Upload
others
View
2
Download
0
Embed Size (px)
Citation preview
SECURITY SUpplIESMaintain and secure your assets with padlocks, lockers, safes and ID cards. Keep your workplace secure with signs, cameras and alarms. Ensure your employees stay safe with ID cards and track visitors with specialised software.
Alarms – Personal & Security .......... 767
Door Locks & Exit Devices .............. 769
Fargo Card Printer ......................... 783
ID Cards & Badge Holders....... 784–785
ID Card & Retractable Key Holders ..................................787
Key Management ................... 777–779
Lanyards .............................. 786, 790
Lockers ........................................776
Locks & Padlocks ................... 774–775
Metal Detectors............................ 765
Mirrors Inspection & Observation ........................ 762–763
Safes – Theft & Fire Resistant .. 780–781
Seals & Security Tape ............ 770–773
Security Equipment ............... 766, 768
Security Markers ........................... 764
Signs .................................... 760–761
Surveillance Cameras ................... 765
Visitor Management Solutions ............................... 782–783
Wristbands ........................... 788–789
CONTENTS
Lace Width Safety Breakaway 100–249 250–499 500 & Up13mm No $1.30 $1.11 $0.91 15mm No 1.39 1.18 0.97 13mm Yes 1.40 1.21 1.01 15mm Yes 1.49 1.28 1.07
TO ORDER Specify Style No. T1174, Lace Type (Woven or Twilll), Lace Width (13mm or 15mm), Finishing (Crimp or Stitch), Lace and Print Colour, Lanyard Attachment, breakaway or standard, specify font or wording or provide logo art in EPS and Quantity.
PRICE (EX GST) Each. Minimum order of 100
For PMS colour match, double-sided printing, other widths and attachments, Please call us for a quote on 1800 65 1173.
NEWCustomised Lanyards
•A convenient way to display identification and promote your brand
•Silk screen print•Print in one colour, on one side of the lace•960mm length with either 13mm or
15mm width
Lace Type Lanyard Attachments
Lace/Print Colours Finishing
Woven LaceTubular shoelace style lace that is comfortable around the neck.
Twill LaceNon stretch lace that is ideal for printing intricate designs
White Orange Navy Blue
Purple Grey
Red Blue Black Yellow Green
Safety Breakaway
Alligator Clip
Swivel Clip (J Hook)
Split Ring
Superior Swivel Clip
Card Holder Strap
Crimp Stitch
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796VB790 | Solutions for a Safe, Secure Workplace!
Security Supplies
Custom Lanyards
•Idealformulti-dayeventsorVIPticketing•Lightweightandultrastretch-resistantformaximumsecurity•Plasticsnaplockingpreventsunauthorisedtransfer•19mmx254mm(WxL)
Plastic Wristbands
TOORDER SpecifyStyleNo.S9943,ColourandQuantity.
PRICE(EXGST) $26.45(1-4),$24.15(5–9),$21.85(10&Up)Perpackof100wristbands.
Silicone Wristbands
•Greattoolforbusinesses,schoolsandcharitiestopromotetheircause
•Siliconematerial•Waterproofandlong-lasting•Reusable•60mmdiameterx12mmwidth
NEW
Blue Fluoro Orange
Red Yellow
Fluoro Pink Green
TOORDER SpecifyStyleNo.T1177,ColourandQuantity.
PRICE(EXGST) $17.80(1-9),$14.40(10-49),$12.21(50&Up)Perpackof10.
Yellow
DayGlow Orange
Red
DayGlow Green
DayGlow Pink
ColoursAvailable:
Solutions for a Safe, Secure Workplace!
Security Supplies | VB789Ask us about our Price Match Guarantee!
Wristbands
•Tear-resistantandnon-stretchTyvek®material•Tamper-evidentadhesiveclosure•Sequentiallynumbered(factoryselected)•Idealforuseineventcrowdmanagementandlargefunctions
•25mmx25mm(WxH)
Tyvek® Wristbands
Ask about our bulk event discounts, Custom logo and print options.
TOORDER SpecifyStyleNo.S9944,ColourorPatternandQuantity.
PRICE(EXGST) $13.80(1-4),$12.65(5–9Packs),$10.35(10&Up)PerPackof100.
ColoursAvailable:
Wristband Width 100–199 200–299 300–399 400–499 500 & Up
19mm $0.32 $0.26 $0.24 $0.23 $0.2225mm 0.37 0.31 0.29 0.28 0.26
TOORDER SpecifyStyleNo.T1176,WristbandWidth(19mmor25mm),WristbandColourandQuantity.
PRICE(EXGST) Each.Minimumorderof100wristbands.
Black
Day Glow Pink
Lime
White
Aqua
Day Glow Orange
Grey
Red
Blue
Gold
Purple
ColoursAvailable:
Black
Day Glow Pink
Lime
White
Aqua
Day Glow Orange
Grey
Red
Blue
Gold
Purple
Yellow
Yellow
Custom Tyvek Wristbands
•Customisationmakeswristbandshardertoreplicate•Tear-resistantandnon-stretchTyvek®material•Blackprint•Tamper-evidentadhesiveclosure•Sequentialnumbered(factoryselected)•255mmlength•SimplysupplyfontandwordingorprovidelogoartinEPSformat
Note: A one time set up charge of $50 applies for the first order of each design.
Checkered
General Admission
Striped
Tiger
Video Game
PatternsAvailable: NEW
NEW
VB788 | Solutions for a Safe, Secure Workplace!
Security Supplies Order online today at www.seton.com.au
Tyvek Wristbands
•Stylishdesign•Easyclipon/offaction•92cmcord•2.5cmimprintablearea•Twistfreefeature•Attachestoabelt
Card Clamp Fitting.
Standard.
ColourOptionsforStandardEndFittingCarabinerReels
Solid:
Blue DarkGrey
BlackWhiteRed
Transparent:
Blue PurpleRedGreen
•Blackvinylcladcase50mmdiameter•600mmstainlesssteelchain•Metalchainandsplitringattachment•Rugged,long,retractablestainlesssteelchainwillkeepkeyssecureandonhandatalltimes
•Madefrom100%recycledmaterial•Perfectforcarryingsecurityandidentificationcards
•Attachestoyourclothingorbelttokeepcardssafeand secure
•Featuresau-clipstrapandnyloncord•Extendableupto88cm
•EasierwaytodisplayyourphotoIDallowingtheconveniencetoeasilyswipeyouridbadge
•Featuresasafetybreakawayclip•FeaturesaU-clipstrapandnyloncord
•Extendableupto96cm
•Durable1200mmkevlarcord•Uniquelockabledesign•Corrosionresistant•Convertiblebeltclip/loopbackattachment
•Uniquelockablefeaturethatincreasesweightcapacity
Metal Chain Retractable
Enviro Friendly ID Retractable
Breakaway Lanyard With Retractable ID Holder
Carabiner Reels
Heavy Duty Key-Bak Retractable
TOORDER SpecifyStyleNo.A38592andQuantity.
PRICE(EXGST) $20.90Each.
TOORDER SpecifyStyleNo.A39742andQuantity.
PRICE(EXGST) $2.50Each.
TOORDER SpecifyStyleNo.T1200,Colour(BlackorBlue)andQuantity.
PRICE(EXGST) $2.50Each.
TOORDER SpecifyStyleNo.S9395,ColourandQuantity.
PRICE(EXGST) $2.45(1-99),$1.70(100&Up)
TOORDER SpecifyStyleNo.A38593andQuantity.
PRICE(EXGST) $24.00Each.
Reinforced ID Retractable Card Holder•Reinforcedstrapandcordmakingitmoredurablethanstandardretractables
•Beltclipatbackforeasyattachment•Extendableupto900mm
NEW
ColoursAvailable:
Black Blue
TOORDER SpecifyStyleNo.A40428andQuantity.
