Upload
others
View
18
Download
1
Embed Size (px)
Citation preview
Role and Regulation of Starch Phosphorylase and Starch
Synthase IV in Starch Biosynthesis in Maize Endosperm Amyloplasts
By
Renuka M Subasinghe
A Thesis
presented to The University of Guelph
In partial fulfillment of the requirements
for the degree of Doctor of Philosophy
in Molecular and Cellular Biology
Guelph Ontario Canada
copy Renuka M Subasinghe January 2013
ABSTRACT
ROLE AND REGULATION OF PLASTIDIAL STARCH PHOSPHORYLASE AND
STARCH SYNTHASE IV IN STARCH BIOSYNTHESIS IN MAIZE
ENDOSPERM AMYLOPLASTS
Renuka M Subasinghe Advisor University of Guelph 2013 Dr Ian Tetlow
Storage starch is synthesized in sub-cellular organelles called amyloplasts
in higher plants The synthesis of the starch granule is a result of the
coordinated activity of several groups of starch biosynthetic enzymes There are
four major groups of these enzymes ADP-glucose pyrophosphorylase (AGPase)
starch synthases (SS) starch branching enzymes (SBE) and starch debranching
enzymes (SDE) Starch phosphorylase (SP) exists as both dimeric and
tetrameric forms in plastids in developing cereal endosperm and catalyses the
reversible transfer of glucosyl units from glucose-1-phosphate to the non-
reducing end of α-1-4 linked glucan chains although the precise role in the
pathway remains unclear The present study was conducted to investigate the
role and regulation of SP and SSIV in starch biosynthesis in developing maize
endosperm The results of this study showed that the tetrameric form of SP
accounts for the majority of measurable catalytic activity with the dimeric form
being barely active and the monomer catalytically inactive A catalytically active
recombinant maize SP was heterologously expressed and used as an affinity
ligand with amyloplast lysates to test protein-protein interactions in vitro
Results showed that the different multimeric status of SP influenced interactions
with other enzymes of starch synthesis Tetrameric SP interacted with SBEI and
SSIIa whilst the dimeric form of the enzyme interacted with SBEI SBEIIb All of
these interactions were enhanced when amyloplasts were pre-treated with ATP
and broken following treatment with alkaline phosphatase (APase) indicating
these interactions are regulated by protein phosphorylation In addition the
catalytic activity of SSIV was reduced following treatment with APase indicating
a role for protein phosphorylation in the regulation of SSIV activity Protein-
protein interaction experiments also suggested a weak interaction between SSIV
and SP Multimeric forms of SP regulated by protein-protein interactions and
protein phosphorylation suggested a role for SP in starch biosynthesis in maize
endosperm
iv
Acknowledgements
First and foremost I wish to express my gratitude and appreciation to my
advisor Dr Ian Tetlow for providing me the opportunity to conduct a PhD in his
laboratory at the Department of Molecular and Cellular Biology University of
Guelph and for the guidance encouragement and expert advice given through
the program
I would especially thank to Dr Michael Emes for his excellent guidance
and contribution given in his area of expertise I would like to thank Drs Robert
Mullen and Peter Pauls for serving as the members of my advisory committee I
gratefully acknowledge all members of the examination committee Dr Frederic
Marsolais (External examiner) Dr Anthony Clarke Dr Robert Mullen Dr Peter
Pauls and Dr Janet Wood
The members of the TetlowEmes research group have contributed
immensely to my personal and professional time at University of Guelph I am
especially grateful to Dr Fushan Liu for his valuable contribution and Amina
Mahmouduva for technical support given towards my research My sincere
thanks also go to Usha Zaheer Nadya Wendy Mark John Lily Ruby and all
the present and pass members in the lab for their support and friendship
I gratefully acknowledge the financial support provided by the BioCar
Initiative Project Ontario and the University of Guelph Graduate Scholarship
program
I sincerely thank to my loving mother my husband and two daughters for
their understanding sacrifice and encouragement given in my life
v
Dedicated to my Loving Family My Husband Wasantha My daughters Niki and Himi
and my mother Karuna
vi
Table of Contents
Title Page
Abstract
Acknowledgementshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellipiv
Dedicationv
Table of Contentshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellipvi
List of Figures helliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellipxiii
List of Tables helliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellipxviii
List of Abbreviationshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellipxvv
Page
CHAPTER 11
1 General Introduction2
11 Starch Metabolism2
111 Molecular structure of starch3
112 Starch Biosynthesis7
1121 Starch biosynthetic enzymes8
11211 ADP-glucose pyrophosphorylase (AGPase EC 27727)8
11212 Starch synthase (SS EC 24121)13
112121 Granule bound starch synthases (GBSS)16
112122 Starch synthase I (SSI)16
112123 Starch synthase II (SSII)18
112124 Starch Synthase III (SSIIIhelliphelliphelliphelliphelliphelliphelliphelliphelliphellip20
112125 Starch synthase IV (SSIV)helliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip21
vii
11213 Starch branching enzyme (SBEs)25
112131 Starch branching enzyme I (SBEI)25
112132 Starch branching enzyme II (SBEII)26
11214 Starch de-branching enzyme (DBE)helliphelliphelliphelliphelliphelliphelliphelliphellip27
11215 Disproportionating enzyme (D-enzyme)28
11216 Starch phosphorylase (SP)29
112161 Importance of SP in starch metabolismhelliphelliphelliphelliphelliphelliphellip30
112162 The isoforms of SP in higher plantshelliphelliphelliphelliphelliphellip30
112163 Characterization of SPhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip32
112164 Biochemical characterization of SPhelliphelliphelliphelliphelliphelliphelliphelliphellip33
112165 SP and starch biosynthesis models40
112166 Evidences of interaction of SP with SSIVhelliphelliphellip41
1122 Post transitional modification of starch biosynthesis enzymes42
12 Objectives of the studyhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip43
CHAPTER 2 Biochemical Investigation of the Regulation of Plastidial
Starch Phosphorylase in Maize Endospermhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip45
21 Introductionhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip46
22 Materials and Methodshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip52
221 Materialshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip52
222 Methodshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip52
2221 Amyloplast purification from maize endospermshelliphelliphelliphelliphelliphelliphellip52
viii
2222 Preparation of whole cell extractshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip53
2223 Localization of SP in the plastidhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip54
2224 Preparation of granule bound proteinshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip54
2225 Biochemical Characterization of SP in maize endospermhelliphelliphelliphelliphellip55
22251 Phosphorylation and dephosphorylation of
amyloplast lysates55
22252 Enzyme Assayshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip56
222521 Starch phosphorylase glucan synthetic activity assayhelliphelliphellip56
222522 Starch phosphorylase glucan degradative activity assay56
22253 Gel Filtration Chromatography (GPC)helliphelliphelliphelliphelliphelliphelliphelliphellip57
2226 Protein analysishelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip58
22261 Quantification of proteinshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip58
22262 Sodium dodecyl sulfate polyacrylamide gel electrophoresishellip58
22263 SP-Native affinity Zymogramhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip59
22264 Coomassie blue staininghelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip60
22265 Silver staininghelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip60
22266 Mobility shift detection of phosphorylated proteins
(Phos-TagTM)helliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip60
22267 Immunological techniqueshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip62
222671 Preparation of Peptides and Antiserahelliphelliphelliphelliphelliphelliphelliphelliphelliphellip62
222672 Antibody Purificationhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip63
222673 Immunoblot analysishelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip64
222674 Immunoprecipitationhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip64
ix
23 Resultshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip66
231 Subcellular localization of SP in maize endosperm66
232 The synthetic activity of SP in developing maize endosperm69
233 Investigating the regulation of SP by protein phosphorylation71
234 Gel filtration chromatography (GPC) analysis of SP74
235 The synthetic and phosphorolytic activities of SP with
different glucan substrates82
236 Immunoprecipitation of SP85
24 Discussionhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip87
3 CHAPTER 3 Using Recombinant Plastidial SP to Understand
The Regulation of Starch Biosynthesishelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip98
31 Introductionhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip99
32 Materials and Methodshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip103
321 RNA extraction from maize endosperm and synthesis of cDNAhelliphelliphellip103
322 Quantification of nucleic acidhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip103
323 Agarose gel electrophoresishelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip104
324 Designing oligo-nucleotide primers and RT-PCRhelliphelliphelliphelliphelliphelliphelliphellip104
325 Ligation of complete SP cDNA sequence to the pET29a expression
vector and transformation to DH5α competent cellshelliphelliphelliphelliphelliphellip107
326 Expression of plastidial maize SP in Escherichia colihelliphelliphelliphelliphelliphelliphelliphellip108
x
327 Testing the synthetic and degradative activity of recombinant SP
using glycogen affinity native zymogramhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip109
328 Gel filtration chromatography analysis of the recombinant SPhelliphelliphellip109
329 Immobilization of recombinant SP on S-Protein Agarose beads and
pulldown assayhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip109
3210 Starch phosphorylase glucan synthetic activity assayhelliphelliphelliphelliphellip111
3211 Starch phosphorylase glucan degradative activity assayhelliphelliphelliphellip111
33 Resultshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip112
331 Comparison of the protein sequence of plastidial SP
of maize endosperm from the cytosolic form and other specieshellip112
332 Development of recombinant SPhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip118
3321 PCRhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip118
3322 Testing the expression level and the synthetic and
degradative activity of recombinant SP on
glycogen affinity zymogramhellip119
333 Gel Filtration Chromatography analysis of recombinant SPhelliphellip125
334 Immobilization of recombinant SP on S-Protein Agarose beadshellip127
335 The glucan synthetic and phospholytic activity of recombinant SP132
34 Discussionhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip135
xi
4 CHAPTER 4 Biochemical Investigation of the Regulation of
Starch Synthase IV in Maize Endosperm146
