson’sBulldogs did so successfullyagainst Flowers two years ago.But in the end, there will neverbe a “correct” approach —only debate.
FOULContinued from Page B-1
BILL RYAN/THE GAZETTE
Northwest High School’s DiegoZarate runs the 1,600 meters duringMonday’s 4A/3A state meet.
n Barons senior, Bulldogsjunior sweep postseason
BY JENNIFER BEEKMANSTAFF WRITER
Don’t mind Bethesda-ChevyChase High School senior JackCrow. While most of his com-petitors at a given dive meet aretypically off listening to music tosettle their nerves before eachturnoff theboard, thePennStateUniversity recruit tends to belaughing to himself in a corner,he said.
“I get made fun of for this ata lot of club diving meets,” Crowsaid. “Everyone listens to musicbut I listentocomediansonPan-dora. So, I’ll be in a corner.”
Crow’s ability to keep thingslight in a pressure-packed situa-tion served him well in Friday’sstate diving competition held atthe University of Maryland, Col-legePark.Trailinghisgoodfriendand training partner, Spring-brook senior Mica Ho, for theentire evening, Crow’s 2014 statetitle defense came down to one
final dive.One near-perfect front 2 1/2
pike later and Crow had com-pleted his sweep of the 2015championship season with hissecond straight state title. Crow,who entered Friday’s competi-tion off wins at the WashingtonMetropolitan InterscholasticSwimming and Diving and Class4A West Region championshipmeets, edged Ho, 508.70-501.25,for the win. Quince Orchard’sJoseph Canova (491.50 points),Churchill’s Mory Gould (430.10)and Walter Johnson’s PatrickCollishaw (429.55) rounded outthe top 5.
While Crow said the win wasbittersweet — especially after Holed for themajorityof thecontest— it was the best way he couldimagine closing out his Baronstenure. He missed the postsea-son during his freshman yearafter breaking his collarbone in asnowboarding accident and fin-ished third as a sophomore.
“I was probably more ner-vousthanhewas[beforethat lastdive],” B-CC coach Jason Blan-ken said.
Also completing a champi-onship season sweep Friday wasthis year’s Metros and 4A WestRegion champion, Churchilljunior Elaina Faerber. This wasFaerber’s first state champion-ship appearance; teams are onlyallowed two entries and last win-ter she was Churchill’s No. 3.
After trading leads severaltime with teammate Kali Beckerin the final few rounds Friday,Faerber ultimately clinchedthe win, 451.05-441.90 over theUniversity of North Carolina re-cruit. Damascus’ Madeline Kline(422.25), Wootton’s Regan West-wood (416.05), who led for thefirst fourrounds,andSenecaVal-ley’s Hannah Montau (369.50)finished third through fifth.
Friday’s win, this entire sea-son, Faerber said, is the first timeshe’s felt truly at full strengthsince undergoing knee surgeryin eighth grade.
“I feel like this year my diveswere stronger, I got more heightoff the board,” Faerber said.
B-CC boy, Churchill girl dive to gold
shaped our season.”“Our first couple games, I
don’t think we scored muchmore than 50 [points],”Tempchin said. “... We reallyhad no idea who was scor-ing.”
Those two losses, as itturned out, proved to be theturning point for the Ben-gals. Not their Dec. 17 two-point upset of Springbrookor their two four-game win-ning streaks they’ve piecedtogether this season. No, itwas those two early-seasondefeats that gave Blake theidentity it had long waitedfor.
Tempchin, a facilitator bynature, answered the needfor scoring, transforminghimself into a combo guardof sorts while still managingthe Bengals’ offense. Sopho-more Kobe Colston, whotransferred from Springbrookover the summer, began todevelop his shooting touchas he became more and morecomfortable with the speedand physicality of the varsitygame. Other scoring options
began to blossom, like se-niors Nathan Bonsu, DexterGlen Jr. and Jordan Browne,and soon, Blake had turnedinto an opponent’s worstnightmare: a balanced team.
In the midst of Blake’smost recent winning streak,which included wins overKennedy, Paint Branch,Wootton and Northwood,the Bengals had a differentscoring leader each game. Onthe season, Blake boasts fiveplayers that average between12.2 and 7.4 points per game,making it tough for oppo-nents to game plan.
After time spent search-ing, Wiggins’ players finallydiscovered who they are: ateam, in every sense of theword.
“This year, there isn’ta, ‘I’m going to put you onmy back’ or, ‘We’re going tothis option at the end of thegame’ person,” Wiggins said.“It’s just knowing the teamyou have in front of you, andthat’s not this team.
“Is it a curse? It’s just ourmakeup.”
BLAKEContinued from Page B-1
THE GAZETTEWednesday, February 25, 2015 s Page B-3
BEST BETn Regional playoffs, TBD, Friday: The first round of
the MPSSAA postseason tournament is scheduledto tip-off on Friday. For full brackets and gametimes go to www.mpssaa.org.
BEST BETn Montrose Christian at Takoma Academy 7 p.m.
Thursday: The Tigers get to see how just far theprogram has come this season as they host thetop-ranked Mustangs.
BASKETBALL HOW THEY RANK
Also receiving votes: None.
The Gazette sports staff ranks the top 10 high school basketball teams inMontgomery County.
Boys
Rank School Record Points
1. Montrose Christian 21-3 602. Richard Montgomery 20-1 533. Magruder 17-4 494. Springbrook 17-3 364. Takoma Academy 24-5 366. Gaithersburg 16-5 327. Bullis 18-6 278. Bethesda-Chevy Chase 15-5 179. St. Andrew’s 21-6 1410. Quince Orchard 13-6 5
Girls
Rank School Record Points
1. Whitman 20-0 602. Paint Branch 20-1 543. Holy Child 21-4 454. Good Counsel 19-9 425. Wootton 18-3 386. Churchill 16-4 307. Walter Johnson 15-4 258. Sherwood 17-2 159. Damascus 14-6 1010. Covenant Life 23-4 7
Also receiving votes: Jewish Day (17-3) 4.
LEADING SCORERSPlayer, school Games Points Avg.Anthony Tarke, Gaithersburg 20 515 25.8Walter English,McLean 16 363 22.7Aaron Byrd, Landon 23 510 22.2Jauvenel Leveill Jr., Northwood 15 300 20.0JonathanMustamu, Kennedy 16 315 19.7Bryan Knapp, JewishDay 19 348 18.3David Levieddin, Hebrew 15 269 17.9DuaneDavis, Damascus 19 336 17.7Bobby Arthur-Williams, Cov. Life 17 296 17.4XavierMcCants, Sherwood 21 366 17.4
LEADING SCORERSPlayer, school Games Points Avg.DominiqueWalker,WatkinsMill 20 449 22.5DaisaHarris, Paint Branch 22 452 20.6Danielle Durjan,WatkinsMill 20 405 20.3Khadijah Pearson, Kennedy 17 248 17.6AbbyMeyers,Whitman 20 350 17.5Hope Randolph,Magruder 19 327 17.2Sheri Addison,Wootton 21 354 16.9Dalina Julien, Einstein 16 270 16.9Daphne Lerner, JewishDay 20 323 16.2Kaylan Jackson, Clarksburg 19 303 16.0
Coaches and team statisticiansmay email season team statistics to [email protected] beforenoon onMondays to be included.
n Lions hold off Flint Hillon the road to secure
conference title
BY ADAM GUTEKUNSTSTAFFWRITER
Just hours after a gruelingwinover St. James Sunday afternoon,St. Andrew’s Episcopal Schoolsenior Marcus Adkison couldn’tsleep. The point guard for theLions boys basketball team gotjust three hours of rest beforesomething woke him up, he said.Adkison climbed into an Epsomsalt bath and watched clips of hisfavoriteplayers—Michael Jordanand Kobe Bryant — throughoutthewee hours of themorning.Hetook in Bryant’s latest interview,highlights of his 81-point gameand a four-minute montage ofJordan highlights, appreciatingthe work ethic both superstarsemployedandwhathecalled“thedog”bothembodiedonthecourt.
“You got to have that dog ifyou want to win,” Adkison said,grinningashestoodoutsideof theLions’ locker roomminutes afterhis teamhadclinched itsfirst everMid-Atlantic Athletic Conferencetitlewitha60-54winMondayoverFlintHill (Va.).
In the fourthquarter, Adkisonbecamethedog,astheseniortookhis tenacity to another level, scor-ing 11 of his game-high 16 pointsin the final eight minutes to helpseal the historic win for St. An-drew’s.
After a Flint Hill 3-pointerbeat the third quarter buzzer tocut the Lions’ advantage to 40-38, Adkison drilled two consecu-tive 3-pointers to open the fourthquarter and set the tone for a St.Andrew’s team that previouslyhad never been further than thetournamentquarterfinals.
“I want my legacy to go out[in] my last game as, ‘Wow, hesteppedupwhenhisteamneededhim to,’” Adkison said. “I hadto be big. I had to do this for myteambecause once they saw that,theypicked it up ... I had to set thetone.”