PRICE(EXGST) $2.70Each.
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796Solutions for a Safe, Secure Workplace!
Security Supplies | VB787
Retractable Key And Card Holders
Colours Available:
Red RoyalBlue
Green BlackNavyBlue
White
Swivel Hook
Split Key Ring
Clip•Classic flat lanyard combined with safety breakaway design stopping lanyards becoming a safety hazard
•Available with clip, key ring or swivel hook end fitting•Polyester lanyard with plastic breakaway joints that snap apart
under stress and easily join back together for re-use
•Easily identify visitors on your grounds•15mm twill lanyards•4 different prints (visitor, staff, security and contractor) •Lanyards are combined with safety breakaway design
stopping lanyards becoming a safety hazard
•Great add on to our pre-printed lanyards•Visitors, contractors, security personnel or even
staff can be identified at once•Comes with pre-punched slot for lanyard and clip attachments
Breakaway Lanyards
Pre-Printed Lanyards
Pre-Printed Cards
TO ORDER Specify Style No. T0103, Style, Colour and Quantity.
PRICE (EX GST) $1.60 (30–149), $0.79 (150 & Up) Per Lanyard. Min Order 30.
TO ORDER Specify Style No. T0646, Print (Visitor, Staff, Security And Contractor) and Quantity.
PRICE (EX GST) $18.50 Per Pack of 10 and per style.
TO ORDER Specify Style No. T0788, Legend and Quantity.
PRICE (EX GST) $15.95 Per Pack Of 10 Per Style.
VB786 | Solutions for a Safe, Secure Workplace!
Security Supplies Ask us about our Price Match Guarantee!
Lanyards And Pre-Printed Cards
Portrait.
Landscape.
Fluro Orange.
•HoldsandprotectsmultipleproximityandbadgeIDcards•Constructedfromthick,flexiblevinyl•Availablein“soft”and“heavyduty”versions•Slotclosuresatthefrontandbackoftheholdertolockincardswhenusedwithlanyards
•Fitsanysizearm•Flexibleidentificationsolution•Alsoavailableinhi-visfluorescentorangefornightworkers•Cleararmbandholdersareavailablewithanavyblueband•Maximuminsertsizeis60x86mm
•Noclipsorpinstodamageclothing•Durablevinylholdersareheldinplacebyashieldedmagnetsotheywon’terasemagneticstripsonidandcreditcards
•Doublepocketholdersallowforversatilityandconvenience
Proximity Card Holders
Arm Band Badge Holders
Magnetic Card Holders
Style No. Format Vinyl 1–199 200–499 500 & UpA32322 Portrait Soft $0.79 $0.67 $0.57A32323 Landscape Soft 0.79 0.67 0.57A32324 Portrait Heavy Duty 1.05 0.94 0.79A32325 Landscape Heavy Duty 1.05 0.94 0.79
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
For Lanyards, see pages 790.
Style No. Description 1–99 100 & UpA22187 Clear Arm Band Badge Holder $6.95 $4.95A22188 Fluro Orange Arm Badge Holder 7.20 5.50
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Format 10–99 100 & UpA34186 Single Pocket Vertical $2.20 $1.55A34187 Double Pocket Vertical 2.45 1.90
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) EachHolder(Minimum10).
Solutions for a Safe, Secure Workplace!
Security Supplies | VB785Order online today at www.seton.com.au
ID Card Holders
Portrait.
Landscape.
Slide Ejector.
Thumb Notch.
•BlackUVpremiumqualitycardholder•Dualformatbadgecanbehunginlandscapeorportraitorientation
•Dualsidedholds2cards•Eachsidehascliporlanyardattachment
•Holderprotectscardswhilemakingiteasytoremovefor use
•Rigiddesignprotectsproximitycardfrombending•Choosefromstandardthumbnotchcut-outorpremiumholderwithslideejectortominimiseslidingfriction
•Fitsupto2creditcardsizedcards•PolycarbonatedispenserwithfrostyfinishhelpspreventUVraysfromfadingcards
•ProtectexpensiveIDandproximitycards•Sturdyplasticholdersholdupto2standardthicknesscreditcardsizedcards
•Madeofclearmouldedplasticwithaslottoaccommodatealanyardorcardclip
•Tamper-evidentpermanentlockcase•Dimensions:54x85.7mm(WxL)
Centered slot and holes for attaching lanyard or clip (see pages 786).
•Tamperproofcardandkeytohelppreventlossormisuse•ProtectsIDcardfromtampering•Endpiecesnapsintolockcardsinside
Dual Sided Deluxe Card Holder
Card Dispensers Permanent Locking Card Case
Premium Lockable Card Holder
TOORDER SpecifyStyleNo.A38590andQuantity.
PRICE(EXGST) $10.95PerPackof10.
TOORDER SpecifyStyleNo.T0694,Orientation(LandscapeorPortrait),Style(WithorWithoutaKey)andQuantity.
PRICE(EXGST) $31.20PerPackof10.
Style No. Format Insert Removal 1–99 100–249 250 & UpA32316 Portrait Side Thumb Notch $1.65 $1.40 $1.10A32318 Portrait Top Slide Ejector 2.40 2.10 1.85A32319 Landscape Side Slide Ejector 2.40 2.10 1.85
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
TOORDER SpecifyStyleNo.A32320(Portrait)orA32321(Landscape)andQuantity.
PRICE(EXGST) $21.50(1–10),$18.50(11–19),$17.20(20&Up).Pack10.
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796VB784 | Solutions for a Safe, Secure Workplace!
Security Supplies
ID Card Holders
Fargo C50 PVC Card Printing System•UsetheFargoC50Printertoprintcosteffective,highqualitycards
•FargoC50printerisbackedbyatwoyearwarranty•IncludeseasytouseAsureIDsolocardsoftwaretodesignyourourowncards
•Manageyourdatausingtheinternaldatabase•AssureIDSoftwarecomeswith2yearfreetechnical support
NEW
Part No. Description PriceA44550 Fargo C50 Solo Package $1,599.00A41601 Full Colour Ribbon - Roll of 250 99.00A36997 Standard CR80 PVC cards - Pack of 100 23.00A41602 Cleaning Kit 45.95
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Description Fargo C50 Solo PackageA44550
Fargo C50 card printer Yes
Colour ribbon - EZ cartridge 1 ribbon (100 cards)
Ultracard premium PVC cards 100 cards
Web camera Yes
Asure ID® card personalisation software with 2-year Asure ID Protect Plan
Yes (Solo Edition)
Card personalisation software user requirements
• Requires simple-to-use card personalisation software
• Require 200 records or less• Require 8 card fields or less including images, text,
variable data• Basic card design features• No third party database integration
Printer Specifications•Edgetoedgesingle-sidedcolourorblackprinting•24secondsprintspeedforafullcolourcard•AcceptsCR79/CR80PVC,adhesiveandrewritablecards
•Hoppercapacity50input/30output•USBinterface
Solutions for a Safe, Secure Workplace!
Security Supplies | VB783Ask us about our Price Match Guarantee!
Fargo Card Printer
A26911
Remove liner...
and press badge together.
•Sign-insystemsimplifiessecuritycontrol•Idealforsmall,mediumorlargebusinessesforvisitor access control
•TIMEbadge®Technologyensuresyourpassesexpireafter 24hours
•Featuresonepackof25badgesheets(300badges),onepackof25carbon-backedlogsheets(300individuallogs)andoneclipboard
•Theeasiestwaytoissuesecurebadges•Pre-assembledtime–dependentbadges•Noeffortrequired•Quickandconvenient•Dimensions:76x50mmSimply remove liner from the FRONTpart and press onto the BACKpart to activate the expiration process. There is no simpler way to protect the security of your workers. Badge readily accepts pen or markers.