41 Introductionhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip147
42 Materials and Methodshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip156
421 Analysis of the localization of SSIV in the plastidhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip156
422 Determination of the protein expression of SSIV
in developing endospermhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip156
423 Determination of SSIV catalytic activity by zymogram analysishellip157
424 Substrate-affinity electrophoresishelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip157
425 Gel Filtration Chromatography (GPC)helliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip158
426 Co-Immunoprecipitation of SSIVhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip158
427 Phosphorylation of SSIV using -32P-ATPhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip158
43 Resultshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip160
431 Testing the specificity of peptide specific anti-SSIV antibodieshellip160
432 Localization of SSIVhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip160
433 Determination of the expression of SSIV in developing endosperm162
434 Determination of the affinity of the SSIV in amyloplast lysates to
Different α-glucan substrateshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip163
435 Investigating the regulation of SSIV by phosphorylation using
-32P-ATPhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip166
436 Determination of the activity of ATP or APase treated
SSIV on zymogramhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip168
xii
437 Gel Filtration Chromatography anlysis of SSIVhelliphelliphelliphelliphellip171
438 Detection of protein-protein interactions of
SSIV by co-immunoprecipitationhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip173
44 Discussionhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip178
5 General Discussion185
6 List of References200
7 Appendixes218
xiii
List of Figures
CHAPTER 1
Figure 11 Structural differences between amylose and amylopectinhelliphelliphelliphelliphelliphellip5
Figure 12 Schematic representation of starch granule structure illustrating
amorphous and semi-crystalline zones of starch granule (a)helliphelliphelliphelliphelliphelliphelliphellip6
Figure 13 A summary of the role of major groups enzymes involve
in starch biosynthetic pathwayhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip7
Figure 14 Domain comparison of starch synthase sequences of five
known SS isoforms in cerealhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip15
CHAPTER 2
Figure 21 Schematic diagram illustrating the putative roles of plastidial
(Pho1) and cytosolic (Pho2) SP in starch metabolism in plants48
Figure 22 Immunoblots showing the subcellular localization of plastidial SP in
maize endosperm the amyloplast lysates contain soluble amyloplast
proteins the granule-bound proteins of the starch granules separated
from amyloplast the soluble protein fraction and starch granule-bound
proteins of whole cell crude extract of the endosperm and the soluble
protein fraction of the amyloplast membrane protein extracts67
Figure 23 Analysis of the localization of proteins imbedded in the granule
surface68
Figure 24 Analysis of the localization of proteins imbedded in the granule
surface and loosely bound to the granules69
xiv
Figure 25 The activity of Pho1 was observed in developing wild-type maize
amyloplast lysates isolated 12-22 DAA using non-denaturing
affinity native zymogram containing 01 glycogen in the gel70
Figure 26 The activity of SP in amyloplast lysates at 22 DAA age in the
synthetic and phosphorolytic direction was tested on glycogen affinity
native zymogram contained 01 glycogen in the gel71
Figure 27 Determination of the different activity levels of plastidial (Pho1)
and cytosolic (Pho2) isoforms of SP following treatment with ATP and
APase72
Figure 28 Mobility shift detection of phosphorylated proteins by
Phosphate affinity SDS-PAGE using Phos-TagTM74
Figure 29 The standard curve developed to analyze the molecular weights of
the proteins eluted by gel filtration chromatography76
Figure 210A Gel filtration chromatography analysis of maize whole cell
crude extracts at 15 DAA and 35 DAA77
Figure 210BCDE Gel filtration chromatography analysis of
amyloplast lysates78798081
Figure 211 Native affinity synthetic activity SP zymogram of the amyloplast
lysates separated by GPC82
Figure 212 Immunoprecipitation of SP by peptide specific anti-SP
antibodies (30 mgmL) with 1 mL amyloplast lysates86
xv
CHAPTER 3
Figure 31 Schematic diagram of the consensus and complementary
strands showing the forward and reverse primers use to isolate
the complete cDNA sequence of the plastidial SP from maize106
Figure 32 Novagen pET29a vector used to over express plastidial SPhellip111
Figure 33 The protein sequences of the plastidial SP of maize endosperm115
Figure 34 The predicted phosphorylation sites of the plastidial maize
SP protein sequence were analyzed using NetPhos 20 Server116117
Figure 35 The PCR product of complete mRNA coding sequence (2805 bp) of
plastidial SP of maize was visualized on a 1 (wv) agarose gel contained
ethidium bromidehelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip119
Figure 36 Over expression of recombinant SP in Arctic express Ecoli was
analyzed by running the soluble recombinant protein on a 10 SDS gel
followed by Coomassie staining and immunoblot analyses by probing
with anti-SP specific antibodies122
Figure 37 The synthetic activity of recombinant SP in glycogen affinity
native zymogramhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip123
Figure 38 Testing the synthetic and degradative activity of recombinant SP
on glycogen affinity native zymogramhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip124
Figure 39 Gel filtration chromatography (GPC) analysis of recombinant
SP126
Figure 310 Immunoblots probed with anti-SP and anti-S-tag peptide specific
antibodies to confirm the immobilization of the recombinant GPC
fractions by S-Agarose beadshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip129
xvi
Figure 311 Immunoblots of the immobilized GPC fractions of the recombinant
SP by S-Agarose beads probed with anti-SSIIa anti-SBEI and anti-SBEIIb
peptide specific antibodieshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip130
Figure 312 Immunoprecipitation of recombinant tetrameric and dimeric forms
of SP by peptide specific anti-SP antibodies bound to Protein A- Sepharose
beads131
Figure 313 Schematic diagram summarizing the protein-protein interactions
between tetrameric and dimeric forms of recombinant SP with starch
biosynthetic enzymes present in the amyloplast lysates132
Figure 314 Synthetic and degradative activities of tetrameric and dimeric
forms of recombinant SP in different glucan substrates134
CHAPTER 4
Figure 41 Amino acid sequence alignment of SSIV in different plant
Species151152
Figure 42 A schematic diagram showing major domains found within
the predicted amino acid sequence of SSIV in wheat endospermhelliphelliphelliphellip153
Figure 43 Immunoblots of amyloplst proteins probed with purified SSIV-
Specific antibodieshelliphelliphelliphelliphelliphelliphelliphelliphelliphellip161
Figure 44 Immunodetection of SSI SSII SSIII and SSIV in stroma
and starch granules of wild-type maize amyloplasts at 22 DAAhelliphelliphellip162
Figure 45 Immunodetection of SSIV at different stages of development
in maize wild-type amyloplastshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip163
xvii
Figure 46A Determination of the relative mobility of the SSIV in amyloplast
lysates in native affinity gel electrophoresis containing varying
concentrations of amylopectin glycogen and maltoheptaose
in the gelshellip164
Figure 46B Plots of the reciprocal of the relative mobility (1Rm) of maize
SSIV against the concentration of different glucan substrateshelliphelliphelliphelliphelliphellip165
Figure 47 SSIV from amyloplast lysates was immunoprecipitated following
incubation of amyloplast lysates with -32P-ATP helliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip167
Figure 48AB Zymogram analysis of SS activity in amyloplast lysates of wild-
Type maize endosperm at 22 DAA170
Figure 48C Figure 48C The activity of SS in the amyloplast lysates in the
Absence of SSIV171
Figure 49 Gel filtration chromatography analysis of SSIV
in amyloplast lysateshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip172
Figure 410A Immunoprecipitation of stromal proteins from wild-type
maize amyloplasts using peptide specific anti-SSIV antibodies
to investigate the protein-protein interactionshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip175
Figure 410B Co-Immunoprecipitation of stromal proteins from wild-type
maize amyloplasts using peptide specific anti-SSIV antibodies
to investigate the protein-protein interactionshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip176
Figure 411 Co-immunoprecipitation of ATP and APase treated stromal
proteins from wild-type maize amyloplasts using peptide specific
anti-SSIV antibodies to investigate the protein-protein interactions
of SSIV with other starch biosynthetic enzymeshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip177
xviii
List of Tables
CHAPTER 1
Table 11 The Km and Vmax values of starch phosphorylase in different
plant specieshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip34
CHAPTER 2
Table 21 The composition of stacking and resolving gels for
SDS-PAGEhelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip59
Table 22 Composition of non- denaturing 8 acrylamide gels (without SDS)
containing 01 (wv) glycogen prepared as followshelliphelliphelliphelliphelliphelliphelliphelliphelliphellip60
Table 23 The gel preparations for Phos-TagTM analysishelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip62
Table 24 The synthetic peptides sequences derived from the
N-terminal sequences of starch biosynthetic enzyme isoforms of
maize there location in full length sequence and the GenBank
accession numbershelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip63
Table 25 Synthetic and phosphorolytic activities of SP in different glucan
substrates84
Table 26 Km and Vmax values of SP in amyloplast lysates in the
phosphorolytic direction85
CHAPTER 3
Table 31 The Km and Vmax values of dimeric and tetrameric forms of
recombinant SP in phosphorylitic directionhelliphelliphelliphelliphelliphelliphellip134
xix
CHAPTER 4
Table 41 Comparison of Kd values of maize SSIV with SSI SSII and
SP estimated by Coummri and Keeling (2001) in different
glucan substrateshelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphelliphellip166
xx
List of Abbreviations
3-PGA ndash 3-phosphoglycerate
ae ndash amylose extender
ADP ndash adenosine diphosphate
AGPase ndash ADP-glucose pyrophosphorylase
AGP-L ndash AGPase large subunit
AGP-S ndash AGPase small subunit
AP - amyloplasts
APase ndash alkaline phosphatase
ATP ndash adenosine triphosphate
BCIPNBT ndash bromo-4-chloro-3-indonyl phosphatenitro blue tetrazolium
BSA ndash bovine serum albumin
cDNA ndash complementary DNA
CE ndash crude extract
D-enzyme ndash disproportionating enzyme
DBE ndash debranching enzyme
DAA ndash days after anthesis
DMSO - dimethylsulphoxide
DP ndash degree of polymerization
DTT - dithiothreitol
EC ndash enzyme commission
Ecoli ndash Escherichia coli
EDTA ndash ethylenediaminetetraacetic acid
G-1-P ndash glucose-1-phosphate
xxi
G-6-P ndash glucose-6-phosphate
GPC ndash gel filtration chromatography
GWD ndash glucan water dikinase
IPTG ndash isopropyl-3-D-thiogalactopyranoside