The Huskies, playing on theirhomecourt, gaveSt. Andrew’s ev-erything they could handle in theclosing minutes, as a Tyler Femilayupintrafficgavethehostsa54-53 advantage with 1 minute, 49seconds remaining. A mid-rangejumpshotbytheLions’TylerStew-art on the other end stemmed theFlintHill run,givingSt.Andrew’salead itwouldn’t relinquish.
After George Muresan’s sec-ond of two free throws bouncedoff the rim with 10 seconds re-maining and the Lions leadingby three points, it was none otherthanAdkisonwhoflewintoswipethe ball away from the Huskies’point guard. Flint Hill was thentagged with an intentional foul asthe Lions wasted away the finalseconds of the game at the freethrow line before their capacitycrowd poured onto the oppo-nent’s floor as the final buzzersounded.
The title was the culminationof a vision Lions’ coach KevinJones had upon arriving at thePotomac school four years ago. Inhis first season at the helm (2011-12), Jones’ led St. Andrew’s to a9-17mark,going0-12 in theMAC.Each year, the Lions improved,recording 15 wins in 2012-13 and18 last season. Friday afternoon,the Lions got their first ever winin the MAC tournament, a 47-44winoverSidwell Friends.Mondaynight, theyhoisted theconferencetournament trophy— a transfor-mation that had Jones emotionalafterwards.
“It’s humbling,” the Lionscoach said. “I have a lot of peopleto thank: family, the community,friends, our players, parents. It’snot justme.Iknowit’seasytolookat me as the coach and think I’mresponsible for all this, but therewerea lotofpeople.”
“In the three years that I’vebeenplayingvarsity, it’ssuchabigchange,” senior Myles Law said.“There’snot reallywords.”
After enduring the years ofstruggle and the growing painsthat ensued, Jones’ dream thathe sold Adkison and Law on backwhen they were transfers lookingfor their next stop, finally materi-alizedMonday evening on a gymfloor inOakton,Va.
“In the beginning, it wasn’teasy,” Adkison said. “Nothing iseasy when you’re trying to get tothe top.”
St. Andrew’s roars to life on the court
n Bulldogs’ streak ends atthree straight league titles
BYADAMGUTEKUNSTSTAFFWRITER
ShortlyafterBullisSchoolboysbasketball coachBruceKelleyandhis staff made their way into thelocker room Sunday afternoon,the white walls of the Potomacschool’sbasementwereenergizedwith feverishchantsof “IAC, IAC,”as a teamother than the Bulldogshoisted the conference champi-onship for the first time in nearlyfour years. Episcopal (Alexandria,Va.) players stormed through thehallway almost as rapidly as theirsection of fans emptied onto theBullis court following one of thewildestfinishesof the season.
After Bullis junior guard AlexLeder sank two free throws to tiethe game with about 35 secondsremaining in regulation, Episco-pal narrowly escaped turning theball over, andwas granted a time-out with eight seconds left, an in-stantbefore theballbouncedoff aMaroonplayer’s foot.
Out of the timeout, EpiscopaljuniorpointguardNickReed,whohad tormented the Bullis defensefor most of the night, caught ahandoff pass outside of the arc,dribbled his way through an at-tempted trap and carved into thelane. Adjusting his shot inmidair,Reed willed the ball up to the rimas time expired, taking off in a fullsprint as the ball trickled throughthenet to seal a thrilling56-54vic-tory andendBullis’ reign atop theInterstateAthleticConference.
“Our defense was to notlet him catch it — that specificplayer,” Kelley said of the finalplay.“Buthe’sgoodandheplayeda real good game. ... At the end ofthe game, it’s just a good playermaking a really good play. Ourguysworkedhardand triednot tolethimcatch it, buthecaught it.”
Added Bullis junior JamalWright: “They set a screen and hejust got open. He’s a good player.
Good players are going to get theball in crunch time.”
Throughout the course of agame that changed leads manytimes, Reed’s tenacity in attack-ing the Bullis defense was a con-stant.TheMaroonguardattackedthe rim at will, using his body tomuscle himself to the basket andhis speed to beat his defenderoff the ball. Reed finished with agame-high 22 points on 8-of-22shooting.
“Way too often — that was aproblem,” Kelley said of Reed’sability to get to the basket. “Wewere trying to deny and not lethimget there ... Itwasnot theper-son covering him asmuch as the
support guys and the help guysaround him. He was quick andhe’sagoodplayer.Hemadesomereally decisive attack-the-rimplays.Buthegot too far.”
Though the outcomewas notwhat Bullis had hoped for, theresilience of a group that shouldreturn all but two players nextseason was yet another step inthis season’s maturation process,Kelley said.
“This really hurts,” Alex Ledersaid. “We’re coming out hungrynext year and we’re going to bemuch better. No one is going torecognizeusnext year.”
Bullis falls at horn in IAC final
BILL RYAN/THE GAZETTE
Bullis School’s Jamaal David’s (right) shot is challenged by Episcopal’s SergioPortobanco during Sunday’s IAC title game.
n Versatile Cougarsdefeat Grace Brethren,
win first title since 2012
BY ERIC GOLDWEINSTAFF WRITER
“Dynamic” is the wordCovenant Life School girlsbasketball coach Terri Mar-shall used to described herteam. The offense can hitshots from outside, workin the post and execute thefastbreak. On the other end,the defense can play man-to-man, zone, big, and small.
“We like to be a threaton all sides of the court,” thefirst-year coach said.
That versatility was onfull display Monday in thePotomac Valley Athletic Con-
ference title game, as the Cou-gars (23-4) defeated GraceBrethren, 57-46, to earn theirfirst championship since2012.
Sophomore forward Jor-dan Robinson dominated thepaint en route to a team-high14 points, while sophomoreKayla Merryman — namedMost Valuable Player — ledthe perimeter attack and had11 points.
The Gaithersburg schoolwas in control for most of thegame — held at Berman He-brew Academy in Rockville— but saw its double-digitlead cut to 48-46 in the fourthquarter.
Needing to put an end tothe Clinton school’s run, Mar-shall switched up the defensefrom a 2-3 to a 3-2.
What followed was a five-plus minute stretch whereCovenant Life held GraceBrethren (19-5) scoreless, andput the game away.
“They were killing us onthat outside shot, getting toomany looks ... they’re a toughteam,”Marshall said. “We hadto change our defense severaltimes.”
Covenant Life led 27-25after a back-and-forth firsthalf where it relied heavily onits perimeter shooting.
“I can’t really explain whatthis means,” said Marshall, a2001 Covenant Life graduateand former star basketballplayer. “I told them day one atpractice what I saw in them: achampionship team.”
Covenant Life recaptures PVAC crown
SportsBriefsMagruder wins race for No. 1
WhentheGaithersburgHighSchoolboysbasketball teamwalkedoff thecourt atRichardMontgomeryFridaynighton the short endofa76-75contest, theTrojansknewnothingofMagruder’s 68-59winover rival Sherwood.The tworesultslockedup the topseedandafirst-roundbye for theColonels in the4AWestRegionSection II. That teamsits at 18-4.TheColonelsbeatGaith-ersburg, theNo.2 seed, twice in theregular season.
—ADAMGUTEKUNST
Clarksburg seniors to signClarksburgHighSchool senior
football playersLarryEdwardsandAndreBrockareexpected toattend
collegeandplay football atHudsonValleyCommunityCollege inAlbanythis fall, according toCoyotes coachLarryHurd.Edwards, adefensivelineman, andBrock, amiddle line-backer, played integral rolesonastoutdefensewhich led theCoyotestoa7-4 recordandplayoffberth lastseason.
TheCoyotes’ offensiveplay-makeranddynamickick returner,TavisHolland, is expected tocon-tinueplaying football at LackawannaCollege inPennsylvania.Receiverand linebackerBarrigtonDaviswillalsobeplaying football atNassauCommunityCollege inNewYorkandoffensive linemanJimDeluziois set toattendMassachusettsMari-timeAcademy.
—PRINCE J.GRIMES
Georgetown Prep finishesthird at prestigious national
swim meetTheLittleHoyasfinished third
at the115thAnnualEastern Inter-scholastic SwimmingandDivingChampionshipsheldFridayandSaturdayatLaSalleUniversity inPennsylvania.Easterns is the larg-estPrepSchool aquatic event intheUnitedStates, according to themeet’swebsite,wheremorenationalandprepschool swimming recordsare set thananyother competitionin thecountry.
Behind top5performances insixof 11 races,GeorgetownPrepfin-ishedwith286points.
—JENNIFERBEEKMAN
154599G
THE GAZETTEPage B-4 Wednesday, February 25, 2015 s
154598G
THE GAZETTEWednesday, February 25, 2015 s Page B-5
THE GAZETTEPage B-6 Wednesday, February 25, 2015 s
n Former Trojans girlsbasketball stars team up
BYERICGOLDWEIN
STAFFWRITER
ColleenMarshall had wantedtoplaybasketball incollege—justnotatthesameschoolasheroldersister,KaraMarshall, she said.
So after graduating fromGaithersburg High School (Classof2012), thetwo-timestatecham-pion ended upwith the women’steam at East Carolina University,instead of accepting an offer toplay at Loyola (Md.) with Kara(2011).
“Out of high school — andKaraknowsthis—Ididn’twanttogotothesameschoolasher. Ikindof wanted to do my own thing,”Colleensaid.