Expiring Visitor Sign-In System
ONEstep TIMEbadge®
Style No. Description PriceA26911 Visitor Sign-In System $199.00A26912 300 Visitor Badges (25 Sheets) 1,025.00 A26913 300 One-Day "V" Timespots 73.00A29431 25 Visitor Logsheets (300 Records) 54.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Description Qty PriceA26820 ONEstep TIMEbadge "Vendor" 500 $194.00A26821 ONEstep TIMEbadge "Temporary" 500 194.00A26822 ONEstep TIMEbadge "Contractor" 500 194.00
TOORDER SpecifyStyleNo.,HeaderTextandQuantity.
PRICE(EXGST) PerPack.
1. Signin – Visitors sign in at the front office
2. Affixbadge – Visitor wears label for easy identification
3. Createautomaticlog – Signing in creates identical duplicate record
4. Maintainprivacy– Label liner hides log copy from subsequent visitors
•Visitorpassesandlogbook in one•Wireboundregistrybookwithself-adhesivepaperpasses
•Passesmeasure88x45mm
•Theeasywaytotrackimportantvisitorinformation•Usetorecordvisitorstoyourpremises•Aquickandeasywaytoaccountforvisitorsinanemergency
•Attractive50pagebookholds1,000entries
Visitor Pass Registry Book Visitor Log Book
TOORDER SpecifyStyleNo.A34180(Standard)orA34181(Sign-OutStyle)andQuantity.
PRICE(EXGST) $82.30PerBook(Standard500Passes,Sign-OutStyle400Passes).
TOORDER SpecifyStyleNo.A26914andQuantity.
PRICE(EXGST) $29.95Each.
VB782 | Solutions for a Safe, Secure Workplace!
Security Supplies Order online today at www.seton.com.au
Visitor Sign-In Systems
•Electroniclockdigitalkeypad•LCDscreenlightsupwhenenteringyourpin•Lasercutsteeldoor•Designfeaturesincludeaninteriorlightwhichcomesonwhendoorisopenedandafeltliningtoprotectyourbelongings
•IncludesintuitiveLCDscreen•Featuresaddedprotectionwithreinforcedhinges,wallsanddoor•Keyareasareimpact-testedandreinforcedwithhardenedsteel•Dimensions:External:520x350x360mm(HxWxD),Internal:510x337x290mm(HxWxD),Doorwallthickness:8mmBodywallthickness:3mm,Weight:36.7kg
•Electroniclockwithdigitalkeypad•Reinforcedsteelconstruction•Concealedfixingpointsandmountingboltsincluded•Internal(LED)lightsource•Armouredsteelplatesprotectinglockingmechanism•Dimensions(HxWxD):ExternalDimensions:200x480x350mm,InternalDimensions:190x467x280mm(HxWxD)
•Onehourfireresistanceandtestedtowithstandintenseheatandhumidity
•Intelligentdigitalsecuritykeypad•1–48hourstotallockdownmode•Re-settable4–12digitalusercode•Emergencybatterycapability•16mmsteellockingboltsandhingesareprotectedwith18mmsteeldog-bolts
A scramble number input enables personal codes to be hidden within longer sequences of numbers, whilst additional access codes can be set for one time use, ensuring privacy no matter who is in the room when accessing your safe.
This purpose designed laptop safe is fitted with a digitally operated lock, a reinforced steel door and hinge and 22mm diameter motorised locking bolts for maximum security of your company assets and data. It comes complete with concealed fixing points and mounting points, operating instructions and 2 override keys.
* Additional freight charges may apply to this product.
Keeping passports, birth certificates, deeds, cards, cash and keys in a safe makes them easier for you to find, but not for thieves.Easy to operate with resettable personal code with 100,000+ possible combinations, easy to read backlit display and low battery warning.
Professional Safe
Yale Laptop Safe
Yale Fire-Rated Document Safe
TOORDER SpecifyStyleNo.A35802andQuantity.
PRICE(EXGST) $635.00Each.
TOORDER SpecifyStyleNo.A37828andQuantity.
PRICE(EXGST) $610.00Each.
Style No. Description Size (H x W x D mm)* Capacity (Litres) PriceA37798 Yale Document Safe – Medium 308 x 410 x 342 mm 16.3 $710.00A37799 Yale Document Safe – Large 420 x 352 x 433 mm 25.3 770.00A37800 Yale Document Safe – Extra Large 522 x 404 x 440 mm 36.9 815.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
* Size relates to external dimensions.
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796Solutions for a Safe, Secure Workplace!
Security Supplies | VB781
Safes
TO ORDER Specify Style No. A35796 and Quantity.
PRICE (EX GST) $30.80 Each.
TO ORDER Specify Style No. A40430 and Quantity.
PRICE (EX GST) $199.95 Each.
TO ORDER Specify Style No. A35801 and Quantity.
PRICE (EX GST) $66.95 Each.
•Keep your cash and other valuables safe and secure
•Sturdy steel construction•Dimensions: 300 x 230 x 90mm
(L x W x D)
•Deposit safe with deposit hatch •24 litre capacity •Anti-fishing device to protect deposits •Key or electronic lock
•Compact safe for the home or office•Door is made of 4mm-thick steel•18mm diameter steel bolts secure door•Removable shelf•Fitted with chubbsafe’s electronic lock•Features a steel door and body with dual plated
steel moving boltwork•Ideal security safe for home and office use•Dimensions: 250 x 350 x 250mm •Weight: 11kg•Capacity: 16L
•68 litre capacity•Internal hanging rail fits 60 files•Lockable and taper proof •Can be stacked when lid is closed•Dimensions: 630 x 450 x 315mm
(L x W x H)
Security Lock Boxes
Omega Safe
AIR15 Safe
Security Crate
Style No. Description PriceA37779 Deposit Safe – Keyed Lock $920.00A37780 Deposit Safe – Electronic Lock 1,025.00
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) Each.
Ideal for protecting valuables, important documents or equipment when not in use.
DimeNSioNS (H x W x D): External: 455 x 340 x 380Internal: 240 x 325 x 305Max deposit size: 80 x 265 x 220
VB780 | Solutions for a Safe, Secure Workplace!
Security Supplies Ask us about our Price Match Guarantee!
Safes And Secure Storage
Colours Available:
Black Yellow Red Blue Green White
Colours Available:
Red Blue
Style No. Description PriceA26887 Key Box w/ Glass Panel, Hammer And Chain $35.95A26888 Replacement Glass 10.20A38819 Key Box w/ Acrylic Panel, Hammer And Chain 35.95A38820 Replacement Acrylic 10.20
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) Each.
•Makes keys accessible yet deters casual use•Rugged steel boxes finished in red•Comes in either glass or acrylic panels•Supplied with hammer, chain and 2 keys•Replacement panels available in glass or acrylic for
separate purchase•Dimensions: 150 x 120 x 80mm
•These tags are colour coded•Made from flexible moulded plastic•Available in 6 colours•Comes with blank adhesive write-on paper labels
for imprinting•Dimensions: 114 x 119mm (L x W)
•Efficient and convenient•Seals with zip security seal•Keep contents secure•Made from flame retardant
material with double stitched seams
•Dimensions: 254 x 254mm
Emergency Key Box
Reusable Key Tags
Security Wallets
TO ORDER Specify Style No. M4858 and Quantity.
PRICE (EX GST) $69.90 (1–4), $62.00 (5–9), $49.50 (10 & Up)Per Pack of 100 like colour tags. Ok to assort packs for best price.
TO ORDER Specify Style No. S8682 and Quantity.