Iso ndash isoamylase
Kd ndash dissociation constant
kDa ndash kilodalton
MDs ndash malto dextrins
MOS ndash malto-oligosaccharide
MW ndash molecular weight
NAD ndash nicotinamide adenine dinucleotide
NADH - nicotinamide adenine dinucleotide (reduced form)
NCBI ndash National Center for Biotechnology Information
OD ndash optimal density
PAGE ndash polyacrylamide gel electrophoresis
PBS ndash phosphate buffered saline
PCR ndash polymerase chain reaction
Pho1 ndash plastidial starch phosphorylase
Pho2 ndash cytosolic starch phosphorylase
PI ndash phosphatase inhibitor (cocktail)
Pi ndash inorganic phosphate
PPi ndash inorganic pyrophosphate
PWD ndash phosphoglucan water dikinase
RB ndash rupturing buffer
xxii
RCF ndash relative centrifugal force
Rm ndash Relative migration
SBE ndash starch branching enzyme
SDS ndash sodium dodecyl sulfate
Ser - serine
SP ndash starch phosphorylase
SS ndash starch synthase
TEMED - tetramethylethylenediamine
Thr - threonine
TTBS - tris buffered saline solution
(vv) ndash (volumevolume)
UDP ndash uridine diphosphate
(wv) ndash (weightvolume)
Wx ndash waxy mutant
1
CHAPTER 1
2
1 General Introduction
11 Starch Metabolism
Starch is the major form of carbon reserve polysaccharide being
synthesized in plants in cellular organelles called plastids (Joen et al 2010
Tetlow et al 2006) Transient starch and storage starch are two forms of starch
available in plants The chloroplasts in photosynthetic tissues such as leaves
produce transient starch during photosynthesis and store it temporally during
the light period Transient starch is converted into sucrose in the dark and which
is translocated within the plant to supply the energy and carbon demand
required for growth and development Storage starch is a long-term carbon
store in the plant which is synthesized in non-photosynthetic plastids called
amyloplasts found in tuberous tissues (eg in potatoes) or as carbon stores in
seeds (Tetlow 2006 2011) The location of starch production in the plant is
reflective of its metabolic role Storage starch is extremely important to the
plant metabolism of higher plants as a supplier of long-term energy requirement
(Gerard et al 2001) For instance storage starch in seeds will be broken down
during germination to provide the growing seed with energy until it becomes a
photoautotrophic plant
Starch is also an important polysaccharide for humans and represents up
to 80 of daily caloric intake in the human diet Seed storage reserve
carbohydrates are produced in cereal endosperms such as in rice wheat maize
barley and sorghum make up 90 of the starch world market alone (Burrell
2003) Starch is a cheap natural and renewable raw material and has numerous
industrial applications Aside from the agri-food sector starch can be fabricated
3
into pulp and paper paints textiles cosmetics pharmaceuticals biodegradable
plastics construction materials and is also used as a source of renewable
energy in the form of ethanol (Shigechi et al 2004)
111 Molecular structure of starch
Starch exists as water insoluble glucan polymers which form into a semi-
crystalline granular structure in the plastid Starch granules are composed of
two different glucosyl polymers called amylose and amylopectin The ratio of
these polymers in a starch granule is largely genetically controlled and normally
amylopectin makes up about 75 of the starch granule mass and amylose
around 25 Glucosyl units of these polymers are connected by (14) bonds
Amylose is an unbranched or less branched polymer which is created by 100ndash
10000 glucosyl units whereas amylopectin has much larger polymer units
(degree of polymerization is 105ndash106 glucose units) with both (14) and
distinctive (16) branching glycosidic links (Fig 11) The number of glucosyl
units in (14) linked linear chains and the relative position of (16) branch
linkages are determined by the inherent properties of the starch biosynthetic
enzymes There is approximately one branch point for every 20 glucose residues
in amylopectin (Manners 1989)
Amylopectin exhibits a polymodal glucan chain distribution This allows
the condensing of shorter chained glucans and the subsequent development of
efficiently packed parallel left-handed double helices which creates crystalline
lamella of the starch granule The compact helices are approximately 6 to 75
nm in length The regular branch point clusters of amylopectin create
4
amorphous lamella which are approximately 3nm in length The compact
helices coupled with regular branch point clustering gives rise to the organized
semi-crystalline nature of the starch granule (Fig 12) (Hizukuri 1986 French
1984) Amylose is found predominantly in a single-helical or random-coil form in
the amorphous noncrystalline regions (Jane et al 1992) The unique semi-
crystaline structure of starch differs from its counterpart glycogen in archaea
bacterial and animal systems glycogen exists as a globular shaped molecule
consisting of water-soluble homogenously branched glucan polymers (Roach
2002)
5
(A)
(B)
Figure 11 Structural differences between amylose and amylopectin The starch granule consists of two forms of glucan polymers amylose and
amylopectin Amylose is a relatively low branched polymer containing (14) bonds (1A) Amylopectin is a highly branched glucan polymer and has both
(14) bonds and (16) bonds (1B) = reducing end
6
Figure 12 Schematic representation of starch granule structure illustrating
amorphous and semi-crystalline zones of starch granule (a) Enlargement of semi-crystalline growth rings illustrating the arrangement of the alternating crystalline and amorphous lamellae (b and c) (Tetlow 2006)
7
112 Starch Biosynthesis
A highly complex and organized coordination of various enzymes is
required to synthesize starch in the amyloplast The major enzymes involved in
the biosynthetic process catalyze specific reactions and are present in several
isoforms in many plants There are four major groups of enzymes are involved
in starch biosynthesis adenosine 5rsquo disphosphate glucose pyrophosphorylase
(AGPase) starch synthase (SS) starch branching enzyme (SBE) and starch
debranching enzyme (DBE) These enzymes are found in several isoforms
present in all starch synthesizing organelles (Vrinten and Nakamura 2000)
Major groups of enzymes involved in amylose and amylopectin biosynthesis
process are shown in Fig 13
Figure 13 A summary of the role of major groups enzymes involve in starch biosynthetic pathway
8
1121 Starch biosynthetic enzymes
11211 ADP-glucose pyrophosphorylase (AGPase EC 27727)
ADP-glucose is the soluble precursor and the glucosyl donor for the
different classes of starch synthases the group of enzymes which are involved
in elongation of the α-glucan chains in both transient and storage starch
biosynthesis in higher plants (Preiss 1988) ADP-Glucose is produced from
glucose-1-phosphate (G-1-P) and adenosine triphosphate (ATP) by the catalytic
activity of AGPase Therefore AGPase catalyzes the key metabolic step in the
synthesis of starch in higher plants and glycogen in bacteria by providing ADP-
glucose the substrate for all SSs (Preiss 1988) The reversible reaction of ADP-
glucose and inorganic pyrophosphate (PPi) synthesis from ATP and G-1-P by the
catalytic activity of AGPase is shown in following reaction (Fu et al 1998)
Glucose-1-phosphate + ATP ADP-glucose + PPi
AGPase is present in all starch synthesizing tissues in higher plants In
spinach leaves (Morell et al 1987 Copeland and Preiss 1981) in Arabidopsis
thaliana leaves (Lin et al 1988) and in potato tubers (Okita et al 1990
Sowokinos and Preiss 1982) AGPase is found as a heterotetrameric in
structure containing two large regulating subunits (AGP-L) and two small (AGP-
S) catalytic subunits In spinach leaves and in potato tubers the large subunits
and the small subunits are respectively 54-55 kDa and 50-51 kDa in size (Okita
et al 1990 Morell et al 1987 Sowokinos and Preiss 1982) and in the wheat
developing endosperm 58 and 55 kDa respectively (Tetlow et al 2003) The
primary sequence of the rice endosperm small subunit has 76 identity to the
9
spinach subunit and the small subunit is structurally conserved in plants (Preiss
et al 1989) Similarly these subunits are coded by at least two different genes
shrunken2 (sh2) and brittle2 (bt2) for the large and small subunits of AGPase
respectively in maize (Bae et al 1990 Bhave et al 1990) The N-terminus of
the small subunit involves its catalytic properties and the heat stability of
AGPase in potato tuber (Ballicora et al 1995) In contrast the AGPase shows
homotetrameric structure in bacterial systems like Escherichia coli and
Salmonella typhimurium which have 200 kDa and 48 kDa subunits respectively
in size (Preiss 1988)
Biochemical and genetic evidence indicate that there are two distinct
AGPases are localized in the cytosol and in the plastid (Okita 1990 Denyer et
al 1996b Tetlow et al 2003 Tiessen et al 2011) In dicots AGPase is
exclusively located in the plastid and represents 98 of the total AGPase
activity in the cell (Thorbjoslashrnsen et al 1996 Tiessen et al 2011) In contrast
the localization of AGPase is predominantly in the cytosol in cereals for example
in wheat endosperm 60-70 of the AGPase activity is cytosolic (Geigenberger
2011 Tetlow et al 2003) in maize endosperm it is 95 (Denyer et al 1996)
and in developing barley endosperm it represents 80-90 (Beckles et al 2001
Tiessen et al 2011) However the large and small subunits sizes are slightly
smaller in plastidic AGPase than in cytosolic form in the amyloplast (Beckles et
al 2001 Tetlow et al 2003)
The presence of AGPase in the cytosol of cereal endosperms implies that
the synthesized precursor ADP-glucose needs to be transported to the
amyloplast for starch synthesis A specialized nucleotide sugar transporter the
10
ADP-glucoseADP transporter encoded by brittle1 gene is located at the inner
amyloplast envelop to import ADP-glucose during storage starch biosynthesis in
cereals (Shannon et al 1998 Tetlow et al 2003) and the amino acid sequence
of the maize endosperm ADP-glucose transporter termed Bt1 has been
determined (Kirchberger et al 2007) In wheat endosperm ADP-glucose
transport into amyloplasts was shown to be dependent on the adenylates ADP
and AMP as counter-exchange substrates (Bowsher et al 2007) The authors
also found that the rate of ADP exported from the amyloplasts to be equal to the
rate of ADP-glucose utilization by starch synthases
AGPase in both photosynthetic and non-photosynthetic plant sources is
allosterically regulated by the metabolites within the carbon assimilation
pathway 3-Phosphoglycerate (3-PGA) is the first intermediate in Calvin cycle of
photosynthesis and the AGPase is allosterically regulated positively by the 3-PGA
and negatively by inorganic phosphate (Pi) in leaf chloroplasts (Neuhaus and
Stitt 1990) During the light period in photosynthetic tissues the level of 3-PGA
in chloroplast stroma increase and the Pi level decreases as it is used as a
substrate in ATP synthesis through photophosphorylation process (Buchanan et
al 2000) In non-photosynthetic tissues such as the amyloplast in cereal
endosperm (Tetlow et al 2003) and in potato tubers (Sowokinos and Preiss
1982 Tiessen et al 2003) similar regulation by 3-PGA and Pi was shown Ratios
of the allosteric effectors (3-PGAPi) are important in controlling AGPase activity
For example the plastidial AGPase activity in wheat endosperm is insensitive to
3-PGA activation compared to potato tubers (Gomez-Casati and Iglesias 2002
Tetlow et al 2003 Ballicora et al 1995 Hylton and Smith 1992)