Colleendid doher own thing,as the sisters enrolled at schoolsthatwere300-plusmiles apart.
But the two, inseparable formost of their childhood — “Wegrewuponadirtcourt inourbackyard playing one-on-one everyday,” Kara said — wouldn’t stayapart for long.
In December 2013, Karalearnedthatshewaspregnantandhad to stop playing midseason.Colleen, at this time, was growingfrustrated with the direction thatECU’s basketball program wasgoing, she said. Shewas consider-ing dropping the sport altogether,but after learning that Kara wasexpecting a child, she realized shewanted to be closer to her oldersister, and that continuing to playcollege basketball was the best
way tomake thathappen.Colleen’s decision was be-
tween American and Loyola, andthe younger Marshall ended upchoosingtoplayatthelatterundercoach JoeLogan.
This year, for the first timesince their 2011 state title run,the two are teammates. It’s notquite the sameaswhen theywereteenagers. Kara, who gave birthto her son in August, is now bal-ancing being a mother, studentand athlete. She is still rusty andplaying her way into game shapeafter joining the teammidseason—she had taken the fall semesteroff while caring for her newborn.Colleen, on the other hand, hasmade an immediate impact andis Loyola’s leading scorer (13.8points per game) after coming offthebenchat ECU last season. ShehadoneofherbestgamesonFeb.14, dropping 35 points in a 66-55winoverBostonUniversity.
“Like her sister, she’s really,really competitive, loves her teamandwantstowin,”Logansaid.“…Hopefully down the stretch wecanget themonthefloor togetherandget themgoing.”
The arrangement makesthings easier not just on Kara, butalso her family. Kara and Colleenare the youngest of seven. Theirmother, Dottie Marshall, no lon-ger has to make the four-plus-hour drive to ECU, and insteadcan watch the game at the muchmoreaccessibleBaltimoreschool,taking turns holding the babywith her friends and family in at-tendance.
Gaithersburg sistersreunite at Loyola
LOYOLA ATHLETICS
Gaithersburg High School graduate Kara Marshall (right) is playing women’sbasketball at Loyola.
n Distance freestylermoved from Floridato train with KatieLedecky’s coach
BY JENNIFER BEEKMANSTAFF WRITER
If there’s one thing theworld’s best athletes havein common, it’s likely theiraversion to failure. Yet partof achieving greatness is thewillingness to put oneself in aposition falter, Nation’s Capi-tal Swim Club’s GeorgetownPrep site coach Bruce Gem-mell said. And the two-timereigning American Swim-ming Coaches AssociationCoach of the Year, who hasguided Stone Ridge senior Ka-tie Ledecky to the top of theswimming world in the pastthree years as well as his son,Andrew, to the 2012 LondonOlympics, would know.
“I think there is some in-nate mental makeup where[top athletes] hate to lose andyet they’re still willing to putthemselves in an environ-ment where they’re going to,”Gemmell said. “You cannotalways expect to win. Somedays you’re going to lose,whether it’s to a training set,against the clock, to [trainingpartners] in practice. Thosewho avoid the risk of losing,don’t tend to succeed. Somedays you’re going to lose andthat’s going to make you bet-ter.”
Not everyone is cut outfor that, Gemmell admitted,it requires a unique level ofmental fortitude. And not ev-eryone can make it in the ul-tra competitive atmosphereof his elite training groupof about 15 athletes — heoversees a total of about 160swimmers, ages 8-18. ButGeorgetown Prep sophomorefreestyler Matthew Hirsch-
berger has thrived in the13 months since uprootinghimself from everything hehad known and moving fromFlorida to Bethesda with hismother and sister — his fa-ther still lives in the SunshineState but visits as often aspossible — to train with thelikes of Ledecky and AndrewGemmell under the elderGemmell.
“Something Bruce toldme was that there are upsand downs in the sport andyou just have to enjoy theride,” said Hirschberger, whohas his sights on making theOlympic team one day. “Thepractices are hard and I don’talways enjoy those but that’sdefinitely how I’m getting towhere I want to be and howI’m going to go the times thatI want. Bruce is very encour-aging during practice, he’ll[get me to do things I don’tthink I can].”
Earlier thismonth,Hirsch-berger won all three events hecontested at the WashingtonMetropolitan InterscholasticSwimming and Diving Cham-pionships, breaking recordsin two, en route to finishing
in a four-way tie atop the in-dividual scoring leaderboard.After setting a GermantownIndoor Swim Center pool re-cord in the 200-yard freestyle,Hirschberger won the 500 bymore than five seconds — heseemed to get faster as therest of the field faded — andswam the third leg of theMet-ros record-setting 200 free-style relay.
In the past few monthsHirschberger has set USASwimming National AgeGroup (16) records in twoevents — 200-meter freestyle(1 minute, 52.88 seconds) and400-meter freestyle (3:56.27)— and has posted top 4times in five others. His 200-yard freestyle time at Met-ros (1:37.13) is the nation’sfourth-fastest and the 4:17.13he swam in the 500 freestylepreliminaries is the country’ssecond-best. He also has top2 times in the 1,000-yard free-style (8:58.21) and 1,650 yards(14:.51.81) as well as the 1,500meters, all in the 16-year-oldage bracket.
While his strength lies indistance swimming, Hirsch-berger’s 21.14 split in his 50
during the relay proves he’sfar from one-dimensional.
“He’s a very determinedswimmer. He hates to lose sohe will give you everything hehas all the time,” Prep coachMatt Mongelli said. “Justfrom the 1,000, on, if you’renot feeling good, it’s notlike it’s going to be over anytime soon. He has the mentaltoughness to push through.The longer [a race is] thefaster he seems to get.”
A trait for many greatathletes, Gemmell said, isthat they make those aroundthem better. Training withand having the support of An-drew Gemmell and Ledeckyhas been an invaluable ex-perience, Hirschberger said.It’s one more swimmers withsimilar grand aspirations arelikely to seek out.
“It’s definitely possible,that’s kind of what happenedwith us,” Hirschberger said.“We saw how well Katie wasdoing and came to talk toBruce and it’s worked out.”
Georgetown Prep sophomoreswimmer embraces ups and downs
TOM FEDOR/THE GAZETTE
Georgetown Prep swimmer Matthew Hirschberger practices Friday with other youth under the guidance of coachBruce Gemmell (top).
Hirschberger
1931964
ANY CARANY CONDITION
WE PAY TOP DOLLAR-FASTFREE PICKUP!
SELL YOUR CAR TODAY!CALL NOW FOR AN
INSTANT CASH OFFER
(301)288-60091932836
CA HCA HFOR CAR !FOR CAR !
1933
190
DATESDATESFebruary 26 • March 26 • April 23 • May 21 • June 25
TIMETIME8:00 AM - 10:00 AM
LOCATIONLOCATIONUnited Therapeutics Education Center
1040 Spring Street, Silver Spring, MD 20910Breakfast will be provided courtesy of Geppetto Catering.
Bea has helped Aetna, Allstate, Bank of America, FedEx, HP,IBM, Levi Strauss & Co., Toyota, The Walt Disney Company andmany other companies develop and enhance their communityinvolvement programs through strategy development,program design and measurement.This series will focus on building a high-impact employeevolunteer program and is relevant to businesses of all sizes.
2015 Education Series with Bea Boccalandro
Present
LEARN MORE AND REGISTER AT CVC-MC.ORG.LEARN MORE AND REGISTER AT CVC-MC.ORG.