PRICE (EX GST) $42.50 (1–4), $37.50 (5–9), $35.50 (10 & Up) Each Wallet.
Security Wallet Clip Seal •Can be used with security wallet•Printed sequential numbers •Allows for an audit train if number is
recorded and tracked•Seal is easily removed by hand
TO ORDER Specify Style No. A44926 and Quantity.
PRICE (EX GST) $159.00 per pack of 1000.
NEW
Solutions for a Safe, Secure Workplace!
Security Supplies | VB779Order online today at www.seton.com.au
Key Management
The combination lock eliminates the need for carrying an extra key.
•Smooth,curveddoorsopenmorethan90°allowingeasyaccess
•Manufacturedfromdurable,lightweightaluminium•Pre-drilledforeasyfitting•Suppliedwith6colourcodedkeyclipsinmixedcolours•Purposebuilt,heightadjustablekeyrailsinsert•4sizestochoosefrom
•Keepkeyssecureonsite•Accommodatesmostkeyringsortags
•28hookcabinetwithcombinationlock
•Canbemountedtoawallor partition
•Steelconstructedcabinetshaveatexturedputtypowdercoatedfinishandcomesuppliedwithwhiteovalkeytags
•Dimensions:195x85x35mm(WxHxD)
•Organisetheflowofkeyswhileadding security•Choosefromfoursizesandavarietyofkeycapacities•Keycontrolsystemcomeswithwhite,durable,vulcanisedfibrekeytagsandacabinetlockwithtwokeys
•Cabinetsaremadeof0.7mmthicksteel–20gaugebodiesand18gauge doors
•Keepreturnedkeyssecure•Accommodatesmostcardandtraditionalkeytypes
•Includestwoaccesskeys•Madefromdurable,powdercoated metal
•Dimensions:195x85x35mm(WxHxD)
Aluminium Key Cabinets
Hook Key Cabinet
Wall Key Cabinet
Key Drop Box
Style No. Description Size (W x H x D) PriceA26883 12 Key Cabinet 185 x 310 x 125mm $102.90A26884 36 Key Cabinet 310 x 315 x 125mm 185.00A26885 54 Key Cabinet 310 x 315 x 125mm 256.00A26886 72 Key Cabinet 427 x 315 x 125mm 310.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
TOORDER KEYCLIPPACKS:SpecifyStyleNo.S9858andQuantity.
PRICE(EXGST) $10.95PerPackof6.
TOORDER SpecifyStyleNo.A34202andQuantity.
PRICE(EXGST) $65.95Each.
TOORDER SpecifyStyleNo.A34203andQuantity.
PRICE(EXGST) $69.95Each.
Style No. Description PriceA35820 Wall-Mounted Cabinet – 30 Key Capacity $195.00A35821 Wall-Mounted Cabinet – 80 Key Capacity 386.00A35824 Wall-Mounted Cabinet – 240 Key Capacity 668.00A35823 Wall-Mounted Cabinet – 160 Key Capacity 510.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) PerCabinet.
TOORDER KEYCLIPPACKS:SpecifyStyleNo.S9858andQuantity.
PRICE(EXGST) $10.95PerPackof6.
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796VB778 | Solutions for a Safe, Secure Workplace!
Security Supplies
Key Management
Colours Available:
Red Light Blue
Yellow GreenOrange Black
Belt Clip.
Cable.
Shackle.
Closing Tool.
Crimping Tool.
Cutting Tool.
•Restrict access and unauthorised key removal•Ideal for fire and police departments, prisons, armoured vehicles and more•Unique tubular locks are extremely durable•Choose from 2 styles and 6 colours
•Ensure your keys are absolutely secure•Solid stainless steel 4mm diameter rings with interlocking
ends provide maximum security•Sealing tool ensures rings cannot be removed unless cut
with bolt cutters•Withstands more than 350kg of force•Ring is engraved with unique serial number for
identificationUse rings to hang keys, workshop tools, medical equipment and other items requiring close monitoring.Easy-to-use, ergonomically designed tools use mini rollers, vice like grips and pressure handles to close and crimp ring to seal. Closing Tool pulls the ring closed and locks it in place; Crimping Tool then squeezes the connection where the two ends of the ring meet to create a permanent seal.Cutting Tool eliminates the need for bolt cutters for removal cuts through ring but will not cut anything else; ring cannot be re-used once cut. Tools Are Sold Separately
Cable Key Kop™
Nylon coated stainless steel aircraft cable with a stainless steel spring cover to prevent abrasion and kinking. Available in 200mm and 400mm cable lengths.
Shackle Key Kop™
Unique shackle style uses a 4mm stainless steel rod in either a loop (38 x 30mm) or ring (50mm dia) configuration. Shackle withdraws completely from lock body so keys may be removed from either end.
Tactical Belt Clip:For easy use with Key Kop – simply slide onto belt and hook the rings into place. Protective clip prevents ring from sliding off.
Key Kop™ Locking Key Ring
Tamper-Proof Key Rings
Style No. Description Size PriceS9859 * Cable Key Kop 200mm $46.50S9860 Cable Key Kop 400mm 51.40S9861 Loop Shackle Key Kop 38 x 30mm 39.90S9862 Ring Shackle Key Kop 50mm Dia. 44.90A29274 Tactical Belt Clip - 20.90
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) Each.
* Not available in Red.
Style No. Description Type Key Capacity 1–9 10–49 50 & UpA34194 25mm Dia. Ring 14 $7.78 $7.06 $6.13A34195 40mm Dia. Ring 22 8.34 7.57 6.54A34196 50mm Dia. Ring 30 9.06 8.19 7.16A34197 75mm Dia. Ring 46 9.94 9.00 8.19A34198 100mm Dia. Ring 66 10.82 9.79 8.70A34199 Closing Tool Tool - 56.65 - -A34200 Crimping Tool Tool - 199.00 - -A34201 Cutting Tool Tool - 199.00 - -
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) Each Ring or Tool.
For tamper evident labels, see page 803.
Ring is engraved with a unique serial number.
Solutions for a Safe, Secure Workplace!
Security Supplies | VB777Ask us about our Price Match Guarantee!
Key Management
Colours Available:
YellowRedBlue Green
•Tough polyethylene material – highly vandal resistant •Three different sizes can be stacked and nested with
marked fixing points•Locked hinge can withstand 3200N •Rustproof and waterproof•Suitable for corrosive environments such as mining,
petrochemical, agriculture and waste management•Label position and air vents on all sizes •Retro fit sloping top available •Maximum stacking height 1800mm
•High grade mild steel construction •Powdercoated with germ guard anti-bacterial paint•Pre-drilled for nesting •Fitted with camlocks •High quality glossy appearance•Locker internal dimensions: 150 x 163 x 360mm (H x W x D)
Rustproof Mix And Match Lockers
Personal Items Locker Units
Style No. Description Size (H x W x D) Weight 1–4 5–9 10 & UpT0605 Plastic Locker – Small 450 x 320 x 460mm 5.2 kg $405.00 $386.00 $355.00T0606 Plastic Locker – Medium 600 x 320 x 460mm 8 kg 460.00 435.00 405.00T0607 Plastic Locker – Large 900 x 320 x 460mm 8.9 kg 525.00 510.00 470.00
A38226 Sloping Top (Fits Small, Medium And Large Size) 150 x 320 x 460mm 1.75 kg 135.00 129.00 118.00
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) Each.
Style No Description Size (H x W x D) Weight PriceA38227 20 Locker Unit – 5 Rows x 4 Columns 940 x 900 x 380 55 kg $1,530.00* A38228 20 Locker Unit – 10 Rows x 2 Columns 1800 x 450 x 380 58 kg 1,620.00*A38229 28 Locker Unit – 7 Rows x 4 Columns 1285 x 900 x 380 68 kg 2,210.00*A38230 40 Locker Unit – 10 Rows x 4 Columns 1800 x 900 x 380 94 kg 2,800.00*
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) Each.