11
The purified wheat endosperm AGPase activity is also inhibited by
adenosine diphosphate (ADP) and fructose-16-bisphosphate and the inhibition
can be reversed by adding 3-PGA and fructose-6-phosphate (Gomez-Casati and
Iglesias 2002) The regulation of plastidic form of AGPase in wheat amyloplast
in synthetic direction required 15 mM 3-PGA to achieve a 2-fold stimulation in
rate and was only inhibited approximately 40 by a 20 mM high concentrations
of Pi (Tetlow et al 2003) In contrast AGPases from photosynthetic tissues of
wheat were regulated by 3-phosphoglycerate (activator A05=001 mM) and
orthophosphate (inhibitor I05=02 mM) shows higher sensitivity of chloroplast
AGPase to 3-PGA (Gomez-Casati and Iglesias 2002) Interestingly the subunits
of the cytosolic and plastidic forms not only differ in their sizes but also in their
kinetic properties in wheat (Tetlow et al 2003) The ratio of pyrophosphorolytic
to synthetic activity indicates a preference towards the pyrophosphorolysis
direction in cytosolic form of AGPase and toward synthesis in plastidial AGPase
(Tetlow et al 2003) The inhibition of the enzyme activity by Pi on the synthetic
direction in whole cell extracts could be restored by 3-PGA whereas the
synthetic reaction in amyloplasts was more sensitive to Pi and this inhibition
was not restored by up to 15 mM 3-PGA (Tetlow et al 2003) Further pyridoxal
phosphate (pyridoxal-P) was shown as an allosteric activator of spinach leaf
AGPase (Morell et al 1988) Pyridoxal-P covalently binds to both the 54 kDa and
51 kDa subunits at or near the allosteric activator site(s) of the enzyme AGPase
shows higher affinity to pyridoxal-P than 3-PGA and binding of pyridoxal-P to
each protein is inhibited by the presence of either the allosteric activator of the
enzyme 3-PGA or the allosteric inhibitor Pi (Morell et al 1988) However the
12
maximum activation by pyridoxal-P is 6-fold and it is comparatively less
compared with 25-fold by 3-PGA (Morell et al 1988)
The activity of AGPase is also influenced through post-translational redox
modulation in several species which involves in reversible disulfide-bridge
formation between the two small catalytic subunits of the enzyme (Tiessen et al
2002 Hendriks et al 2003) The catalytic subunits of the enzyme were detected
by their mobility in non-reducing SDS gels as a dimer in oxidized form and as a
monomer in reduced form where the overall activity of the enzyme was
increased in monomeric and lower in dimeric forms (Kolbe et al 2005) The
activity of recombinant AGPase developed from potato was increased in 4-fold
by adding a reducing agent dithiothreitol (DTT) (Sowokinos and Preiss 1982)
Further AGPase from potato tubers was activated by a small protein (12 kDa)
which facilitates the reduction of other proteins called thioredoxin f and m
leading to an increase in catalytic-subunit monomerization and increased
sensitivity to activation by 3PGA (Ballicora et al 2000) In contrast AGPase
activity was partially inactivated following exposure to oxidized thioredoxin due
to formation of disulfide bonds between the N-termini of the AGPase small
subunit (ADP-S) in the potato tubers (Fu et al 1998) Tiessen et al 2002 also
showed that potato tuber AGPase is subject to redox-dependent
posttranslational regulation involving formation of an intermolecular cysteine
(Cys) bridge between the two small catalytic subunits of the heterotetrameric
holoenzyme Hendriks et al (2003) further analyzed that the intermolecular Cys
bridge between the two smaller catalytic subunits is rapidly converted from a
dimer to a monomer when isolated chloroplasts are illuminated or when sucrose
13
is supplied to leaves via the petiole in the dark and from a monomer to a dimer
when pre-illuminated leaves are darkened in pea potato and Arabidopsis
leaves This redox activation not only responds to the changes in sugars in
chloroplast but also in potato tubers (Tiessen et al 2002) However the AGPase
is regulated by a light-dependent signal in photosynthetic tissues Further
studies carried out by Tiessen et al 2003 suggested that sucrose and glucose
lead to redox activation of AGPase via two different signaling pathways involving
SNF1-related protein kinase (SnRK1) and hexokinase respectively which are
implicated in a regulatory network that controls the expression and
phosphorylation of cytosolic enzymes in response to sugars in potato tubers
(Geigenberger 2011)
11212 Starch synthase (SS EC 24121)
The starch synthases catalyze the transfer of the glucosyl moiety of ADP-
glucose to the non-reducing end of an - (14)-linked glucan primer in higher
plants Among the entire starch biosynthesis enzymes SS has the highest
number of isoforms (Fujita et al 2011) This group of enzymes is divided into
two groups first the granulendashbound starch synthases (GBSS) which are
encoded by the Waxy (Wx) gene are involved in amylose biosynthesis
(Nakamura et al 1993 Sano 1984 Echt and Schwartz 1981) The second
class of starch synthases consists of four major isoforms SSI SSII SSIII and
SSIV which are involved in amylopectin synthesis Isoforms of the major classes
of SSs are highly conserved in higher plants (Ball and Morell 2003) A region of
approximately 60kDa is highly conserved in C-terminus of all these enzymes in
14
higher plants and green algae whereas this region is distributed across the
protein sequence in prokaryotic glycogen synthases (Tetlow 2011) The KndashXndashGndash
GndashL motif is thought to be responsible for substrate (ADP-glucose) binding in
prokaryotic glycogen synthase (GSs) and in higher plant SSs (Furukawa et al
1990 1993 Busi et al 2008) and is also found only in the C-terminus of higher
plants and green algal SSs (Nichols et al 2000) where as the K-X-G-G-L
domains are distributed across the GSs protein sequence in prokaryotes
(Fukukawa et al 1990) The presence of lysine in the KndashXndashGndashGndashL domain
determines glucan primer preference (Gao et al 2004) Further the glutamate
and aspartate are found as important residues for catalytic activity and
substrate binding in maize SSs (Nichols et al 2000) SSs show considerable
variation within the N-terminus upstream of the catalytic core and this region
can vary greatly in length from 22 kDa in granule-bound starch synthase I
(GBSSI) to approximately 135 kDa in maize SSIII (Gao et al 1998) (Fig 14)
The phylogenetic and sequence analysis of plants SS (Arabidopsis thaliana
wheat and rice) and algal SS and prokaryotic GS isoforms on the basis of
predicted amino acid sequence suggests that SSIs SSIIs and GBSSIs have
distinct evolutionary origins as compared to SSIIIs and SSIVs (Leterrier et al
2008) Especially the valine residue within the highly conserved K-X-G-G-L
motif appears to have faced strong evolutionary selection in SSIII and SSIVs
and it may affect primersubstrate binding of these SSs compared to SSIs SSIIs
and GBSSIs (Leterrier et al 2008) The other prominent difference in SSIII and
SSIV from other SSs is the highly conserved G-X-G motif near the nucleotide-
binding cleft (Leterrier et al 2008)
15
Figure 14 Domain comparison of starch synthase sequences of five known SS
isoforms in cereal The C-terminal catalytic domains (in black color) includes K-X-G-G-L motif which is a putative ADPG-binding domain SSs vary in the length of the N- terminal region (shown as hatched bars) The N-terminal arm is
believed to provide isoform specificity possibly through binding to other proteins SSIII in particular has a unique N-terminal extension thought to be
involved in controlling proteinndashprotein interactions (Sequence lengths are not drawn to scale) (Source Tetlow 2011)
112121 Granule bound starch synthases (GBSS)
There are two isoforms of GBSS GBSSI and GBSSII both of which are only
found in the granule matrix of starch biosynthesizing tissues GBSSI is
responsible for elongating amylose in storage tissues and GBSSII in tissues such
as pericarp leaf stem and root (Yandeau-Nelson et al 2010 Vrinten and
Nakamura 2000) The waxy mutant results in a lack of amylose production
(Vrinten and Nakamura 2000 Vrinten et al 1999) All of the GBSSI protein in
maize endosperm is remained as granule associated (Mu-Forster et al 1996)
However the Waxy or low amylose starches are still able to form a granule and
16
maintain its semi-crystalline property suggesting that amylose is not required
for insoluble granule synthesis (Denyer et al 1999)
112122 Starch synthase I (SSI)
SSI is responsible for the synthesis of shorter glucan chains up to ten or less
than ten glucosyl units in maize endosperm (Commuri and Keeling 2001) SSI
synthesizes shorter glucan chains with the degree of polymerization (DP) less or
equal to 10 (DPle10) in transient starch synthesis in leaves (Delvalle et al
2005) The soluble SSI in maize is 76kDa in size (Mu et al 1994) The degree of
association of SSI in the starch granule is significant representing 85 of total
SSI content in maize endosperm (Mu-Forster et al 1996) Further the affinity of
SSI for amylopectin (Kd= 02 mgmL) was higher compared to starch (Kd= 049
mgmL) glycogen (Kd= 10 mgmL) and amylose (Kd= 06 mgmL) (Commuri
and Keeling 2001)
The amino acid sequence of SSI in maize shares 757 sequence identity
to rice SSI (Knight et al 1998) In japonica rice lacking SSII (Nakamura et al
2005) SSI accounts 70 of the total SSs activity (Fujita et al 2006) However
the relative contribution of SS isoforms is different in different species (eg
SSIII contributes gt70 of total SS activity in potato) (Abel et al 1996) The
accumulation of SSI total transcripts was higher at 5ndash10 days-post-anthesis
(DPA) than at 15ndash25 DPA in developing wheat endosperm (Peng et al 2001)
During the endosperm development the relative abundance of SSI did not vary
in starch granules whereas SSI concentration in the endosperm soluble
fractions was highest from 10-15 DPA and below detection levels at 5 DPA The
17
wheat endosperm SSI further exhibited similar concentration per kernel from
15-25 DPA in endosperm soluble fractions but at considerably higher
concentrations in starch granules as compared to endosperm soluble fractions
(Peng et al 2001) SSI from japonica rice produces chains with a degree of
polymerization (DP) 8-12 from short and DP 6-7 chains emerging from the
branch point in the A and B1 chains of the amylopectin (Fujita et al 2006)
Further SSI mutant showed decreased number of DP 8-12 glucan chains and
increased number of both DP 6-7 and DP 16-19 chains in endosperm
amylopectin in japonica rice (Fujita et al 2006) However SSI mutants in
transgenic potato plants displayed no visible phenotypic changes in starch
structure (Kossman et al 1999) The overlapping function of SSI and SSIII were
revealed by creating double-recessive homozygous mutants from SSI null
mutants with SSIII null mutants in japonica rice (Fujita et al 2011) The seeds
from these mutants remained sterile and the heterozygous mutants produced
fertile opaque seeds further confirmed that SSI or SSIII is required for starch
biosynthesis in rice (Fujita et al 2011)
112123 Starch synthase II (SSII)
Two SSII isoforms are present (SSIIa and SSIIb) in higher plants SSIIa
predominates in cereal endosperm while SSIIb is mostly confined to vegetative
and photosynthetic tissues (Morell et al 2003) SSII is also partitioned in both
the starch granule bound protein fraction and in the soluble protein fraction in
the plastid (Li et al 1999) SSIIa mRNA level showed a higher accumulation
during the period of starch accumulation in developing maize endosperm (Harn
18