THE GAZETTEWednesday, February 25, 2015 s Page B-7
Apartments Apartments Apartments Apartments Apartments Apartments Apartments Apartments Apartments Apartments
Apartments Apartments
Real EstateOpportunities
Houses for SaleMontgomery County
Houses for SaleMontgomery County
Lots/Acreage
Real EstateAuctions
Real EstateAuctions
Houses for RentMontgomery County
Houses for RentMontgomery County
Unfurnished ApartmentsMontgomery County
CondominiumsFor Sale
CondominiumsFor Rent
SharedHousing
SharedHousing
SharedHousing
SharedHousing
Vacation Propertyfor Sale
Real EstateOpportunities
Call 301-670-7100 oremail [email protected]
BUY IT,SELL IT,FIND IT
SELL YOURVEHICLE
CLASSIFIEDDEADLINEMonday 4pmAs Low
As$3999
• Domestic Cars• Motorcycles• Trucks for Sale
• Furniture• Pets• Auctions
• Homes for Sale• Condos for Rent• Shared Housing
• Career Training• Full Time Employment• Part Time Employment
CCLLAASSSSIIFFIIEEDDSSCCLLAASSSSIIFFIIEEDDSSCLASSIFIEDS
to advertisecall
301.670.7100or email
HUD In-house Section 8Waitlist has CLOSED asof Fri 02/20/15 at 3:00 pmNewly upgraded apartmentcommunity featuring all new: (1,2, 3 bedroom apts available)
µFitness CenterµBusiness CenterµWoof-N-Wag Dog ParkµOutdoor grill and picnic area
17 Featherwood Court, #14Silver Spring, Maryland 20904
301-622-2110SpringParcApts.com EHO
GLEN BURNIE OF-FICE CONDO FORRENT BY OWNERZoned C-2 Professio-nal; This ground floorunit has private en-trance, contains indi-vidual heating andA/C, fully carpeted,private lavatory &plenty of free & onsiteparking. 743 sq. ft.Glen Prof. CenterCrain Hwy, S.W. Call 8am to 4 pm 410-582-0601
CCAALLLL FFOORR SSPPEECCIIAALLSS
(301) 460-16473004 Bel Pre Rd., Apt. 204,Silver Spring, MD 20906
STRATHMORE HOUSESTRATHMORE HOUSEAPARTMENTSAPARTMENTS
kSwimming PoolkSwimming Pool
kNewly Updated UnitskNewly Updated Units
kSpacious Floor PlanskSpacious Floor Plans
kSmall Pets WelcomekSmall Pets Welcome
kBalcony PatiokBalcony Patio
kFamily RoomkFamily Room
kFull Size W/DkFull Size W/Din every unitin every unit
G557954
SILVER SPRINGSILVER SPRING
ROCKVILLEROCKVILLE
Office Hours: M-F 9:00am - 6:00pm
• Emergency Response System• 24 Hour Maintenance• Transportation Via Community Van• Pet Friendly• Full Size Washer & Dryer
www.PinnacleAMS.com/GardensOfTraville
14431 Traville Garden CircleRockville, Maryland 20850
301-762-5224X
Senior Living 62+Senior Living 62+
DON’TWAIT APPLYTODAY!DON’TWAIT APPLYTODAY!GAITHERSBURGGAITHERSBURG
WEDNESDAY
OPEN HOUSECOFFEE SOCIAL11AM-1PM
• Free membership to Kentlands Citizen’s Assembly• Planned Activities • Transportation • Emergency Pull Cords • Controlled Access
Kentlands Manor Senior Apartments217 Booth Street, Gaithersburg, MD [email protected]
Advertise YourApartment Community
Here!and reach over 350,000 readers!
Contact: Ashby Rice (301) 670-2667for pricing and ad deadlines.
GAITHERSBURGGAITHERSBURG
301-948-8898
• Huge Floor Plans • Large Walkin Closets• Private Balcony/Patio
• Fully Equipped Kitchen w/Breakfast Bar• Minutes away from I-270, Metro, and MARC Train
SSTTRREEAAMMSSIIDDEE AAPPAARRTTMMEENNTTSSSSTTRREEAAMMSSIIDDEE AAPPAARRTTMMEENNTTSSSTREAMSIDE APARTMENTS
(888)303-1868
An Active Senior Apartment CommunitySituated In the heart of the Kentlandsneighborhood with all the benefits ofsmall town living, with the excitement ofthe city life!
DISCOVER DELA-WARE’S RESORTLIVING WITHOUTRESORT PRIC-ING! Milder winters &low taxes! GatedCommunity withamazing amenities!New Homes $80’s.Brochures available ]1 - 8 6 6 - 6 2 9 - 0 7 7 0www.coolbranch.com
GC3460
MONTGOMERYV I L LAGE : 4 B D2.5BA SFH in Plea-sant Ridge. 2,645 sqft. Deck, fenced patio,hw floors, new paint.$475K. 240-271-2903
W E E K E N DGETWAY CABINAND 3+ AC. CLOSETO 200 AC. LAKEMOUNTAIN VIEWS$67,900 Secludedwooded parcel withlog Sided cabin shell,easy access, Shortdrive to DC, financingCALL OWNER 800-888-1262
Bank Owned On-siteREAL ESTATE AUCTIONGermantown, MD
20208 Thunderhead Way3Br, 2.5Ba, 1188 sq
Single Family ResidenceSale Date: Sat April 4th at 10am
FREE BROCHURE800-260-5846
www.auctionservicesintl.comPaul Sobwick (MD) Auctioneer
5% Buyers Premium
GAITH: 4Br 3Ba, 3lvlTH, Spacious, Bsmt,Deck, W/D nr Mid Cty& ICC. $1650 + utilsCall: 240-780-1770
GAITH: 4 BR TH, 2.5BA, Hrd wood flrs. Finwlk-out bsmt. Nr busline. $1700/mCall: 240-386-7891
GAITHERSBUG:3BD, 2FB, 2HB TH.Bsmt, util RM W/D,yard. New carpet &paint. Nr bus, mall.$1800. 301-580-6663
GAITHERSBURG:4Br 3.5Ba SFH.Remod. Near shops &transp. $2150 HOC okCall: 301-908-9627
GERM: 3BR/3BA 3lvlTH. New pnt, crpt,fnsh bsmnt, FP, W/D,wetbar. $1650 + utils.202-538-1255
MONT. VILLAGE:TH, 3Br, 2FBa, 2 HBa,bsmnt,HOC OK nr bus& shop $1850 301-787-7382 or 301-787-7583
MT AIRY: In MoCo3Br, 2Ba, quiet area,fully renov. lrg yrd,NS/NP, $1500 + utils& SD 301-831-5170
WHEATON 4BR,2BA Brick Rambler, 2lvls, fncd yard, drive-way, quiet street. Availnow $2000/mo 1519Jasper St., Wheaton20902. 301-253-3061.
GAITHERSBURG:1Br, 1Ba, 1st mo rentis free! $99 S/D, up-dated interiors, $1050+elec 240-224-7367
GAITHERSBURG:2Br, 1Ba, 1st mo rentis free! $99 S/D, up-dated interiors, $1250+elec 240-224-7367
KENSINGTON: 2 Brin bsmt, priv entr & Ba,w/d, kit nr bus/495,NIH 1400sf, $1800 incutils SD 301-518-2650
SILVER SPRING:3Br, 1Ba, $1300 walkto school, 605 SilverSpring Ave, HOC wel-come 240-353-8500
URBANA: Lrg & lux-urious, 3Br, 2.5Ba,many options, 2 lvl,3000sf, assumable VAloan, 3.3% 30 yr fixCall: 301-758-8001
BETHESDA: 2Br,1Ba, walk to Mont Mall& trans hub, $1600 moincl gas/water, NP/NS240-357-0122
CHEVY CHASE:1BR 1BA RenovatedKit & Ba, new w/d, lgbalcony, 24 hr. con-cierge, parking utilitiescable pool gym sauna.$2,100. 301-897-9188
GAITHERBURG:Spacious. Near ShadyGrove. 3rd flr 2Br/2Ba+Den, new Kit. $1695util incl. 240-994-9993
GAITH:FIRESIDECONDOS: 3Br, 2fullba, balc. $1800 utilsincl. HOC Welc. Avail03/01 call 301-535-3017
MONTGOMERYVILLAGE: 2br/2bafully renovated condoavail now $1550 utilsincl. 917-544-6744 or240-449-9754
SILVER SPRING:2br/2ba condo, balc,all utils incl $1600.Section 8 welcomed.240-552-5929
BOWIE: Bsmt inSFH, $900/mo inc util,Free Cable. NS/NPAvailable March 2ndCall: 301-509-3050
BURTONSVILLE:Furn/Unfurn, 1 Br inbsmt, w/priv full Ba, nrbus & shops $600 incutils 240-486-4918
GAITHERSBURG:1 Br nr Metro/ShopsNo Pets, No Smoking$385 Avail Now.Call: 301-219-1066
GAITHERSBURG:Basement in TH. Priventr,/BA, full kit., pkg.$1,000 incl. utils.NP/NS. 240-372-8575
GAITHERSBURG-Bsmt apt 3BR 1 FullBA, priv entr, micro-wave & refrigerator,new carpet & paintW/D $900 utils cabtv &internet incld close tometro station & buscall 240-751-2533
GAITHERSBURG:Master BD $800 utilsincl. addtl BD $500utils incl. walk in closet& BA. 240-938-3123
GAITHERSBURG:Near Costco Male, 1brshr ba $450 utils incl.1/mo S/D. Avail now!301-340-0409
GAITH/FLWR HILL:1BR Bsmt Apt. in SFH,3/acres, prvt entr. allutils, CATV & I-net$1,000. 301-869-1954
GERMANTOWN:Lrg Br $550 utils inclshrd Bath & kitchen, nrbus & shops. Availnow call 301-920-4988
GERMANTOWN:Rm for rent in TH nrbus & shopping center$550/mo util includeNP/NS 240-715-5147
GERMANTOWN:Spacious1 Br bsmt Aptw/priv entr in SFH, F,NS, $899/mo inc util301-260-1005 (11am-8pm)
GERM: Full basmt inTH $550. Utils & SecDep Requ. NS/No petsAvail 02/3 Call 202-491-1565
LAKE WHET-STONE: TH toShare $700 inc. utiland wifi. NP. $500sec dep.240.750.8832
LAUREL: Lrg furn orunfurn room w/priv Ba,nr Marc train, NP/NS$625/month inc utilsCall: 301-792-8830
LEISURE WORLD:1BR, 1BA in 2BR Con-do. shrd LR, kit, DR,W/D. $725 incl utils.Must be at least 50 yrsold. 443-687-3881
SILVER SPRING:1 Br, shrd Ba, nrmetro/bus, shops,$500 month inc utilsCall: 301-233-8227
SILVER SPRING:3Br, 1.5Ba, SFH, walk-out bsmt, rec room,updated kit, W/D,fenced yrd, deck,NP/NS $1700/mo +utils 301-253-1646
SILVER SPRING:Fem, 1Br, priv Ba, nrbus/metro/shops, NS,$850 include utils Call:301-768-1329
SILVER SPRING-Room avail now! $395shared kitchen, bath&utils nr public transp.Call 301-404-2681
SS/LAYHILL MBr inTH w/priv Ba Femaleonly nr Bus/Shops.$675 utils incl + SD703-914-5555
WHITE OAK: BR inSFH. Quiet Neighbor-hood $550/mo utilitiesincluded. NS, No PetsCall 202-994-5534
OCEAN CITY,MARYLAND. Bestselection of affordablerentals.Full/ partial weeks.Call for FREE bro-chure. Open daily.Holiday Resort Serv-ices. 1-800-638-2102.Online reservations:www.holidayoc.com
Page B-8 Wednesday, February 25, 2015 s
BusinessOpportunities
Full TimeHelp Wanted
Auctions Auctions
Yard/Garage SaleMontgomery County
Yard/Garage SaleMontgomery County
MiscellaneousFor Sale Firewood
Pets
BusinessOpportunities
BusinessOpportunities
LegalNotices
LegalNotices
MiscellaneousServices
CareerEducation
ProfessionalServices
LicensedDaycare
LicensedDaycare
LicensedDaycare
LicensedDaycare
Full TimeHelp Wanted
CareerTraining
CareerTraining
Full TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
It’sFREE!