* Additional freight charges may apply.
VB776 | Solutions for a Safe, Secure Workplace!
Security Supplies Order online today at www.seton.com.au
Lockers
Colours Available:
RedBlue GreenBlack
Colours Available:
Red SilverBlue Green
•Strong and corrosion resistant•Lightweight•Variety of colours to choose from•50mm shackle diameter
•3-pin combination •Lightweight aluminium construction•30mm padlock body width •4.8mm shackle diameter•Ideal for securing luggage and lockers
Aluminium Industrial Grade Padlocks
Colour Finish Combination Padlocks
•High quality, industrial grade•Renowned for reliable performance•5 pin brass padlock with pin tumbler mechanism•Hardened steel shackle and 45mm lock
Compact Brass Padlock
Also available in keyed alike sets. Call us for a quote.
TO ORDER Specify Style No. A20548 and Quantity.
PRICE (EX GST) $20.95 Each.
A20551 A36779
•User-friendly padlock offers standard to medium security options
•Features hardened steel shackles•Available in 3 pin dial combination or 4 pin re-settable
combination lock for additional security
Combination Padlocks
Style No Description PriceA36779 3-Pin Dial Combination Lock $21.00A36778 3-Pin Combination – 8mm Shackle 50.95A20551 4-Pin Combination – 9mm Shackle 57.65
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) Each.
TO ORDER Specify Style No. T0459 and Quantity.
PRICE (EX GST) $29.50 Each.
TO ORDER Specify Style No. T0458, Colour and Quantity.
PRICE (EX GST) $15.95 Each.
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796Solutions for a Safe, Secure Workplace!
Security Supplies | VB775
Security Padlocks
Prevent theft by locking unattended trailers.
•5pin,doubleboltedpadlockwithextrahardshackleforextrasecurity
•Sealedlockkeepswaterandmudout,makingitperfectforuseoutdoors
•Madefromnon-corrosivematerials•Shockabsorbingcasingpreventsscratches
•Theultimateinpadlocksecurity•Stainlesssteelbodyensuresahighlevelofcorrosionresistance
•5pintumblercylinderandhardenedsteelshackleofferahighsecuritysolutionforshedsandcontainers
•Dimensions:Shackle10mmdia.Body70mmdia.
High Security Diskus Padlock
•Manufacturedtoensuresuperiorprotectionforextremeforceapplications
•Featuresahardenedsteel5-pintumbler•Suitableforuseonsmallapplicationssuchasvendingmachinesandlargeapplicationslikesitecontainers
•Dimensions:70x18x50mm
•Rustandcorrosionresistant•Guardagainttrailertheft•Idealforcontractors,tradesmenandlandscaperstoguardagainsttrailertow-awaytheft
•Madefromchromeplates,thezincdiecastlockbodyresistsrustandcorrosion
•Fits47.6mmand50.8mmballdiametersforReese,Fulton, Valley,Attwood®Putnam,Marvel,Ideal,Acme,Dutton-lainsonandUFP
•Advancedlockingsystemresistspickingandprying
Solid Brass Monobloc Padlocks Universal Coupler Locks
Outdoor Padlock
TOORDER SpecifyStyleNo.A20548andQuantity.
PRICE(EXGST) $20.95Each.
TOORDER SpecifyStyleNo.A20550andQuantity.
PRICE(EXGST) $60.50Each.
TOORDER SpecifyStyleNo.A18219andQuantity.
PRICE(EXGST) $79.90Each.
Style No. Padlock Body Width PriceA20552 45mm $24.00A36780 50mm 34.95
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
VB774 | Solutions for a Safe, Secure Workplace!
Security Supplies Ask us about our Price Match Guarantee!
Padlocks
•Highlyaggressivesilverreversematerial•Breaksintopieceswhenremoved•Serialnumbersarenumberedatmanufacturer•Size:125x175mm
•VOIDOPENappearsonpackagewhensealsremoved•Weatherresistant•Greatforcartonandplasticpackaging•Numbered,logoandbarcodecomestandard•Size:85x25mm
•HiddentamperevidenceSEcurItyVOIDappearswhen removed
•Idealforarchiveboxesandpackaging•50mlong
•totallyremovable•Whenremovedleavesnoadhesiveresidueon applied surface
•Weatherresistant•Numbered,logoandbarcodecomestandard•Size:110x30mm
Self Destruct Paper Label
Secure Void Seals
Total Transfer Security Tape
Non-Residue Voiding Seal
tOOrDEr SpecifyStyleNo.A40333andQuantity.
PrIcE(EXGSt) $402.00PerrollOf500Labels.
tOOrDEr SpecifyStyleNo.A40251andQuantity.
PrIcE(EXGSt) $423.00PerrollOf1000Seals.
tOOrDEr SpecifyStyleNo.A40253andQuantity.
PrIcE(EXGSt) $27.00Eachroll.
tOOrDEr SpecifyStyleNo.A40252andQuantity.
PrIcE(EXGSt) $478.00PerrollOf1000Seals.
Solutions for a Safe, Secure Workplace!
Security Supplies | VB773Order online today at www.seton.com.au
Tamper Evident Labels And Tape
•Quickandeasytoremovebytwistingatbreak-pointon spear
•Hingespringsopentoshowevidenceoftampering•Easytoclose,onehandedoperation•Numberedatmanufacturer•Idealforfirstaidcabinets,meterboxesandbarcarts
Springlok Padlock
•SCECapprovedandISO17712/C-TPATcompliant•Uniqueplasticcoatedboltseal•Dualflexiblewireandsteelshaft•Pullstrengthover1,000kg•Stampingonnutonly•Canonlyberemovedwithboltcutters
One Seal
TOORDER SpecifyStyleNo.T0787,Colour(Blue,Green,Orange,Red,Yellow)andQuantity.
PRICE(EXGST) $409.00PerPack1000.
TOORDER SpecifyStyleNo.T0775,Colour(Blue,Green,Orange,White,Yellow)andQuantity.
PRICE(EXGST) $4.50Each.
TOORDER SpecifyStyleNo.T0776,Colour(Blue,Green,Red,Yellow)andQuantity.
PRICE(EXGST) $3.50Each.
•C-TPATcomplianthighsecurityseal•Plasticcoatingwillshowevidenceoftamperingwhilealsoprotectingagainstcorrosion
•Patentedlockingmechanismprovideseasylockingandahightensilestrength
•Lasermarkednumberingonbothboltandbody•Tensilestrength:1300kg
Snapper Seal
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796VB772 | Solutions for a Safe, Secure Workplace!
Security Supplies
Security Seals
•Extralargetabforadditionalinformation•Self-locking•Securegrippingprongs•Idealforpalletcages,plasticcontainers•Averagepullapartforceis49kg
•Easytoapplyadjustablestrapseal•Roundtailforsmoothinsertion•TheBI-LOKisusedforavarietyofapplicationslikesealingmeters
•9–11kgpullstrength
Grip Rip Seal Bi-Lock Seal
•Integratedbreakpointforeasyremoval•Lockingchamberensurespropersealingengagement•Numberedatmanufacture•Averagepullapartforceis16kg
•Polypropylenebodyblushestorevealsignsoftampering•Canbeusedonmeters,drums,doors,scales,bags,luggage,toteboxes,barcarts,pouchesandmore
•Heatstampedwith7digits•Factorychoosesstartingnumber
Polylock II Plastic Padlock Seal
TOORDER SpecifyStyleNo.A40249andQuantity.
PRICE(EXGST) $592.00PerPack1000.
TOORDER SpecifyStyleNo.T0773,Colour(Blue,Orange,Red,White,Yellow)andQuantity.