et al 1998) SSIIa plays a role in medium chain length extension and appears to
be involved in elongating glucan chains produced by SSI leading to the
production of medium length chains of DP=12-25 (Zhang et al 2004 Morell et
al 2003) The sex6 mutant of barley lacking SSII activity in the endosperm has
a shrunken endosperm phenotype and reduced starch content due to substantial
decrease in amylopectin content However the amylose content was increased
up to 71 and 625 compared with 25 in the wild-type (Morell et al 2003)
Moreover these mutants have altered chain-length distribution whereas the
amount of shorter glucan chains (DP= 6-11) increased from 2415 (in wild-
type) to 3818 and 3896 and the medium length glucan chains (DP= 12-
30) decreased from 6912 (in wild-type) to 5414 and 5342 in M292 and
M342 mutants respectively (Morell et al 2003) Interestingly the lack of SSII
causes a reduction in the levels of the branching enzymes SBEIIa SBEIIb and
SSI in the starch granule but not the amount of these enzymes in the soluble
fraction in barley amyloplasts (Morell et al 2003) This suggests that either SSII
mutation prevents binding of these proteins to the starch granules or they are
prevented from forming protein complexes in the amyloplast stroma and get
trapped in the granule (Morell et al 2003) The effects on chain length
distribution of ss2 mutants observed in barley are similar to sugary2 (su-2)
mutants of maize endosperm lacking SSIIa (Zhang et al 2004) indicating a
common function for SSII in starch granule assembly The su-2 mutants exhibit a
significant increase in DP= 6-11 shorter chains and a decrease in DP=13-20
medium length chains (Zhang et al 2004) In the Arabidopsis thaliana mutant
ss2 (Atss2) the growth rate or the starch quantity were not affected but
19
increased the amyloseamylopectin ratio increased total amylose (43 of total
amylose) and DP=12-28 medium length glucan chains were significantly
decreased as similar as in the endosperms of many cereals (Zhang et al 2008)
In addition the total SSs activity was recorded as 212 plusmn 87 nmol
productminmg proteins in wild-type leaf extract was increased up to 237 plusmn
87 in Atss2 (Zhang et al 2008) These results suggested that the loss of SSII
activity can be restored by any other conserved SS specifically SSI GBSSI or
SSIII or SSIV in transient starch biosynthesis (Zhang et al 2008)
112124 Starch Synthase III (SSIII)
The SSIII was found as 1392 kDa size in potato (Abel et al 1996) and gt200
kDa in maize endosperm (Cao et al 1999) and is expressed throughout the
developmental stages of these plants The calculated molecular masses of the
isoforms found in rice endosperm (OsSSIII-1) and leaves (OsSSIII-2) were 138
kDa and 201 kDa respectively (Dian et al 2005)
SSIII is coded by the DUI gene in maize endosperm (Cao et al 1999)
The du1 mutations alter starch structure indicates that DU1 provides a specific
function(s) that cannot be compensated for by the remaining soluble SS activity
(Abel et al 1996) The ss3 mutant showed a significant decrease in total SS
activity by 13-29 compared to 100 of SS activity in the wild-type without
any significant effect on the plant phenotype amylose content or the tuber yield
in potato (Abel et al 1996) The granule morphology was changed in ss3 single
mutants producing small granule structures (Abel et al 1996)
20
SSIII elongates comparatively longer glucan chains than SSII producing
DP= 25-40 or greater glucan chains in amylopectin (Tomlinson and Denyer
2003 Edwards et al 1999 Abel et al 1996) The frequency distribution of the
linear glucan chain in ss2 and ss3 single mutant lines showed strong
enrichments at DP= 6-9 and ss2ss3 double mutant lines showed strong
enrichments at both DP= 7ndash8 and DP= 12ndash13 (Edwards et al 2002) The
frequency distribution of the linear glucan chain was determined in transient
starch from Arabidopsis thaliana Atss3-1 Atss3-2 mutant lines (Zhang et al
2005) The frequency of shorter chains of DP= 5-10 and DP= 26-37 are
respectively increased but chains of DP= 14-20 and DP= 43-46 are respectively
decreased suggesting that SSIII is involved in producing comparatively longer
glucan chains compared with SSI and SSII (Zhang et al 2005 Edwards et al
2002) SSIII appears to be a vital enzyme in transient starch biosynthesis
starch granule initiation requires the presence of either SSIII or SSIV in
Arabidopsis leaves (Szydlowski et al 2009)
112125 Starch synthase IV (SSIV)
SSIV is exclusively present in the stroma of the plastids (Leterrier et al 2008
Roldan et al 2007) The role of SSIV in chain length distribution is not clear but
it may play a selective role in priming starch granule formation (Roldan et al
2007) SSIII and SSIV in rice have two isoforms in each enzyme OsSSIII1
OsSSIII2 and OsSSIV1 OsSSIV2 (Dian et al 2005) The SSIII2 and SSIV1
genes are mainly expressed in rice endosperm whereas the other two isoforms
were expressed mainly in leaves The cDNA sequence of wheat SSIV
21
preferentially expressed in leaves is most similar to rice SSIV2 which share a
similar exon-intron arrangement (Leterrier et al 2008) suggesting that the SSIV
present in leaves and endosperms may have slight variation in amino acid
sequences (eg as similarly observed in SBEIIa and SBEIIb)
The SSIV protein in Arabidopsis thaliana is 11299 kDa in size (Roldan et
al 2007) showing 71 582 568 and 583 sequence identity to Vigna
unguiculata (accession number AJ006752) wheat (accession number
AY044844) rice (SSIVa accession number AY373257) and rice (SSIVb
accession number AY373258) respectively (Roldan et al 2007) Two
independent mutant alleles of SSIV in Arabidopsis thaliana Atss4-1 [from
Columbia-0 (Col-0) ecotype] and Atss4-2 [from Wassilewskija (WS) ecotype]
showed no decrease in total soluble SS activity but lower growth rates were
recorded in the mutant plants grown under a 16-h day8-h night photo period
approximately as 100 mgFW (fresh weight) and 50 mgFW of the plant
compared with their respective wild types which conserved 550 mgFW and 275
mgFW of growth rates (Roldan et al 2007) However the fruit size number of
seeds per silique and germination ratios were not altered in the mutant lines
but the starch contents in the leaves were significantly reduced in both mutants
by 35 for the Atss4-1 and 40 for the Atss4-2 line with respect to their wild
types at the end of the illuminated period Although the total SS activity was
not affected the total activity of both cytosolic and plastidial forms of starch
phosphorylase (SP) was increased by 14ndash2-fold in both Atss4-1 and Atss4-2
mutants which may be due to a metabolic alteration that triggers the induction
22
of SP isoform gene expressions in ss4 mutants (Roldan et al 2007) The exact
reason for the increase of SP in ss4 mutant is not known
In Arabidopsis thaliana leaves amyloseamylopectin ratio was not
changed in Atss4 mutants (Roldan et al 2007) The chain length distribution
pattern was determined in Atss4 mutants and their respective wild types and
indicated that the Atss4 mutation had minor effects on the structure of
amylopectin and only a slight reduction in the number of shorter chains of DP=
7ndash10 were observed The microscopic analysis of starch granules collected at 4
and 12 h during the light phase showed a greater difference in size between Col-
0 and Atss4-1 starch granules the surface area was increased by 10 times at
the end of the day in Atss4-1 mutant plants A single starch granule was
contained in the mutant whereas in wild-type showed 4ndash5 starch granules per
chloroplast concluding that the mutation at the AtSS4 locus affects both the
number and size of starch granules synthesized in the chloroplast These
observations further suggested that the SSIV may be involved in the priming of
the starch granule (Roldan et al 2007) However this hypothesis was not yet
confirmed in any plant species The essential mechanism of starch granule
initiation is largely unknown
SSIV in wheat endosperm was found as 1031 kDa protein which is 87
homologous to the OsSSIVb in rice endosperm [Genbank AAQ82623] (Leterrier
et al 2008) Like all other SSs the N-terminus of wheat SSIV is unique the
SSIV-specific region from amino acids 1ndash405 contains two coiled-coil domains
and a 14-3-3-protein recognition site (Leterrier et al 2008) The coiled-coiled
domains are commonly involved in crucial interactions such as transcriptional
23
control (Mason et al 2004) and 14-3-3 proteins are commonly linked to binding
with various signaling proteins such as kinases and phosphatases (Comparot et
al 2003) The mRNA expression of SSIV was highest in non-endosperm tissues
such as in leaf embryo and roots in wheat and the level of expression in the
endosperm was comparatively lower and the expression was independent from
the regulation of the circadian clock Therefore the transcript accumulation
levels did not coincide with the period of high carbon flux to starch in the wheat
endosperm (Leterrier et al 2008)
To elucidate the function of SSIV in the priming process of starch granule
formation different combinations of homologous double SSs mutations in ss4
mutant backgrounds were developed in Arabidopsis thaliana ss1ss4 ss2ss4
and ss3ss4 (Szydlowski et al 2009) Decreased levels of starch accumulated in
ss1ss4 and ss2ss4 double mutants were equal with the sum of the decreases
starch levels in their respective single mutant lines At the end of 12h light
period the starch accumulation in the respective ss3 and ss4 single mutants
were recorded as 122 (Zhang et al 2005) and 62 (Rolden et al 2007)
respectively compared to their wild types However the ss3ss4 double mutant
did not accumulate any measurable amounts of starch despite the dark or light
conditions (Szydlowski et al 2009) Therefore the presence of either SSIII or
SSIV is a crucial requirement in transient starch biosynthesis (Szydlowski et al
2009) Further although the ss3ss4 double mutants did not affect on other
starch metabolism enzymes (such as phosphoglucomutase AGPase and starch
branching enzymes (SBE) they showed a significantly increased SP activity
(more than 8 fold in wild-type) (Szydlowski et al 2009) which may be due to
24
an alternative route of starch biosynthesis available using hexose phosphates via
a starch phosphorylase (SP)-mediated pathway (Fettke et al 2010) (see the
section 11216 for the details)
SSIV is a newly identified SS isoform existing in the plastids However
the exact function of SSIV in storage starch biosynthesis has yet to be identified
The expression of SSIV during the endosperm development is high at the later
stage of the grain filling (Dian et al 2005) The coordination and interactions of
the various enzyme classes are explained through the operation of protein-
protein interactions (see the section 1122) Chapter 4 of this thesis present
an investigation of the catalytic activity and regulation of SSIV by protein-
protein interaction with other starch biosynthetic enzymes in maize amyloplasts
11213 Starch branching enzyme (SBEs EC 24118)
The branching structural arrangement of amylopectin is generated by
starch branching enzymes (SBEs) These enzymes generate the -(16)
linkages through cleavage of internal -(14) glycosidic bonds The reducing
ends are then transferred to the C6 hydroxyls forming a new branch point In
common with the other classes of starch biosynthetic enzymes SBEs have
multiple isoforms (eg SBEI SBEIIa and SBEIIb) some of which are plant
tissue andor developmental specific in their expression patterns (Regina et al
2005 Gao et al 1997)
25
112131 Starch branching enzyme I (SBEI)