Buy It,
Sell It,
Find It
GazetteBuyandSell.com
HUNT AUCTIONSunday, March 1st, 10AM
At Hunts Place19521 Woodfield Road (Rt 124)Gaithersburg, MD 20879
Furn-Collectables -Sportscards-Gd stuff301-948-3937 - Open 9:00 AM#5205 Look on Auctionzip.com
Join 400+ familiesconsigning at our HOLIDAY
SALE !!Montgomery Fairgrounds
16 Chestnut StGaithersburg, MD 20877
(use Chestnut or Dalmar entrances)Fri. 03/06 9a-7p, Sat 03/07 9a-5p
Sun 03/08 10a-4p Many Items 50% Off,Mon 03/09 9a-10a (Dollar Dash)
FREE ADMISSION!Baby To Teen: Toys, Clothes,
Books, Baby Equipment & More!!!!Consignors Wantedwww.totswap.net
GET THE BIG DEALFROM DIRECTV!Act Now- $19.99/mo.Free 3-Months ofHBO, starz,SHOWTIME &CINEMAX FREEGENIE HD/DVRUpgrade! 2014 NFLSunday TicketIncluded with SelectPackages.New Customers OnlyIV Support HoldingsLLC- An authorizedDirecTV DealerSome exclusionsapply - Call for details1-800-897-4169
ACORNSTAIRLIFTS NEWSTRAIGHT OR CUS-TOM CURVEDRAYMOND MAULE &SON ESTABLISHEDMARYLAND 1929STILL FAMILYOWNED FREE ESTI-MATES SAVE$200.00 888-353-8878ANGEL OR KATHY
PROTECT YOURHOME - ADT AU-THORIZED DEAL-ER: Burglary, Fire,and EmergencyAlerts 24 hours aday , 7 days aweek! CALL TO-DAY, INSTALLEDTOMORROW! 888-858-9457 (M-F 9am- 9 pm ET)
ACORNSTAIRLIFTS. TheAFFORDABLE solu-tion to your stairs!**Limited time -$250Off Your StairliftPurchase!** Buy Direct& SAVE. Please call1-800-304-4489 forFREE DVD andbrochure.
Daycare DirectoryDamascus Licensed Family Daycare Lic#: 139094 301-253-4753 20872Children’s Center Of Damascus Lic#: 31453 301-253-6864 20872My Little Lamb Daycare Lic#: 51328 240-498-4599 20877GG’s Little Angel Daycare Lic#: 152997 301-926-6062 20879My Little Place Home Daycare Lic#: 131042 301-947-8477 20886Emmanuel Learning Child Development Center Lic#: 200019 301-622-0777 20904Starburst Child Care Lic#: 159882 301-674-4173 20855Learn And Play Daycare Lic#: 250177 240-408-6532 20876Happy Tots Family Daycare Lic#: 250166 301-365-5618 20852
DEADLINE: MARCH 2nd, 2015 GGPP22119977AAGP2197A
GC3440
NURSING ASSISTANTTRAINING IN JUST 4 WEEKS
GAITHERSBURG CAMPUSMORNING STAR ACADEMY
101 Lakeforest Blvd, Suite 402Gaithersburg, MD 20877Call: 301-977-7393www.mstarna.com
SILVER SPRING CAMPUSCARE XPERT ACADEMY
13321 New Hampshire Ave, Suite 205Silver Spring, MD 20904Call: 301-384-6011www.cxana.com
Now enrolling forMarch 23rd, 2015 classesCALL FOR DETAILS!
Certified Nursing AssistantsPotomac Home Support is hiring Maryland certifiedCNA’S for 2 hour cases in Montgomery County. Mostcases are in upper Montgomery County and SilverSpring. It is possible to see multiple patients per day.Must have car, current MD Certification and CPR.
Prefer bi-lingual in Spanish and/or French. Cases are inthe morning to early afternoon.
Please email resume to [email protected]
FIREWOOD FORSALE
$250/cord$150 per 1/2 cordµ Includes Deliveryµ Stacking Extra
ChargeAsk for Jose301-417-0753301-370-7008
ENGLISH BULL-DOG PUPPY:11 weeks old, AKCRegistered, up-to-datewith vaccines and de-wormed, vet checked,comes with a yearhealth guaranteed,$800 Email: [email protected]
PROFESSIONALSERVICES: Workfrom home online.Sales Talent?Comm + [email protected]
MEDICAL BILLINGTRAININGPROGRAM! Train toprocess insurance andMedical Billing fromhome! NO EXPERI-ENCE NEEDED! On-line training at CTIgets you job ready! HSDiploma/Ged &Computer / In te rne tneeded. 1-877-649-2671.
AVIATION GRADSWORK WITHJETBLUE , Boeing,Delta and others- starthere with hands ontraining for FAA certifi-cation. Financial aid ifqualified. Call AviationInstitute of Mainte-nance 866-823-6729
ABANDONED VESSEL NOTICEAbandoned boat located at 14904McIntosh Ct. Silver Spring, Md.20905. 12 ft. Alumacraft boat.Hull I.D. # MDZ47287F600. If ves-sel is not claimed within 30 days ofpublication date applicant will seektitle.
Contact: [email protected]
(2-25-15)
DONATE AUTOS,TRUCKS, RV’S.LUTHERAN MIS-SION SOCIETY.Your donation helpslocal families withfood, clothing, shelter,counseling. Tax de-ductible. MVA License#W1044.410-636-0123 orwww.LutheranMission-Society.org
ALL THINGSBASEMENTY!Basement SystemsInc. Call us for all ofyour basement needs!Waterproofing? Finish-ing? Structural Re-pairs? Humidity andMold Control FREEESTIMATES! Call 1-800-998-5574
DISH TV RETAIL-ER . Starting at$19.99/month (for 12mos.) & High SpeedInternet starting at$14.95/month (whereavailable) SAVE! AskAbout SAME DAY In-stallation! CALL Now!800-278-1401
GOT KNEE PAIN?BACK PAIN?SHOULDER PAIN?Get a pain-relievingbrace -little orNO cost to you. Medi-care Patients CallHealth Hotline Now! 1-800-900-5406
GET CABLE TV,INTERNET &PHONE with FREEHD Equipment and in-stall for under $3 aday! Call Now! 855-752-8550
WHEELCHAIR ANDSCOOTER RE-PAIR. Medicare Ac-cepted. Fast FriendlyService. BBB Rated.Loaners Available.CALL 1-800-450-7709
AUTOMOTIVE
MULTIPLE LUBETECH POSITIONSMOBIL LUBE EXPRESS
in Kensington, MD. Experiencepreferred, but will train the
right person!APPLY IN PERSON AT:10635 Connecticut Ave.
Kensington, MD.
AVON - Earn extraincome with a newcareer! Sell fromhome, work online.$15 startup. For infor-mation call: 888-423-1792 (M-F 9-7 & Sat9-1 Central)
MEDICAL BILLINGTRAINING PRO-GRAM ! Train toprocess insuranceand Medical Billingfrom home! NO EX-PERIENCE NEED-ED! Online trainingat CTI gets you jobready! HSDiploma/Ged &Computer/Internetneeded. 1-877-649-2671
GET CASH NOWFOR YOUR ANNU-ITY OR STRUC-TURED SETTLE-MENT. Top DollarsPaid. Fast. No HassleService! 877-693-0934(M-F 9:35 am - 7 pmET)
PROBLEMS WITHTHE IRS ORSTATE TAXES?Settle for a fraction ofwhat your owe! Freeface to face consulta-tions with offices inyour area. Call 855-970-2032
GC3427
GC3421
Full Time Culinary ServicesAssistant ManagerLess than Part Time CulinaryServices Associatesfor various shiftsPRN EnvironmentalServices Associatefor various shifts
Brooke Grove Retirement Village is an Equal Opportunity Employer
E-mail resume: [email protected] apply in person at:
18100 Slade School Road, Sandy Spring, MD 20860Direct any questions to the HR department at
301-924-2811, option 3
CARPENTERExperienced carpenter needed for CWC
Remodeling, Inc. Rockville, MD, send resume to:
Construction InspectorsENR Top 100 firm has immediate openings forhighway construction inspectors. Roadway andpaving experience preferred, but not required.Experienced and entry level positions available.