PRICE(EXGST) $265.00PerPack1000.
TOORDER SpecifyStyleNo.A40250andQuantity.
PRICE(EXGST) $418.00PerPack1000.
TOORDER SpecifyStyleNo.T0774,Colour(Blue,Green,Red)andQuantity.
PRICE(EXGST) $510.00PerPack1000.
Solutions for a Safe, Secure Workplace!
Security Supplies | VB771Ask us about our Price Match Guarantee!
Security Seals
•Australiandesignedandmanufactured•Grippingspikesforaddedsecurity•Manufacturedfromnylon•Consecutivelynumberedwith6digits
•Manufacturedfrompolypropylene•Idealforsmallbags,cashtins,chemicaldrums•Packedinmatsof10,boxesof1000•Averagebreakingstrengthis16kg•Factorychoosesstartingnumber•Dimensions:Overalllength:240mm,Operationallength:140mm,Flagsize:51x19mm
•S.C.E.CApproved•Highstrengthmetallockingchamber•Integralmetalclipprovideshighlevelofsecurity•Idealforuseonlargebagsorcages•Averagepullapartforceis40kg•Factorychoosesstartingnumber
•Approvedforuseonfireextinguishersandmedical cabinets•Doublewalllockingchamberdesignprotectsagainsttamperingattempts
•Morethan20lockingpositions•Averagepullapartforceis6.5kg
Custom Pulltight Seal
Pull Grip Numbered Seal S-Grip Seal
Pulltite Seal
TOORDER SpecifyStyleNo.T0772,Colour(Blue,Green,Red,White,Yellow)andQuantity.
PRICE(EXGST) $438.00PerPackOf1000Seals.One-TimeSetUpCustomCharge$65.00.
Style No. Description PriceT0768 Pull Tite Plain seals $256.00T0769 Pull Tite Numbered seals 305.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
TOORDER SpecifyStyleNo.T0770,Colour(Blue,RedYellow)andQuantity.
PRICE(EXGST) $399.00PerPack1000.
TOORDER SpecifyStyleNo.A40309andQuantity.
PRICE(EXGST) $472.00PerPack1000.
VB770 | Solutions for a Safe, Secure Workplace!
Security Supplies Order online today at www.seton.com.au
Pulltight Seals
*Back-check cushions slows the opening movement of the door prior to reaching final open position. Mandatory on all fire doors.
•Theperfectsolutionforhightrafficareasorwheresecurityaccesscontrolisessential
•Availableinthreestyles•Standard,withback-checkorwithholdarmopen•Featuresincludeadjustablelatchingandclosingspeed
•CompliestoAustralianStandardAS1905.1:1997,EN1125:1997,AS2331.3.1:1980,AS4145.2:1993
•Lockwood9000seriespanicexitdeviceassistsinaquickevacuationintheeventofanemergency
•Simplesingleactionrequiredtoopendoor•Anessentialaccessdeviceforsafeexitofabuilding•Availableaseitherarimforstandarddoorsorverticaltypefortalldoors
•Exitbytouchbartosuitupto900mmwidedoor
Door Closer
Panic Exit Devices
A18814A18815
•CompliestoAS4145.2-2008•Lockwood’smechanicaldigitalDXlockscontrolaccessinareaswheresecurityisparamount
•Keylesslockingmechanism•Patentedtechnology,easytoinstallanduse•Lightcommercialapplication•Nowiringorbatteriesrequired
Mechanical Digital Locks
FEATURES INCLUDE:1 x New modern styling gives a rounded organic shape1 x Stainless steel heavy gauge springs for superior durability in the clearing mechanism1 x Newly patented Anti-Sensory Feature removes the possibility to detect the active code
by touch1 x Easy re-coding with the non-reversible tumblers, ensuring that re-coding is correctly
carried out before the lock is re-fixed.
Style No. Description PriceA18814 Mechanical Digital Rimlock – Keyless Lock $439.00A18815 Mechanical Digital Tubular Latch – Keyless Lock 275.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.Installationinstructionsincluded.
Style No. Description PriceA18812 Rim Exit Device $498.00A18813 Vertical Rod Type Device 730.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.Installationinstructionsincluded.
Style No. Description PriceA18809 Door Closer – Standard $60.50A18810 Door Closer w/ Back-Check 60.50A18811 Door Closer w/ Hold Arm Open 76.95
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.Installationinstructionsincludedwithtemplate.
For Emergency Exit Signs, see pages 339–342.
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796Solutions for a Safe, Secure Workplace!
Security Supplies | VB769
Door Accessories
High Powered Xenon Bulb. Anti-roll Bar.
Non Slip Grip.
Permanent twist on/off.
Tactical Switch/ Momentary on/off.
•Polyethylenelightweightbumpcap•Idealforsecurity,buildingandeventaccesscontrolstaff•Protectsagainstheadbumpsandscalplacerations•WithnewLEDlight(requires2xAAbatteries)
•Optionalscrew-ontrafficwand•51Lumensofcleanbrightlight,ensuremaximumcommunicationvisibility
•Runtimeof15hours,willoutlastafullworkshift,includingover-time
•Lightweightpolymerbodyiscorrosionproof,resistanttoextremetemperaturesandweather resistant
•Poweredby4xAAbatteries(notincluded)•Length:31.7mm
•Highpowerbeamwithlithiumbatteries•Constantonandmomentaryswitch•Non-slipgripwithanti-rollfeature•Includesholster,batteriesandsparebulb($30value)•Durableanodisedaluminiumcase•Offers93lumensofbrilliantwhitelight•Perfectforsecurityandlawenforcement•Dimensions:127x31mm(LxW)•Weight:320g
•Increasevisibilityofyoursecuritystaffdayornight•Lightweightvestshaveafrontvelcroclosure•Designprovideshighvisibilitywhileallowingairflowforcomfort
•Securityinhi-visprintcentredintherearofvestandonthefrontlefthandchest
•Idealforsecurity,buildingandeventaccesscontrolstaff
Security LED Bumper Cap
Recoil™ LED Traffic Wand
Tactical Xenon Light
Hi-Vis Security Vest
TOORDER SpecifyStyleNo.A39552andQuantity.
PRICE(EXGST) $54.00Each.
TOORDER SpecifyStyleNo.T0719,Size(Small–5XL)andQuantity.
PRICE(EXGST) $45.00Each.
Kit Contains:1 x Recoil™ LED1 x Traffic Wand4 x Coloured Discs
TOORDER SpecifyStyleNo.A39550andQuantity.
PRICE(EXGST) $185.00Each.
TOORDER SpecifyStyleNo.A39551andQuantity.
PRICE(EXGST) $109.00Each.
TOORDER REPLACEMENTBULBS:SpecifyStyleNo.A21799andQuantity.
PRICE(EXGST) $19.90Packof2.
Holster.
VB768 | Solutions for a Safe, Secure Workplace!
Security Supplies Ask us about our Price Match Guarantee!
Security Equipment
•Easy-to-useripcordorslideactivationofalarm–earpiercing130+dB
•Doublesasakeyringsoisalwaysonhandtoprotectagainstattack
•Handytorchtolightupcarordoorkeyhole•Compact–70x35mm•12Vbatteryincluded
Bodyguard Mini Keyring Alarm With Torch
TOORDER SpecifyStyleNo.A26862andQuantity.
PRICE(EXGST) $32.00Each.