SBEI and the SBEIIrsquos differ in the length of the glucan chain they transfer
in vitro and show different substrate specificities SBEI exhibits a higher rate of
branching with amylose and transfers longer chains compared to SBEII which
has a higher affinity towards amylopectin (Guan and Preiss 1993 Takeda et al
1993) The amylopectin chain-length profile of the maize SBEI mutant (sbe1)
was not affected compared with wild-type (Blauth et al 2002) However SBEI
has a lower Km for amylose and tends to produce shorter constituent chains
compared to SBEIIa or SBEIIb when reacted with amylose in vitro (Gao et al
1996) In maize SBEI is expressed moderately during middle stages of kernel
development (12ndash20 DAA) strongly during the later stages of kernel
development (22ndash43 DAA) and is moderately expressed in vegetative tissues
(Kim et al 1998) When compared to the total SBE activity in mutants of SBEI
SBEIIa and SBEIIb in maize a loss of enzyme activity have been identified for
only SBEIIa and SBEIIb (Blauth et al 2002) showed that the lack of SBEI was
compensated by other two SBE isoforms Alternatively SBEI does not have a
significant role in determining starch quantity or quality in leaves or endosperm
(Blauth et al 2002) SBEI is highly conserved in plants and has been shown to
interact with other starch biosynthetic enzymes (Liu et al 2009 Tetlow et al
2004) indicating that SBE plays some function in regulating the starch
biosynthetic process
26
112132 Starch branching enzyme II (SBEII)
In monocots two SBEII gene products (SBEIIa and SBEIIb) are closely related
(Rahman et al 2001) However in wheat endosperm their expression patterns
are considerably different where SBEIIa is expressed at a higher level than
SBEIIb (Regina et al 2005) SBEII mutations show a more pronounced
phenotypic change compared to SBEI A mutation of the gene encoding SBEIIb
in maize produces a high-amylose starch phenotype known as the amylose
extender (ae-) (Banks et al 1974 Yu et al 1998) Mutations in SBEIIb in maize
(ae mutant) produce resistant starch genotype which characteristically produces
less branched and longer glucan chains in amylopectin (Nishi et al 2001
Klucinec and Thompson 2002)
Phenotypic changes in SBEIIa mutations are dependent on the source of
starch In maize there was a visible change in leaf starch in SBEIIa mutants
however no significant changes occurred in storage starches of maize kernels
(Blauth et al 2001) The catalytic activity of SBEIIa and SBEIIb is regulated by
protein phosphorylation in wheat endosperm (Tetlow et al 2004) and show a
high expression of SBEIIa compared to SBEIIa in developinf wheat endosperm
(Morell et al 1997 Regina et al 2005) In contrast in maize endosperm
SBEIIb is the predominant form being expressed at approximately 50 times the
level of the SBEIIa form (Gao et al 1997) it is the most abundant protein in the
maize endosperm amylopast stroma (Mu et al 2001)
27
11214 Starch de-branching enzyme (DBE EC 32141 and EC
32168)
Starch debranching enzymes play an important role in the development of
crystalline amylopectin There are two types of DBEs The isoamylase-type (ISO)
hydrolyzes -(16) linkages in amylopectin and pullulanase-type (PUL)
hydrolyzes -(16) linkages in amylopectin and pullulan a fungal polymer of
malto-triose There are three isoamylase-type DBE isoforms (ISO1 ISO2 and
ISO3) Rice and maize mutants lacking ISO1 (sugary1) demonstrate an increase
in the disordered water-soluble highly and randomly branched polysaccharide
called phytoglycogen (Nakamura 2002 James et al 1995) Although the
respective substrates of isoamylase and pullulanase type DBEs are known their
specific roles in starch biosynthesis are not clear However there are two
existing models for their function The glucan trimming model proposes that
DBEs remove any branches that would inhibit crystallization of the developing
granule (Ball et al 1996 Myers et al 2000) Another model suggests that DBEs
clear away any soluble glucan not attached to the granule (Zeeman et al 1998)
The theory is based on the concept that SSrsquos and SBErsquos will continue to
synthesize glucan polymers if sufficient substrate is present therefore causing
phytoglycogen accumulation Although the latter model would explain the
increase of phytoglycogen in DBE mutants it is possible these models are not
mutually exclusive
ISO1 and ISO2 form a hetero-oligomeric complex to form a functional
enzyme (Hussain et al 2003) This complex is approximately 400 kDa in size
and is also found with a 300 kDa complex containing ISO1 but not ISO2 in
28
maize Loss of ISO1 prevents formation of the complexes indicating that ISO1
is required for the complex assembly (Kubo et al 2010) ISO3 thought to be
involved in starch degradation (Dinges et al 2003) In Arabidopsis leaves ISO3
is catalytically active on water-soluble polysaccharides that have been produced
by β-amylase and starch phosphorylase (Wattebled et al 2005)
11215 Disproportionating enzyme (D-enzyme E C 24125)
D-enzyme catalyzes the hydrolysis of -(14) linkages of unbranched
malto-oligosacharides and subsequent transfer of the glucan released at the
non-reducing end to a non-reducing end of the acceptor molecule to form a new
-(14) linkage D-enzyme mutation in Arabidopsis show reduced rates of
nocturnal starch degradation indicating that D-enzyme plays a part in the
pathway of chloroplast starch degradation (Critchley et al 2001) Some
research evidence suggested that the D-enzymes work in conjunction with SP
contributing to starch synthesis via the phosphorolytic SP reaction (Takaha et al
1998) According to this model the short-chain MOS liberated in the trimming
reaction by DBEs are converted to longer-chain glucans by D-enzyme which are
the substrates for phosphorolysis by SP liberating G-1-P used to synthesize
ADP-glucose by plastidial AGPase (Takaha et al 1998) In addition in
Chlamydomonas reinhardtii the phosphorolytic SP reaction is stimulated by the
presence of D-enzyme (Colleoni et al 1999)
29
11216 Starch phosphorylase (SP EC 2411)
Starch phosphorylase exists in both tetrameric and dimeric states and
catalyses the reversible transfer of glucosyl units from glucose-1-phosphate (G-
1-P) to the non-reducing end of α-1-4 linked glucan chains as shown in the
following equation
G-1-P + (14-α-D-Glucose)n (14-α-D-Glucose)n+1 + Pi
112161 Importance of SP in starch metabolism
SP has often been regarded as a glucan degradative enzyme (Preiss
1982 Preiss 1984) The α-glucan phosphorylase (EC 2411) found in animals
fungi and prokaryotes plays a major role in glucan catabolism (Preiss 1984)
and the amino acid sequence of the enzyme is found to be highly conserved
among prokaryotes and eukaryotes (Newgard et al 1989) Genetic analyses in
Chlamydomonas showed that the mutation of plastidial SP affected starch
accumulation (Dauvilleacutee et al 2006) In addition the mutation of plastidial α-
glucan phosphorylase could not change the total accumulation of starch or the
starch structure during the day or its remobilization at night when the
phosphorylase gene activity was eliminated by T-DNA insertion in Arabidopsis
thaliana leaves where transient starch is synthesized (Zeeman et al 2004) In
contrast research evidence demonstrated that the SP has a certain effect on the
storage starch biosynthesis that the development of plastidial SP activity
coincides with starch accumulation in developing cereal endosperms in rice
(Satoh et al 2008) in wheat (Schupp and Ziegler 2004 Tickle et al 2009) and
30
in maize (Yu et al 2001) Above evidence further suggests that the plastidial
forms of SP are involved in starch synthesis rather than the degradation in
higher plants
112162 The isoforms of SP in higher plants
Two major isoforms of SP are present in plants and differ in their
intracellular localization and are designated as plastidic (Pho1) and cytosolic
(Pho2) isoforms (Nakano and Fukui 1986) In developing rice endosperm
plastidial Pho1 accounts for about 96 of the total phosphorylase activity and it
is restricted to the stroma (Satoh et al 2008) The predicted protein sequence
alignment of Pho1 and Pho2 isoforms show a significant 50 amino acid extension
in the N-terminus of Pho1 which represent the transit peptide (Nakano and
Fukui 1986) In this thesis the term SP is generally used for the plastidial form
The plastidial form of SP (112 kDa in maize Mu et al 2001) is known to
be the second most abundant protein in the maize amyloplast stroma next to
SBEIIb (Yu et al 2001) Peptide sequences of plastidial SP in maize showed
higher identities to potato sweet potato and spinach and the N-terminus
sequence was unique in maize amyloplast it can not be aligned with any other
N-terminus sequences of Pho1 available in the gene bank (Yu et al 2001)
Excluding the N-terminus difference between Pho1 and Pho2 a unique 78-amino
acid insertion in the middle of the Pho1 sequence is a prominent characteristic of
the plastidial isoform in higher plants (Yu et al 2001) In potato Pho1 and Pho2
showed 81 - 84 amino acid sequence similarity over most part of the
sequence with the exception of N-terminal transit peptide and the large L-78
31
insertion located between the N and C terminal domains (Albrecht et al 1998)
Significant variation is found in the molecular mass of the Pho1 and Pho2 in
wheat endosperm as 100 kDa and 90 kDa respectively (Albrecht et al 1998)
The peptide sequence ILDNADLPASVAELFVK is a common sequence fragment
found in the L-78 region in maize and potato (Yu et al 2001 Albrecht et al
1998) In addition the sequence comparison among SP from potato tuber
rabbit muscle and Escherichia coli revealed the presence of the characteristic
78-residue insertion only in the middle of the polypeptide chain of the potato
enzyme (Nakano and Fukui 1986) (Fig 33 in Chapter 3) suggesting the L-78
region is specific to plants The proposed function of the L-78 insertion is
thought to be the obstruction of the binding of Pho1 to large highly branched
polysaccharides (Albrecht et al 1998) This idea was further confirmed by the
observation that the L-78 insertion in sweet potato (Ipomea batatas) blocked
the starch-binding site in Pho1 molecule showing low affinity towards starch
(Young et al 2006) Several serine phosphorylation sites were also found in the
L-78 insertion suggested that the regulation of Pho1 is phosphorylation
dependent (Young et al 2006) This research group was able to purify a 338
kDa protein kinase activity from sweet potato roots using liquid chromatography
methods and which actively phosphorylates the L-78 insertion (Young et al
2006) Interestingly this phosphorylation modification was not found in Pho2
isoform or after L-78 insertion was proteolytically removed from Pho1 (Young et
al 2006)
32
112163 Characterization of SP
All phosphorylases exist as dimers or tetramers of identical subunits and
have similar kinetic and structural properties but their regulatory mechanisms
may vary depending on the source of the enzyme (Dauvilleacutee et al 2006
Weinhaumlusel et al 1997 Brisson et al 1989) or its multimeric state (see later)
The α-glucan phosphorylase found in bacterial forms has a homodimeric
molecular structure (Dauvilleacutee et al 2006 Weinhaumlusel et al 1997) Gel filtration
chromatography studies revealed that the native enzyme consisted of two
identical subunits in maize (Mu et al 2001) which coincides with findings of
Tanabe et al (1987) on availability of dimeric form (203 kDa) of α-glycogen
phopsphorylase in yeast The purified form of SP from maize endosperm was