Exceptional benefit package.Please email resume to [email protected].
An Equal Opportunity Employer.
DIRECTOR OF MAINTENANCEThis FT position requires the Director of Maintenance to have aminimum of 5 years experience. Must be able to estimate jobsand prepare bids, oversee technicians and perform maintenanceand construction repairs at various homeowner and condominiumassociation properties, in Mont. Co., including both interior andexterior work such as carpentry, plumbing, concrete repairs,landscaping/work, trash removal & hauling, and painting.Responsible for managing all company resources, tools, materialsand equipment. Candidate must be able to lift 80 lbs minimumand have current MD driver’s license, MHIC license and able touse personal pickup truck and tools. This position includesbenefits, and mileage reimbursement. Please fax resumeincluding work history to 301-353-0369, Attn: "HR Director".
GC3426
Real Estate Silver Spring
Work with the BEST!Be trained individually by one of the area’s top offices & one of the area’s bestsalesman with over 34 years. New & experienced salespeople welcomed.
Must R.S.V.P.Call Bill Hennessy
330011--338888--22662266330011--338888--22662266301-388-2626bill.hennessy@longfoster.com • Long & Foster Real Estate, Inc.
EOE
GC3425
Healthcare
ORAL SURGERY STAFFSurgical Assistant. Modern, caring Oral andMaxillofacial surgical office needs motivated,intelligent, friendly individuals to join our busy multi-location practice. Experience preferred. Pleasereply to 301-774-6200.
Dental/MedicalAssistantTrainees
Needed NowDental/Medical
Offices now hiring.No experience?Job Training& Placement
Assistance Available1-888-818-7802
CTO SCHEV
MEDICAL ASSISTANTOrthopaedic practice in Kensington has 2immediate full time openings for a MedicalAssistant. We are looking for a customer servicedriven, enthusiastic individual with strong patientcare and computer skills. We offer competitivesalary and benefits package. 1 to 2 yrs.experience preferred. Please email resume [email protected] or fax to: 301-962-7450
CLEANINGEarn $400+ per week. Monday-Friday OR Tuesday-Saturday.No nights. Must have own car
& valid. Drivers lic.Se Habla Espanol.
Merry MaidsGaithersburg 301-869-6243Silver Spring 301-587-5594
Computer Systems AnalystDB driven web apps/scripts onWindows/Linux platforms (Perl &MySQL). Master’s in Comp. Science &Engineering or related field. To apply:w w w . f a s e b . o r g / A b o u t -F A S E B / E m p l o y m e n t -Opportunities.aspx or send resumeto: Genetics Society of America, Attn:FASEB Human Resources, 9650Rockville Pike, Bethesda, MD 20814.www.genetics-gsa.org/careers/ EOE
DriversThe Shredding Company is seeking
PT/FT drivers. Must be self-motivated & responsible with cleanbackground. Duties include driving a
fully automated shred truck tolocations in DMV to secure &destroy confidential material.
Independent working environment &dedicated routes. Based in
Gaithersburg. MUST HAVE CLASSB CDL or driving experience. For
more information visitgazette.net/careers or call
301-325-5561. Email resumes [email protected]
Maintenance Technician IConcentric Security LLC is seekingquality entry level technicians to train
as FT technicians to maintainhydraulic & electrical vehicle. Basicmechanical/ electrical knowledge is
preferred but no experiencenecessary. More info visitgazette.net/careers. Send
resume to: [email protected]
OPTICAL FINISHINGOptical Company in SilverSpring needs an experiencedperson for our fast finishingdept,. Knowledge of alensometer and/or edger aplus! Only dependable peopleneed apply. Hrs of operationMon-Fri 9am-6pm. We areaccepting applications Mon-Fri 10am-4pm at 2401 LindenLane, Silver Spring MD 20910Bill White 301-585-9060
SEASONAL**EARN EXTRA INCOME**
Garden CenterMerchandiser
PT for Bell Nursery, anationally recognized grower& vendor is looking for
hardworking people to stockour products at a gardencenter near you. Must be
flexible for weekend work. Forjob descriptions and locations:
www.bellnursery.com
Wednesday, February 25, 2015 s Page B-9
Full TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
Part TimeHelp Wanted
Part TimeHelp Wanted
Part TimeHelp Wanted
Part TimeHelp Wanted
Full TimeHelp Wanted
Full TimeHelp Wanted
Part TimeHelp Wanted
Part TimeHelp Wanted
Career TrainingNeed to re-start your career?
PRN/On Call, GNA’s, LPN’s, RN’sNational Lutheran Communities & Services (NLCS) has beenblessed with a long tradition of service to people of all faiths. Since1890, we’ve helped people find wonderful choices for retirementliving, new options for financial security and expert services for healthcare and wellness. While staying rooted in our heritage, we havecontinued to plan for the needs of future generations we will serve.
The Village at Rockville is hiring for PRN/On-Call Staff forGNA’s, LPN’s, and RN’s (day and night shift). If you are looking for achange with competitive salary, and excellent benefits, please submityour resume at: http://www.nationallutheran.org/careers.National Lutheran Communities & Services is an EEO Employer.
Registered Nurse/ Bi-LingualPotomac Home Support is hiring Maryland certified RNs formonthly in home assessment in Montgomery County. These
visits are in conjunction with a MontgomeryCounty Government program. We are in need of bi-lingualnurses in Russian, Korean, Cantonese or Mandarin.
Email resume to [email protected]
Residential CustomerService Rep.
5+ years office experienceSend resume to [email protected]
RESIDENTIAL HVACINSTALLATION TECHSImmediate openings, 5+ years experience
Send resume to [email protected]
Education
TEACHERS /AIDES
Sunrise Learning CenterSeeks ft Pre- School Teachers/Assistant for pre-school center in
Gaithersburg. 90 hrs plusexperience or college credit in
ECE is needed.Call 301-208-6948
Repair Technician IConcentric Security LLC: is seekingfull time technicians to maintain,
troubleshoot and repair hydraulic andelectrical vehicle barrier equipment inthe DC/NOVA and surrounding areas.High School Diploma, PLC knowledgeand valid drivers license required.Send resume to [email protected]
More info visit gazette/net/careers
ReceptionistPart time. For busy Silver Spring doctors office.Must have at least 2 years office experience.Duties include answering phones, appointmentscheduling and medical filing. Email resume to:[email protected]
MARKETING ADMIN ASSISTANTThe Bethesda Soccer Club, a local non-profit youth organizationis seeking a Marketing Administrative Assistant to support theExecutive Director on marketing initiatives, website design andmanagement, as well as manage the social network communications.This position is targeted at 20 hours per week, with a flexible workschedule. Hourly salary is negotiable. Please submit yourresume to Bethesda Soccer Club; 9107B Gaither Road;Gaithersburg, MD 20877 or fax to 240-403-7501.Deadline for submissions is February 27, 2015. For moreinformation contact Brad Roos at [email protected] or visitour website at www.bethesdasoccer.org.
Maintenance EngineerPart Time. Hi-Rise Condominium in Rockville,MD is looking for an experienced part timemaintenance engineer. Must have experiencewith HVAC, electrical, plumbing, gas boilers,generators and fire systems. Position also requires24 hours Emergency On-Call. Please [email protected] or call 301-294-0303.
CommunicationsAssistant
Needed for a small company inSilver Spring, 15-20 hrs/week.Write/design charts, flyers, etc.for small co. Must be prof onMac, Excel, Publisher.
Please send resumes to:[email protected].
Page B-10 Wednesday, February 25, 2015 s
THE GAZETTEWednesday, February 25, 2015 s Page B-11
AutoInsurance
CarsWanted
CarsWanted
CarsWanted
CarsWanted
ImportCars
CarsWanted
CarsWanted
Check out the Gazette’s auto site at Gazette.Net/AutosWith 2 great ways to shop for your next car, you won’t believe how easy it isto buy a car locally through The Gazette. Check the weekly newspaper forunique specials from various dealers and then visit our new auto website24/7 at Gazette.Net/Autos to search entire inventories of trusted localdealers updated daily.
Dealers, for more information call 301-670-7100or email - [email protected]
Deals andWheels
to advertisecall
301.670.7100or email
www.CapitalAutoAuction.comSince 1989
BUY BELOW KBB VALUE
RAIN OR SHINE!
WE HAVE VEHICLES FOR EVERY BUDGET AND NEED!
OPEN TO PUBLIC • ALL DEALERS WELCOME
Temple Hills, MD5001 Beech Road
Live/Drive Auction TimeSaturdays 9:00a.m.
Washington, DC1905 Brentwood Road
Live/Drive Auction TimeSaturdays 10:00a.m.