•Alarmsoundsoninactivityafteraspecifiedtimeperiod•Idealforuseinwarehouses,buildingsites,anywherepeopleareworkingremotelyoralone
•Activates130dBsirenafter4minutesofimmobilityandsoundsalarmaminutelater
•Uniquebuilt-instrobetorchalarmflashesbrightlywhenactivatedtoattractattention
•Ripcordactivation•130dBsiren•Convenienttestbuttonfacility•Fittedwithahandybelt/keyringclip•Batteryincludedprovidingupto4hourscontinuoususe
Man-Down Alarm
Bodyguard Personal Attack Alarm With Torch And Strobe Light
TOORDER SpecifyStyleNo.A22722andQuantity.
PRICE(EXGST) $185.00Each.
TOORDER SpecifyStyleNo.A36739andQuantity.
PRICE(EXGST) $34.00Each.
2 alarms in 1.
Solutions for a Safe, Secure Workplace!
Security Supplies | VB767Order online today at www.seton.com.au
Personal Security Alarms
KIT CONTAINS:1 x External control panel1 x Siren1 x Movement activated sensor1 x Portable on/off alarm remote control unit
•Affordablesecuritysystemwithoutamonitoringservice•Easywirelessinstallation•Kitsuppliedwithmountinghardware•DIYwirelessremotecontrolledsecuritysystem•Sensordetectsmotionwithinan8mradiusandhasascanangleof1200
•Hand-heldUVlampwithstrap•Idealtocheckformarksonproperty•Providingawidebeamtoscanitemsquicklyandeffectively•DetectsUVsecuritypenmarkings
•UVmarkerpensareasimple,easytouseandeconomicaltheftdeterrent
•Idealformarkinganyvaluableproperty•ContainsspecialUVsensitiveinkthatshowsupunderultra-violetlight
•Penhasabullettipandstrokewidthof1.5–3mm
Wireless Alarm System
UV Light
UV Marker Pen
TOORDER SpecifyStyleNo.A40416andQuantity.
PRICE(EXGST) $51.50Each.
TOORDER SpecifyStyleNo.A40338andQuantity.
PRICE(EXGST) $60.90Each.
TOORDER SpecifyStyleNo.A40337andQuantity.
PRICE(EXGST) $19.95Each.
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796VB766 | Solutions for a Safe, Secure Workplace!
Security Supplies
Alarm Systems
A26901 A26902
A19436
A39482
A39483
A39484
•Looksjustliketherealthing,indistinguishablefrom“live”cameras•Economicaldeterrentagainsttheftandvandalism•Nowiring–installsinminutes
•Detectthepresenceofmetalwithoutfail•Batteryoperated,easytouse•EssentialforhighriskareasoreventsEnsure your facility is safe and secure and prevent any unauthorised objects entering or leaving your building. With a simple sweep across the body or bag, the metal detector can identify many objects – big and small.
Polifer*:The Piezo sound and red LED light effectively indicates the presence of metals. Automatic tuning. Supplied with a convenient safety wrist strap (Not for food purposes).
SuperWand**:Comfortable, ergonomic grip ideal for extend use. 240mm (L) scan area means you can cover large areas in a single sweep. Choice of audible or silent vibrate/LED alarm signal. One-touch button operation and 3 coloured LED indicator lights.
TacticalHand-Held**:Rugged, compact, sealed waterproof design with moulded rubber grip. Silent operation for maximum discretion. Bright LED flashlight for low light and night operations.
Internal Dome Surveillance Cameras•ProfessionalappearancedummycamerawithredflashingLED•Kitcomeswithtwohigh-visibilitywarningstickers,andincludesallnecessaryhardware
•Nocablesarerequiredforoperation,
Internal Surveillance Cameras•Largeinteriordecoycamerahasavisiblereplicaautoirislens,redLEDflashinglightandrealistic
•Anexcellentvisualdeterrenttointruders,burglarsandvandals.
External Surveillance Cameras•Theindoor/outdoorreplicainfraredCCTVcameraismodelledonpopularday/nightinfrared
•weatherproofcamerasascommonlyusedintheCCTVindustry.•Camerahasinfra-redLEDs,aflashingredLED‘monitoringin-operation’andwarninglight.
•Outdooruse,thevisibleinfra-redLEDsgivetheimpressionthatthisprofessionallookingcameradetectsinthedark
Simulated Surveillance Cameras
Hand-Held Metal Detectors
Style No. Description PriceA39482 Internal Dome Surviellance Camera $59.95A39483 Internal Surveillance Camera 72.00A39484 External Surveillance Camera 95.90
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Description PriceA19436 Polifer Metal Detector $310.00A26901 Super Wand Metal Detector 365.00A26902 Tactical Hand Held Detector 330.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
*Uses 9V Battery, not included. Supplied with European AC adaptor not for use in Australasia. **Uses 9V Battery included with this item. Supplied with European AC adaptor not for use in Australasia.
Solutions for a Safe, Secure Workplace!
Security Supplies | VB765Ask us about our Price Match Guarantee!
Cameras And Metal Detectors
ARMS OUT TO SIDE
STAND HERE
A26893 A26895
A26897
A26894
A26896 A26898
•Giveclearindicationofwhereyouwantsomeonetostand
•Highlyvisible,deepdyed,brightyellowfootprintsprintedontoablackmat
•Hardwearingnylonyarnsetontoasmoothrubbernon-slipback
•Eyecatchingsoyourmessagewon’tbemissed
•Anti-slipsurfaceenhancessafety
•Idealforwarehouses,factoriesandoutdoorareas
•Dimensions:350x500mm
Security Floor Mat
Security Floor Markers
Style No. Description Size PriceA26899 Footprints Only Mat 585 x 890mm $149.00A26900 Footprints And Wording Mat 760 x 915mm 205.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) $39.90Each.
Black And White – Numbered. Coloured Bars – Un-numbered.
•Mountsnexttodoorframesforaddedsecurity•Choosefromtwostylesforquickandeasyidentification•Blackandwhiteversionismadefromreflective,highquality,durablevinyl
•Colouredversionismadefromself-adhesive,non-reflectivevinyl
•Idealforservicestations,receptionareasorbanks
Height Indicator Tape
Style No. Description Size (W x H) 1–5 6 & UpA18816 Black And White – Numbered Each 38 x 920mm $24.00 $19.95A20503 Coloured Bars – Un-Numbered Pk Of 5 25 x 410mm 29.95 21.20
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
VB764 | Solutions for a Safe, Secure Workplace!
Security Supplies Order online today at www.seton.com.au
Security Markers
•Ahighsecuritysolutiontoobservationandsurveillance•Rock,bulletandshatterresistant•Idealforprisonsandotherhighsecurityapplications•Indoorandoutdoormodelsavailable•160˚Wide-angleconvexdesignensuresthemaximumfieldofvisionpossible
•Comeswithadjustableswivelmountingbracketforeasyinstallation
•Designedtomakesecurityandsafetycheckssimpleandeasy•Extendsyourvisionwithoutcausinginjurytoyourback•Useundervehicles,machineryhighorhiddenshelvingareas•Designedinconjunctionwithpolice,armedforcesandsecuritygroups
•Availableasroundconvexorflatsquareshapesandintwosizes•Allmirrorscomeequippedwithadjustableswivelandhandlethatcanextendupto1300mm
•Strongmagnetfortemporaryfixing•Availablein12and24voltmodels•Ensuresmachineryiseasilyseen•Perfectforuseonheavyvehiclesandmachinery
Indoor/Outdoor Polycarbonate Convex Mirrors
Inspection Safety Mirror
Magnetic Base Rotating Beacon
Style No. Description Size 1–4 5–9 10 & UpA12295 Round Convex Mirror w/ Wheels 200mm Dia. $155.00 $139.50 $125.50A12296 Round Convex Mirror w/ Wheels 300mm Dia. 220.00 198.00 178.20A24693 Square Flat Mirror w/ Wheels 200mm Dia. 135.00 121.50 109.35A24694 Square Flat Mirror w/ Wheels 300mm Dia. 169.00 152.10 137.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Voltage 1–5 6–9 10 & UpA33018 12 Volt $172.00 $145.00 $132.00A33019 24 Volt 172.00 145.00 132.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Description Size PriceA24738 Polycarbonate – Indoor 305mm Dia. $295.00A24739 Polycarbonate – Indoor 457mm Dia. 380.00A24740 Polycarbonate – Indoor 660mm Dia. 495.00A24741 Polycarbonate – Indoor 762mm Dia. 640.00A24742 Polycarbonate – Indoor 915mm Dia. 810.00A24743 Polycarbonate – Outdoor 305mm Dia. 315.00A24744 Polycarbonate – Outdoor 457mm Dia. 415.00A24745 Polycarbonate – Outdoor 660mm Dia. 530.00A24746 Polycarbonate – Outdoor 762mm Dia. 685.00A24747 Polycarbonate – Outdoor 915mm Dia. 850.00A24846* Post Mount Attachment For Convex Mirror - 35.65
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
* For post-mounted mirrors, select the appropriate size mirror and add A24846 (post mount attachment)
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796Solutions for a Safe, Secure Workplace!