thermally labile above 50degC where optimum enzyme activity is at pH 60 in the
synthetic direction and pH 55 in the phosphorolytic or degradative direction at
40degC (Mu et al 2001)
112164 Biochemical characterization of SP
According to their affinities for glucan substrates SPs are further
classified as low affinity (SP-L) and high affinity (SP-H) isoforms respectively in
potato tuber and leaf (Mori et al 1993) When the L-78 insertion in SP-L was
replaced by high affinity SP-H sequence the SP-L showed less affinity to
glycogen compared to SP-H form (Km=10400 and Km=10 μgmL) (Mori et al
1993) The L-78 insertion-replaced chimeric enzyme was five times less active
than the SP-L isoform but still showed low affinity to glycogen than in SP-L
(Km= 24 μgmL) However when the glycogen was replaced by amylopectin
33
and amylose (DP=30) the affinity increased in SP-L (Km= 82 and Km=76
μgmL respectively) in SP-H form (Km=36 and Km=87 μgmL respectively)
and in chimeric form (Km=53 and Km=2 μgml respectively) Among all the
isoforms the SP-H form has the highest affinity to amylopectin suggesting that
the L-78 region has greater affinity towards low molecular weight substrates
(Mori et al 1993) In addition two isoforms named Pho1a and Pho1b were
identified in potato (Sonnewald et al 1995) The homodimeric form of Pho1a
isoform was immunochemically detectable only in tuber extracts where both
Pho1a and heterodimeric Pho1b were present in leaf extracts in potato (Albrecht
et al 1998) Wheat has three forms of SP (designated as P1 P2 P3) which are
distinguished in non-denaturing separation gels containing glycogen (Schupp
2004) The activity form P3 is plastidic in where as P1 and P2 are cytosolic and
found mainly in younger leaves (Schupp 2004) However mature leaves only
contain the plastidic form which was also strongly evident in the endosperm of
the developing seeds Cytosolic forms are more prominent in germinating seeds
(Schupp 2004) suggestive of the involvement of cytosolic SP forms in the
utilization of α-glucans resulting from starch degradation
The plastidial and cytosolic SP show different affinity towards high and low
molecular glucan polymers in synthetic direction (Table 11) Plastidial SP
prefers amylopectin than the glycogen potato tuber (Liddle et al 1961) spinach
leaf (Shimomura et al 1982) and sweet corn (Lee and Braun 1973) and maize
(Yu et al 2001) In maize endosperm the Km value for amylopectin in the
synthetic direction of the SP reaction was 34-fold lower and the Kd value was
40-fold lower than of glycogen (Yu et al 2001) The kinetic analysis indicated
34
that the Km value for amylopectin was eight-fold lower than that of glycogen
and the phosphorolytic reaction was favored over the synthetic reaction when
malto-oligosaccharides (DP= 4 to 7 units) were used as substrates (Mu et al
2001)
Table 11 The Km and Vmax values of starch phosphorylase in different plant species SP-L =plastidial form of SP SP-H= cytosolic form of SP (s) = synthetic
direction (p) = phosphorolytic direction
Plant Tissue
Substrate
Vmax
(umolminmg)
Km
(mgml)
Reference
Purified SP
from maize
amyloplast
stroma
Amylopectin
Glycogen
058 (s)
063 (s)
013 (s)
045 (s)
Yu et al
2001
Purified SP
from maize
amyloplast
stroma
Amylopectin
Glycogen
Maltoheptaose
73 (s) 111 (p)
716 (s) 1180(p)
78 (s) 1993 (p)
0017 (s) 0028(p)
025 (s) 094(p)
008 (s) 01 (p)
Mu et al
2001
Sweet potato
tuber crude
extract
Starch
G-1-P
Pi
0077 (s)
0115 (p)
1052 (s) 1498(p)
Young et al
2006
Potato tubers
Recombinant
proteins of
SP-L and SP-
H types
Maltopentaose
SP- L type
SP- H type
Glycogen
SP- L
SP- H
Amylopectin
SP- L
SP- H
Amylose
DP=30
SP- L
SP- H
396 (s) 165 (p)
961 (s) 368 (p)
83 (p)
94 (p)
79 (p)
83 (p)
139 (P)
182 (P)
013 (s)
112 (s)
10400 (p)
98 (p)
82 (p)
36 (p)
76 (P)
87 (P)
Mori et al
1993
35
ADP-glucose the major precursor for starch biosynthesis has been known
for long time as an inhibitor of activity of SP in the synthetic direction (Matheson
and Richardson 1978) ADP-glucose (at 4 mM) reduced the synthetic activity of
plastidial SP and G-1-P (at 10 mM) reduced the activity of cytosolic SP by 18
to 22 respectively in pea seeds (Matheson and Richardson 1978) Low
concentration of G-1-P and high PiG-1-P ratio increase the degradation activity
by glycogen phosphorylase in vivo (Schupp and Ziegler 2004 Newgard et al
1989) suggesting SP degradative activity is increased by inorganic phosphate
(Pi) In addition in developing barley endosperm cytosolic Pi concentration was
very higher (over 23 folds) than G-1-P where cytosolic form of SP required
higher level of Pi (Tiessen et al 2011) However according to the findings of
Hwang et al 2010 incorporation of [14C]-G-1-P into starch was only partially
affected by Pi Even under physiological G-1-P substrate levels (02 mM)
plastidial SP from rice was still able to carry out the biosynthetic reaction
although at low rates in the presence of 50-fold excess of Pi in vitro Hence
under conditions that would favor the degradation of starch plastidial SP
preferentially carries out biosynthesis
The animal orthologue of SP glycogen phosphorylase consists of two
identical subunits each of which have a highly conserved C-terminal region
incorporating a pyridoxal phosphate molecule which is essential for activity and
a site effecting non-catalytic glucan binding (Newgard et al 1989) The activities
of animal glycogen phosphorylases in releasing glucose for dissimilative
metabolism are highly regulated by allosteric effectors and covalent
modifications (Johnson 1992 Newgard et al 1989) All known α-glucan
36
phosphorylases require pyridoxal 5-phosphate for activity as a cofactor (Yanase
et al 2006) The maize shrunken-4 mutant is found to be lacking SP activity in
the endosperm and the mutants had reduced the starch content and the soluble
protein content by two-third than in the wild type kernel (Tsai and Nelson
1969) The activities AGPase and SS are also reduced in the shrunken-4 mutant
while reducing the total amount of pyridoxal-5-phosphate in the endosperm by
8-fold than in the wild type endosperm (Tsai and Nelson 1969) This reduction
was identified as the lack of SP cofactor pyridoxal-5-phosphate in the shrunken-
4 mutant in the maize (Tsai and Nelson 1969) However external addition of
pyridoxal-5-phosphate to the assay system for SP activity of the mutant did not
affect the activity (Yu et al 2001) Thioreactive agents such as diethyl
pyrocarbonate phenylglyoxal have also been identified as some of the chemical
inhibitors of SP (Mu et al 2001)
The pho1 mutants developed in rice endosperm have helped to elucidate
the in vitro role of SP on the other major starch biosynthetic enzyme isoforms
(Satoh et al 2008) Induced mutagenesis of SP by N-methyl-nitrosourea
treatment led to the creation of a series of mutants with a considerable
reduction in starch contents from the seed morphologies varies from white-core
pseudonormal to shrunken in rice particularly at different temperatures (varied
from 20oC to 30oC) (Satoh et al 2008) The white-core phenotypes made
approximately 18 and 20 mg of grain weight in pseudonormal approximately
18 and 19 mg and in shrunken made 10 and 8 mg of grain weight where the
wild type approximately made 22 mg both at 30oC and 20oC temperatures
respectively Scanning electron microscopy showed that the sizes of the starch
37
granules were decreased (shrunken phenotype had the smallest granules than in
the wild type) in the mutant lines and some granules were more spherical than
the irregular polyhedron-shaped granules typical of wild-type starch grains
High-resolution capillary electrophoresis technique was used to measure the
chain length distribution of the amylopectin in the endosperm The mutants
created a higher proportion of DP=11 shorter glucan chains with a decrease in
the proportion of intermediate chains with a DP= 13-21 Even though the seed
weight was varied within the white-core pseudonormal and shrunken
phenotypes of the mutants they have demonstrated a similar change in chain
length distribution in the amylopectin In contrast this study also showed that
the Pho1 mutants did not have any effects on the measurable activity levels of
the other major starch biosynthetic enzymes such as AGPase DBE isozymes
(isoamylase and pullulanase) SBE isoforms (SBEI SBEIIa and SBEIIb) and SS
isoforms (SSI and SSIIIa) (Satoh et al 2008) Based on these results the
authors suggested that the SP could operate at two distinct phases of starch
biosynthesis one phase consisting of starch initiation and a second phase is in
starch elongation (Satoh et al 2008) The in vitro analysis of chain length
elongation properties of recombinant SP and SSIIa from rice were compared on
MOS of DP=4 DP=6 or DP=7 glucan primers Despite the type of primer used
in the reaction the two enzymes showed different product distributions to each
other (Satoh et al 2008) SP produced a broad distribution of MOS products of
increasing size mostly DP= 6-11 SSIIa showed a much narrower distribution
(DP= 6-7) of MOS products The results clearly indicated that SP can synthesize
much longer linear glucans (DP= 16) than SSIIa (DP= 7-9) (Satoh et al 2008)
38
In addition the catalytic activity of SP from rice is significantly higher (75
mmoles G-1-Pmg proteinmin) toward MOS than SSIIa is (24 nmoles
ADPglucosemg proteinmin) Therefore these results support a role for SP in
extending small MOS whereas rice SSIIa is unlikely to be involved in this
process The authors further suggested that these longer linear glucan chains
which are produced by SP could presumably be the linear substrates for SBE to
form branched glucans in the starch initiation process (Satoh et al 2008)
Functional interactions between SP and SBE isoforms were observed in
vitro and showed that purified SP from rice endosperm synthesized glucans
from G-1-P in the presence of different isoforms of SBE even without any
exogenous glucan primer (Nakamura et al 2012) Glucan production was higher
by SP when SBEI was present compared to SBEIIa or SBEIIb and produced
glucan polymers with DP =11 7 and 6 respectively (Nakamura et al 2012)
Activities of SP and SBE were depended on the mutual availability SP and SBE
and showed mutual capacities for chain elongation and chain branching
(Nakamura et al 2012)
The isoforms of the major enzymes involved in starch biosynthesis are
regulated by protein phosphorylation and protein-protein interactions (Liu et al
2009 Hennen-Bierwagen et al 2008 Tetlow et al 2008 Tetlow et al 2004)
Plastidial SP in wheat endosperm is also involved in formation of active protein
complexes with the SBEI and SBEIIb particularly in wheat amyloplast stroma in
a phosphorylation-dependent manner (Tetlow et al 2004) Novel complexes of
starch synthesis enzymes assembled in the amylose extender (ae-) mutant
(lacking SBEIIb) of maize (Liu et al 2009) The complex formed by SSI SSII
39
with SBEIIb in wild-type was replaced by forming SBE1 combined with SP in the
ae- mutant (Liu et al 2009) Genetic analyses further revealed that the loss of
SBEIIb in ae mutant could cause a significant increase in the SBEI SBEIIa
SSIII and SP in the starch granule (Liu et al 2009 Grimaud et al 2008)
112165 SP and starch biosynthesis models
Based on recent genetic and biochemical evidence some researchers
suggested that SP may play a role in the initiation of starch biosynthesis (Satoh
et al 2008 Leterrier et al 2008 Roldan et al 2007) Tickle et al (2009)
recently suggested a model in which SP plays a role in starch synthesis via two
pathways First SP degrades the soluble malto-oligosaccharides (MOS) which