AUCTIONS EVERY SATURDAY
Call 301-640-5987or email [email protected]
G557454
3371 Fort Meade Road, Laurel1.855.881.9197 • www.ourismanvw.com
Ourisman VW of LaurelAll prices & payments exclude tax, tags, title, freight and $300 processing fee. Cannot be combined with any previous advertised or internet special. Pictures are for illustrativepurposes only. Special APR financing cannot be combined with sale prices. Ends 03/03/15.
OURISMAN VW WORLD AUTO CERTIFIED PRE OWNED29 Available...Rates Starting at 1.64% up to 72 months
Online Chat Available...24 Hour Website •Hours Mon-Fri 9 am-9 pm • Sat 9 am-8 pm G55
7457
OURISMAN VWYOU ALWAYS GET YOUR WAYAT OURISMAN EVERYDAY
2005 Toyota Scion..............V608066A, Gray, 90,560 Miles......................$5,9942005 Touareg SUV V8.........V002600A, Blue, 76,398 Miles..................$10,9912007 Mini Cooper S...........V0044181A, Silver, 36,693 Miles...............$11,7802009 Mini Cooper...............V008158A, White, 72,319 Miles, Clubman.......$11,9952011 Jeep Sport Compass...V629986A, Gray, 62,022 Miles..................$12,4602010 Golf TDI.......................V0329015A, Black, 96,203 Miles...................$12,6822012 Beetle.........................V062264A, Silver, 17,467 Miles.................$13,9902012 Beetle 2.5L.................V061840A,White, 37,953 Miles.................$13,9912012 Jetta Se Conv/Sun....V058483B, Black, 25,335 Miles.................$13,9912014 Ford Focus.................PR0124, Red, 34,432 Miles.......................$14,3502012 Jetta SEL PREM PZEV.VLP0123, Grey, 55,979 Miles.........................$14,7712009 Honda Accord EX-L...V035244A, Gold, 58,695 Miles......................$14,7212014 Dodge Avenger SE....VPR0126, Black, 27,379 Miles...................$14,9702014 Jetta Sedan...............VPR0112,Black,6,921 Miles.......................$14,9962014 Jetta Sedan...............VPR0114,Platinum,6,705 Miles..................$14,9962013 Kia Optima LX............VP0119, Red, 39,215 Miles...........................$15,9932014 Jeep Patriot................VP0102A,Black,9359 Miles..............................$15,995
2014 Passat.........................VPR0109,White,5,375 Miles......................$15,9962012 Golf TDI.......................V406892A, Red, 51,111 Miles.......................$16,6942012 Hyundai Sonata Ltd. .VP0127, White, 58,071 Miles.....................$16,5912014 Nissan Altima............PR0125, Grey, 25,866 Miles......................$17,4902012 Kia Sportage LX........VP0121,Silver,12,277 Miles.........................$17,8932014 Passat.........................VPR0110,Silver,7,578 Miles.......................$16,9962014 Passat.........................V044301A,Gray,15,182 Miles....................$19,9962012 CC Lux Plus...............V811951A, Beige, 26,600 Miles................$20,4592013 GTI Wolfsburg............V058760A, Black, 12,059 Miles.................$20,9912015 Jetta SEI.....................V254216A, Silver, 1,652 Miles.......................$22,6312013 Passat SEL.................V024049A, Black, 11,681 Miles.................$22,9902014 GTI Wolfsburg............V039591A, Black, 7,854 Miles.......................$23,9912015 Passat 1.8T Se...........V504978A, Fortana Red, 1651Miles...........$25,9902013 Dodge Durango AWD SXTV357170A, Black, 22,979 Miles.................$25,9912013 Camaro RS.................V040108B,Black,30,660 Miles....................$26,4622013 Dodge Challenger HEMI..V060204A, Red, 13,157 Miles.......................$26,222
2014 PASSAT S
#9061840, Automatic, PowerWindows,Power Locks, Keyless Entry
BUY FOR$17,999
OR $249/MO for 72 MONTHS
MSRP $23,495
2015 TIGUAN S 2WD
#13510753, Automatic, Power Windows,Power Locks, Keyless Entry
BUY FOR$24,999
OR $372/MO for 72 MONTHS
MSRP $27,180
2014 TOUAREG TDI R-LINE V6
#14012689, Navigation, SunroofPower Windows/Locks, Loaded
BUY FOR$46,994
OR $659/MO for 72 MONTHS
MSRP $55,835
2014 JETTA SEDAN TDI
#7283821, Automatic Power Windows,Power Locks, Bluetooth
BUY FOR$18,699
OR $289/MO for 72 MONTHS
MSRP $23,495
SAVE UP TO$8,000
#7280305, Power Windows,Power Locks, Keyless Entry, Auto
MSRP $19,245
2015 JETTA S
BUY FOR$16,995
OR $229/MO for 72 MONTHS
2015 BEETLE 1.8L
#163411, Power Windows/Power Locks,Keyless Entry, AutoMSRP $22,615
BUY FOR$19,999
OR $289/MO for 72 MONTHS
2014 JETTA 4D SPORTWAGEN TDI
#5606905, Automactic. PowerWindows,Power Locks, Keyless Entry, SunRoof
MSRP $30,320
BUY FOR$24,499
OR $358/MO for 72 MONTHS
2015 GOLF GTI 2D HB S
#4036792, Manual, Power Windows,Power Locks, Keyless Entry
BUY FOR$22,999
OR $329/MO for 72 MONTHS
MSRP $25,535
2015 GOLF 4D HBLAUNCH EDITION
#3022537, Power Windows, Power Locks,Auto, Keyless Entry, Sunroof
MSRP $18,815
BUY FOR$16,599
OR $219/MO for 72 MONTHS
AUTO INSURANCESTARTING AT $25/MONTH!Call 877-929-9397
CASH FOR CARS!Any Make, Model orYear. We Pay MORE!Running or Not. SellYour Car or Truck TO-DAY. Free Towing!Instant Offer:1-888-545-8647
CARS/TRUCKSWANTED! Top$$$$$ PAID! Runningor Not, All Makes!Free Towing! We’reLocal! 7 Days/Week.Call 1-800-959-8518
WANTED: 190SL,230SL, 280SL, Merce-des or other pre-1972Foreign Sportscar orConvertible. Porsche,Jaguar, Ferrari, etc.ANY CONDITION!FAIR OFFERS! Mike520-977-1110.
08 BMW 5 SERIES:535i RWD, $22k,52k mi, 4 dr,white/cream, 6 cyl,[email protected]
ANY CAR ANY CONDITIONWE PAY TOP DOLLAR-FAST FREE PICKUP!
SELL YOUR CAR TODAY!CALL NOW FOR AN
INSTANT CASH OFFER
(301)288-6009
CA HFOR CAR !
G557453
Page B-12 Wednesday, February 25, 2015 s
2012 Honda Accord EX-L
#G0055, Leather,Sunroof,Alloys $16,995
DARCARS VOLVO15401 Frederick Rd, Rockville, MDwww.darcarsvolvo.com
1.888.824.9165
DARCARS VOLVO OF ROCKVILLE
YOUR GOOD CREDITRESTORED HEREDARCARS
See what it’s liketo love car buying.
2012 Subaru Outback Ltd.
#427002A,3.6,AWD,leather, 38k Miles $22,950
2011 Nissan Versa
#G0054, Automatic,1.8S Sedan, 1-Owner,27k Miles
$10,995
G558210
#P9242, 6 cycl, 3rd RowSeat, 20K miles, 100Kwarranty
$26,950
2011 Volvo XC 902012 Toyota Sienna XLE
#P9173A, V6, 8-seater,Dual Sliding doors, 1owner, 34K Miles
$25,950
#P9249, 1-Owner,13K Miles, Warrantyto 60K Miles
$18,950
2013 Hyundai Tucson LTD
2012 Chevrolet Tahoe LTZ
#526585A, Immaculate! Only 16KMiles. Nav, DVD, Rear Camera,Captain’s Chairs, Well Maintained
$43,9502012 Hyundai Sante Fe............................................... $21,950#P9247, ONLY 7k MILES!!!, Serrano Red
2011 Volvo XC70 AWD................................................... $22,950# 526603A, Super Clean, Sunroof, Power Tailgate
2011 BMW 335i AWDTwin Turbo....................$25,950#P9214, Nav, Leather, Sunroof,31K Miles
2014 Lexus ES............................................................................ $36,950#329044A, ONLY 4K MILES!!!, V6, NAV, DVD, SUNROOF
#526583B, Turbo-Diesel,21K Miles!! Sunroof,Fender Sound, Bluetooth
$18,995
2013 VW Jetta TDI Premium
2007 Volvo S80............................................................................. $12,995#526135A, 6 Cyl, Front Wheel Drive, Leather, Premium Sound, 63k Miles
2013 Nissan Maxima 3.5 SV.................................. $18,750#526109A, Like New! 1-Owner, V6
2012 Volvo S60........................................................................... $19,950#526559A, Certified, Turbo, 100k Warr., 46k Miles
2012 Mazda CX-9 4WD................................................. $19,950#526080A, V6, Leather, 7-seater, Side Air Bags, Black
2012 Mini Cooper
#P9215, Only 15kMiles, Leather,Panoramic Moonroof
$15,995
#P9212A, Immaculateinside & out! $9,995
2004 BMW 325i2008 Honda Civic
#526622A, 1 Owner, wellmaintained. $7,995
2008 Chrysler 300C
#526600AHEMI w/only52K miles, AWD, Leather,Chrome-clad Wheels
$14,995
$25,977#487551B,HighPerformance Luxury,77KMiles, Loaded! Spotless!