Security Supplies | VB763
Security Mirrors
Full Domes: can be suspended on chains or fastened directly to the ceiling to provide a 360˚ view. Ideal at four-way intersections. Includes D rings for ceiling attachment with screws
Half Domes: use the half domes for 180˚ view. Reduces the risk of collision at corner intersections. Comes with pre drilled holes. Screws or adhesive not included.
Quarter Domes: Use quarter domes for 90˚ view. Ideal for vision around corners, aisles, blind spots and/or entry and exit areas. Comes with pre drilled holes. Screws or adhesive not included.
•Helppreventaccidentsatintersectionsanddetertheft
•Lightweightacrylicmirror,easytoinstallwallmountabledesign
•Suitableforindooruse•Availableinsevensizes•Allmirrorscomewithinstallationinstructionsandwallmountbracket
•Durableandscratchresistantacrylicconvexmirrors
•Offerexcellentsafetyandsecurity
•Ballandswivelplateareattacheddirectlytothemirrortoreduceweightandcostlyinstallations
•Allmirrorscomewithinstructionsforinstallationandtelescopicarm
•Heavy-dutymountingbracketssupplied
•Idealforviewinglargeareasoroverheadobservation
•Useindoorsinoffices,hospitals,retail,receptionorindustrialareas
•Choosefromthreestyles
Economy Convex Safety Mirrors
Indoor Convex Mirrors
Dome Mirrors
Style No. Size 1–4 5–9 10 & UpA32976 305mm Dia. $119.00 $113.00 $107.00A32977 457mm Dia. 151.00 143.00 136.00A32978 609mm Dia. 239.00 227.00 215.00A32979 667mm Dia. 255.00 242.00 230.00A32980 762mm Dia. 343.00 326.00 309.00A32981 812mm Dia. 367.00 348.00 331.00A32982 914mm Dia. 415.00 394.00 374.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Size 1–4 5–9 10 & Up A32987 457mm Dia. $279.00 $265.00 $251.00A32988 609mm Dia. 359.00 341.00 324.00A32989 812mm Dia. 583.00 554.00 526.00A32990 914mm Dia. 639.00 607.00 576.00A32991 1016mm Dia. 687.00 652.00 620.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Size 1–4 5–9 10 & Up A32992 457 x 300mm $143.00 $136.00 $129.00A32993 660 x 300mm 215.00 204.00 194.00A32994 914 x 300mm 407.00 386.00 367.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Size 1–4 5–9 10 & Up A32995 457mm $175.00 $166.00 $158.00A32996 660mm 255.00 242.00 230.00A32997 812mm 335.00 318.00 302.00A32998 914mm 415.00 394.00 374.00A32999 1016mm 495.00 470.00 446.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Style No. Description Size 1–4 5–9 10 & UpA32983 Convex Mirror 300mm Dia. $183.00 $174.00 $ 165.00A32984 Convex Mirror 660mm Dia. 295.00 280.00 266.00A32985 Convex Mirror 760mm Dia. 391.00 371.00 353.00A32986 Indoor Rectangular Mirror 610 x 400mm 431.00 409.00 389.00
TOORDER SpecifyStyleNo.andQuantity.
PRICE(EXGST) Each.
Buy more, save more. Call our quotes department for details.
VB762 | Solutions for a Safe, Secure Workplace!
Security Supplies Ask us about our Price Match Guarantee!
Security Mirrors
Highly visible and informative.
S6321 S0183S6556 S6569 S6559
S6319 S6568 S6567 S6557 S6558
T0497 T0498
ALL VEHICLESMUST STOP AT
SECURITY GATE
S6544S6566S6560T0492 T0490
T0495 T0496
ALL VISITORS ARE SUBJECT
TO INSPECTION
T0493 T0494T0491
See page 513 for details.
Recycled polypropylene is commonly made into bins, pallets, sheeting and trays.
Size 1–5 6–9 10 & Up300 x 450mm $40.25 $36.30 $32.70450 x 600mm 48.75 43.90 39.50
TO ORDER Specify Style No., Size and Quantity.
PRICE (EX GST) Each.
Size Material 1–5 6–9 10 & Up250 x 180mm Self Adhesive Vinyl $20.80 $18.75 $16.90300 x 450mm Polypropylene 40.25 36.30 32.70300 x 450mm Metal 42.60 38.50 34.50
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) Each.
Solutions for a Safe, Secure Workplace!
Security Supplies | VB761Order online today at www.seton.com.au
Security Signs
•Made from polypropylene•Serves as a ‘to the point’ statement of
your security policy
•Provides economical visual deterrent•Make vandals and criminals think twice•Ideal for use in covert areas where cameras are
not clearly visible•Comes in 3 materials to suit your requirements -
self-adhesive vinyl, polypropylene and metal
Security Notice Signs
Surveillance Signs
S0336
S0337
S0338
S0340
S0339
S0341
A21665 A21666 A21667
A26856
A26859
A26857
A26860
A26858
A26861
A21668 A21669 A21670
A21659 A21660 A21661 A21662 A21663 A21664
Internal View: Sign Transparent.
External View: Sign Visible.
T0480
T0485
T0481
T0486
T0482
T0487
T0483
T0488
T0484
T0489
See page 513 for details.
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) $39.40 (1–5), $34.15 (6 & Up) Pack of 5.
TO ORDER Specify Style No. and Quantity.
PRICE (EX GST) $20.80 Each.
Size Material 1–5 6–9 10 & Up250 x 180mm Self Adhesive Vinyl $20.80 $18.75 $16.90225 x 300mm Polypropylene 33.90 30.50 27.50225 x 300mm Metal 38.80 34.90 31.40300 x 450mm Polypropylene 40.25 36.30 32.70300 x 450mm Metal 42.60 38.50 34.50450 x 600mm Polypropylene 48.75 43.90 39.50450 x 600mm Metal 51.35 46.30 41.70
TO ORDER Specify Style No., Size, Material and Quantity.
PRICE (EX GST) Per SIgn. OK to assort for best price.
To Order, Call us on 1800 65 1173 or Fax 1800 67 8796VB760 | Solutions for a Safe, Secure Workplace!
Security Supplies
Signs And Labels
•Provides a highly visible warning to trespassers
•Ideal for use in windows or areas near surveillance equipment
•Convenient size, available in packs of five
•Made from self-stick vinyl and measure 110 x 150mm in size
•Communicate your security message•Without limiting window visibility•Readable on front side – see through from the back•Adhesive backed and measure 250 x 180mm in size
•Ensure your staff and visitors know what areas are off limits
Security/Surveillance Window Labels
See-Thru Security Labels
Restricted Area Signs