2008 Mercedes S AWD V8
$12,977#R1991, Next to New!160Miles, Super Fuel Efficient,7yr/100KWarranty
2014 Nissan Versa Note SV
$14,977#R1986C, LowMiles and inGreatCondition!
2010 Toyota RAV4 AWD
$21,977#541074A, Navigation, PanoramicRoof, Leather, Loaded, 19KMiles
2013 Kia Sportage EX
DARCARSNISSAN of ROCKVILLE15911 Indianola Drive • Rockville, MD (at Rt. 355 across from King Farm)
888.805.8235 • www.DARCARSNISSAN.comBAD CREDIT - NO CREDIT - CALL TODAY!
DARCARS NISSAN
www.DARCARSnissan.com
G557463
$11,977#541095A, PanoramnicRoof,Well Kept, Looks LikeNew!
2010 Scion tC
$7,977#440115A, LowMiles for ‘07,Clean!
2007 Nissan Versa 1.8 S
$13,977#545028A,Fuel Efficient,Automatic, 8KMiles
2012 Hyundai Accent
$20,977#538090B, Beautiful in BlackShowroomShine! 28kMiles
2011 Nissan Xterra PRO-4X
$7,977#546059A, Hard To Find, InGreatShape, Automatic
2002 Mercedes Benz C-Class Wagon
$15,977#541044A, Loaded!Nav,51KMiles
2010 Prius V
$11,977#448071B, Almost New!Only 8KMiles, FuelEfficient,Well Equipped
2014 Kia Soul
$5,995#G0047,WellMaintained inBeautiful Condition, AffordableLuxury, Under 100KMiles
1991 Lexus LS
Wednesday, February 25, 2015 s Page B-13
DARCARS See what it’s like tolove car buying
15625 Frederick Rd (Rte 355) • Rockville,MDn OPEN SUNDAY n VISIT US ON THEWEB ATwww.355Toyota.com
PRICES AND PAYMENTS INCLUDE ANY APPLICABLE MANUFACTURE’S REBATES AND EXCLUDE MILITARY ($500) AND COLLEGE GRAD ($500) REBATES, TAX, TAGS, DEALER PROCESSING CHARGE ($300) AND FREIGHT: CARS $795 OR $810, TRUCKS, SPORT UTILITY AND SIENNAS $810, $845 AND $995. *0.0% APR & 0% APR FINANCING UP TO 60 MONTHS TO QUALIFIED BUYERS THRU TOYOTA FINANCIAL SERVICES. TOTALFINANCED CANNOT EXCEED MSRP PLUS OPTIONS, TAX, AND LICENSE FEES. 0% APR MONTHLY PAYMENTS OF $16.67 FOR EACH $1000 BORROWED. 0.9% APR 60 MONTHLY PAYMENTS OF $17.05 FOR EACH $1000 BORROWED. APR OFFERS ARE NOT VALID WITH ANY OTHER CASH BACK LEASE OFFER. NOT ALL BUYERS WILL QUALIFY.**LEASE PAYMENTS BASED ON 36 MONTHS, 12,000 MILES PER YEAR WITH $995 DOWNPLUS $650 ACQUISITION FEE, NO SECURITY DEPOSIT REQUIRED. LEASES FOR COROLLA AND CAMRY ARE 24 MONTHS WITH $0 DOWN PLUS TAX, TAGS, FREIGHT, PROCESSING AND $650 ACQUISITION FEE. SEE DEALER FOR COMPLETE DETAILS. EXPIRES 3/3/2015.
1-888-831-9671
G557460
0% FOR60 MONTHS+On 10 Toyota Models
4 DR., AUTO,4 CYL., INCL.
2 AVAILABLE: #570508, 570587NEW 2015 COROLLA L
2 AVAILABLE: #564249, 564232NEW 2015 RAV4 4X2 LE
4 CYL.,AUTOMATIC
2 AVAILABLE: #572074, 572081NEW 2015 CAMRY LE
AUTO,4 CYL., 4 DR
4 DR., AUTO, 6 CYL.
NEW 2015 SIENNA L2 AVAILABLE: #560075, 560085
$24,690
AUTO, 4 CYL
2 AVAILABLE: #567141, 567123NEW 2015 TACOMA 4X2 XTRACAB
362 AVAILABLE: #570280, 570278
4 DR., AUTO,4 CYL
2015 COROLLA LE
$129/2 AVAILABLE: #453039, 453040
NEW 2014 SCION XD
4 CYL.,4 DR., AUTO
$14,990
MO**
2 AVAILABLE: #572068, 572042NEW 2015 CAMRY LE
4 CYL.,AUTO
$14,590
AFTER TOYOTA $1,000 REBATE
AFTER $750 REBATE
$19,290
$179/MO**
AFTER $750 REBATE
$20,890
$0DOWN
$0DOWN
$0DOWN
$0DOWN
$18,390
ASK AASK AFRIENDFRIEND
WHO DRIVES A TOYOTAWHO DRIVES A TOYOTA
AFTER TOYOTA $750 REBATE
PRESIDENTIALPRESIDENTIALSAVINGS EVENT EXTENDEDSAVINGS EVENT EXTENDED
G558213
Prices include all rebates and incentives. DARCARS Nissan DOES NOT Include college grad or military rebates in price! NMAC Bonus Cash require financing through NMAC with approved credit. Prices exclude tax,tags, freight (Cars $810, SUVs and Trucks $860-$1000) and $300 processing charge, Lease payments are calculated with tax, tags, freight, $300 processing charge and first payment due at signing, and are valid with
tier one approval through NMAC. Prices and payments valid only at listed VINS. See dealer for details. Offer expires 03/02/2015.
DARCARS NISSANTWO LOCATIONS
Rockville15911 Indianola DriveRockville, MD 20855
888-797-1831
College Park9330 Baltimore Ave
College Park, MD 20740888-693-8037
SEE WHAT IT’S LIKE TO LOVE CAR BUYING
DARCARS NISSAN OF ROCKVILLE
www.DARCARSnissan.com
DARCARS NISSAN OF COLLEGE PARK
www.DARCARSnissanofcollegepark.com
2015 NISSANVERSA NOTE SV MSRP: $17,320
Sale Price: $14,995Nissan Rebate: $500
NMAC Bonus Cash: $500
$13,995w/automatictransmission
MODEL #11615
4AT THISPRICE $0 DOWN
$159/MO36 MO LEASE12K MILES/YR
OR
2015 NISSANALTIMA 2.5 S
MSRP: $23,935Sale Price: $19,745
Nissan Rebate: -$1,250NMAC Bonus Cash: -$1,000
$17,495
MODEL #131154 at this price
4AT THISPRICE $0 DOWN
$159/MO36 MO LEASE12K MILES/YR
OR
$0 DOWN
$169/MO36 MO LEASE12K MILES/YR
2014 NISSANMAXIMA 3.5 SV MSRP: $35,815
Sale Price: $30,995Nissan Rebate: $4,500
NMAC Bonus Cash: $500
$25,995Leather, HeatedSeats, moonroofMODEL #16214
4AT THISPRICE $0 DOWN
$299/MO39 MO LEASE12K MILES/YR
OR
MODEL #17015 $0 DOWN
MSRP: $32,000Sale Price: $28,495
NMAC Bonus Cash: $3,500
$24,995$239/MO39 MO LEASE12K MILES/YR
OR
2015 NISSANLEAF S
4AT THISPRICE
w/Charger Pkg
2015 MURANOSIN STOCK,AVAILABLE
FORIMMEDIATEDELIVERY!
2015 NISSANVERSA S MSRP: $12,815
Sale Price: $10,995Nissan Rebate: $500
$10,495w/manual
transmissionMODEL #11155
4AT THISPRICE $0 DOWN
$159/MO36 MO LEASE12K MILES/YR
OR
2015 NISSANPATHFINDER 4X4 S
MSRP: $32,295Sale Price: $27,495
Nissan Rebate: $1,000Nissan Bonus Rebate: $1,000
NMAC Bonus Cash: $500
$24,995
MODEL #25015
4AT THISPRICE $0 DOWN
$239/MO36 MO LEASE12K MILES/YR
OR
2014 NISSANSENTRA SR
MSRP: $19,745Sale Price: $16,495
Nissan Rebate: $1,000NMAC Bonus Cash: $500
$14,995
w/alloy wheelsMODEL #12214
OR4AT THISPRICE
2015 NISSANROGUE SV
MSRP: $26,935Sale Price: $23,495Nissan Rebate: $750
NMAC Bonus Cash: $250
$22,495
AWDMODEL #22415
4AT THISPRICE $0 DOWN
$259/MO36 MO LEASE12K MILES/YR
OR
Page B-14 Wednesday, February 25, 2015 s