are made from starch via the action of DBE into G-1-P in the amyloplast
stroma This G-1-P can then be converted to ADP-glucose by AGPase and to
recycled back into starch The second mechanism suggests that SP can directly
act on the surface of the starch granule where it could phosphorolytically
modify the structure of starch to produce G-1-P (Tickle et al 2009) Recent
mutant analysis in Arabidopsis suggests plastidial SP is not required in starch
degradation in chloroplasts (Zeeman et al 2004) The leaves of mature SP
mutant plants had small white lesions on the tips or margins of fully expanded
leaves It was suggested that SP may play a role in creating tolerance to abiotic
stresses in leaves by providing an alternate route for starch degradation
(Zeeman et al 2004)
40
The existence of a complementary path of forming reserve starch was
discussed in potato by analyzing the effect of the G-1-P-dependent intracellular
carbon flux (Fettke et al 2010) The tuber discs of wild-type and various
transgenic potato lines expressing an antisense construct directed against the
plastidial SP isofoms were incubated with 14C-lablled G-1-P G-6-P sucrose and
maltose Highest amount of starch was measured in G-1-P substrate compared
to G-6-P sucrose and maltose indicating that the path of starch biosynthesis is
functional that is selectively initiated by the uptake of the anomeric glucose
phosphate ester (Fettke et al 2010) The initiation of this path is separated
against external glucose 6-phosphate Rice SP mutants grown at 300C produced
about 6 of the shrunken phenotypes (compared to 100 in wild-type) the
starch content was similar in the wild-type and the percentages of shrunken
phenotype was increased in SP mutant plants when the temperature was
decreased to 250C and 200C by 35-39 and 66 respectively with a severe
reduction in starch accumulation It was suggested that SP may play an
important role in starch biosynthesis during fluctuating andor adverse
temperature conditions in rice (Satoh et al 2008)
112166 Evidence of interaction of SP with SSIV
Research evidence suggested potential interactions between the SP and
SSIV enzymes In Arabidopsis thaliana leaves the activity of SP increased in ss4
mutants by 14 -2 fold compared to the wild-type without changing starch
structure or the amyloseamylopectin ratio and the concentrations of soluble
sugars remain unchanged (Roldan et al 2007) However granule size was
41
increased in ss4 mutants with a reduction in the granule number to 2-3 granules
per amyloplast compared to the 4-5 granules in wild-type (Roldan et al 2007)
Interestingly the double mutant of ss4 and sp produced granule size of at least
4 times higher than starch granules originating from the wild-type plants
(Planchot et al 2008)
1122 Post translational modification of starch biosynthesis enzymes
Protein phosphorylation allosteric and redox modification are the major
post translational modifications which take place in order to control the activity
of enzymes Phosphorylation of major starch biosynthetic enzymes was recently
discovered by Tetlow et al (2004) who investigated the role of protein
phosphorylation as a mechanism of regulation of the starch synthesis in
developing wheat endosperm After incubating intact plastids from wheat with -
[32P]-ATP it was found that three isoforms of SBErsquos (SBEI SBEIIa and SBEIIb)
were phosphorylated on serine residues (Tetlow et al 2004) The activity of
SBEIIb in amyloplasts and SBEIIa in chloroplasts was stimulated by
phosphorylation whereas dephosphorylation using alkaline phosphatase reduced
catalytic activity (Tetlow et al 2004)
There is increasing evidence that starch synthesis does not consist of
several isolated and simple reactions as indicated in Figure 13 The interaction
and coordination of starch biosynthetic enzymes appears to be a general feature
of starch biosynthesis in plants Starch biosynthetic enzymes form heteromeric
protein complexes that are probably involved in starch synthesis (Hennen-
Bierwagen et al 2008 Tetlow et al 2008 Tetlow et al 2004) Co-
42
immunoprecipitation experiments revealed that SP SBEIIb and SBEI form a
protein complex of three enzymes when only these enzymes are phosphorylated
within the soluble protein fraction in wheat amyloplasts lysates (Tetlow et al
2004) Dephosphorylation with alkaline phosphatase disassembled the complex
formed (Tetlow et al 2004) suggesting that the protein-protein interactions are
likely to be phosphorylation-dependent In developing endosperm of barley the
sex6 mutant lacking SSIIa resulted a reduction in amylopectin synthesis to less
than 20 of the wild-type levels and production of high amylose starches
(Morell et al 2003) A pleiotropic effect of the SSIIa mutation abolished the
binding of SSI SBElla and SBEIIb to the starch granules while not significantly
altering their expression levels in the soluble fraction (Morell et al 2003) In
wheat endosperm physical interactions between SSrsquos and SBErsquos were detected
and two distinct complexes identified (Tetlow et al 2008) The authors found
one complex consisting of SSI SSII and SBEIIa and another complex with SSI
SSII SBEIIb Furthermore both of these complexes are phosphorylated and in
vitro dephosphorylation with alkaline phosphatase resulted in disassociation of
the proteins In maize amyloplasts a multi-subunit complex containing SSIIa
SSIII SBEIIa and SBEIIb was detected using gel permeation chromatography
(Hennen-Bierwagen et al 2008) The authors also located another complex
consisting of starch synthesizing enzymes SSIIa SBEIIa and SBEIIb In the ae-
mutant lacking SBEIIb a novel protein complex was found in which SBEIIb was
replaced by SBE1 and SP (Liu et al 2009) Analyses further revealed that
eliminating SBEIIb in ae- mutant caused significant increases in the abundance
of SBEI SBEIIa SSIII and SP in the granule (these proteins are not found in
43
the granule in the granules of wild-type maize) without affecting SSI or SSIIa
(Grimaud et al 2008) Staining the internal granule-associated proteins using a
phospho-protein specific dye revealed phosphorylation of at least three proteins
GBSS SBEIIb and SP (Grimaud et al 2008) This evidence added weight to the
hypothesis that starch synthesizing enzymes exists as hetero complexes in
developing cereal endosperm and these proteins eventually become granule-
associated via as yet unknown mechanisms
12 Objectives of the study
As the research evidence indicates SP may have the potential to be
involved in starch synthesis possibly involving the formation of protein
complexes with other enzymes Therefore the first aim of this research project
was
To determine whether the SP is involved in starch biosynthesis in maize
endosperm by interacting with starch biosynthetic enzymes and forming
protein complexes
The second objective was to understand the involvement of SP in starch
synthesis in maize and explore possible interactions with SSIV
The third objective was to investigate if the SP-involved protein-protein
interactions are regulated by protein phosphorylation
The results in this thesis discuss the possible interaction of SSIV and SP
and the mechanisms of their regulation through phosphorylation in wild type
developing maize endosperm using the amyloplast lysates and partially purified
44
recombinant SP This research aims to provide further insight into our growing
understanding of coordinated activity of different enzymes associated in starch
synthesis through protein-protein interactions and complex formation in
developing maize endosperm The results in the thesis outline the biochemical
characterization of SP and SSIV in developing maize endosperm and explore
possible protein-protein interactions of SP and other starch biosynthetic
enzymes The protein complexes in amyloplasts could influence the quality as
well as the quantity of starch in developing endosperm through the modulation
of the granule structure Understanding of the basis of these modulations in
starch is therefore essential Starch produced in plastids provides up to 80 of
the food calorie requirement of humans with various potential applications in
nonndashfood industries Application of starch in food and non-food industries is
depends on different structural and functional properties of starch which can be
modified with the knowledge of its genetic manipulations This research
expected to enhance our understanding of the basics of starch biosynthesis to
develop models of starch structure assembly
45
CHAPTER 2
46
Biochemical Investigation of the Regulation of Plastidial Starch
Phosphorylase in Maize Endosperm
21 Introduction
Starch phosphorylase (SP) is a tetrameric orand dimeric enzyme which
catalyses the addition of glucosyl units from glucose-1-phosphate (G-1-P) to the
non-reducing end of α-1-4 linked glucan chains liberating inorganic phosphate
(Pi) in forward reaction and produces G-1-P while degrading glycosyl units in
reverse reaction SP is potentially involved in both starch synthesis and
degradation as shown in the following equation
G-1-P + (14-α-D-Glucose)n (14-α-D-Glucose)n+1 + Pi
Two isoforms of SP are found in higher plants designated by their sub-
cellular localization the plastidial (Pho1) and the cytosolic (Pho2) (Zeeman et al
2004 Steup et al 19881981 Nakano and Fukui 1986) The plastidial form
(Pho1) in maize endosperm is designated as SP in this thesis
211 Cytosolic form of SP (Pho2)
The extraplastidic (Pho2) starch phosphorylases do not contain L-78
amino acid insertion as in plastidial form (Pho1) and they are much more
effective in degrading processes (Zeeman et al 2004 Steup et al 1988) Pho2
preferentially degrades branched starch molecules and can even attack starch
47
granules in vitro (Steup et al 1988) However in starch-accumulating tissues
like developing seeds and leaves which maintain intact amyloplasts or
chloroplasts cytosolic Pho2 has no direct access to the starch inside the plastid
Cytosolic SP may be involved in regulating the cytosolic G-1-P level by
glucosylating and trimming a heteropolysaccharides found in the cytosol
produced mainly from maltose (a product of starch breakdown inside the
plastid) which is translocated to the cytosol through MEX1 transporter located in
the plastidic membrane (Yang and Steup 1990 Steup et al 1991 Buchner et al
1996 Pyke 2009 Rathore et al 2009) The production of metabolites such as
maltose and glucose which are exported to cytosol are involved in glycan
metabolism by the action of cytosolic phosphorylase (Pho2) disproportionating
enzyme cytosolic transglucosidase and Pho2 produces G-1-P in the cytosol
(Pyke 2009 Zeeman et al 2004) Fig 21 illustrates the putative roles of
plastidial (Pho1) and cytosolic (Pho2) SP in starch metabolism in plants
212 Plastdial SP (Pho1)
The plastidial isoform of SP Pho1 is present throughout endosperm
development in cereals (Schupp and Ziegler 2004 Satoh et al 2008 Tickle et
al 2009) The Pho1 also contributes the highest proportion of the total SP
activity in the endosperm and remains active throughout the endosperm
development in rice endosperm (Satoh et al 2008) Also the mutation in Pho1
in rice endosperm produces a shrunken phenotype endosperm with reduced
starch content and altered starch granule structure in rice (Satoh et al 2008)
The shrunken 4 mutants lacking plastidial SP activity in maize endosperm
48
produce endosperms with reduced starch contents (Tsai and Nelson 1969) and
the fact that Pho1 does not appear to influence starch degradation in
Arabidopsis thaliana (Zeeman et al 2004) suggests plastidial SP may play a role
in the storage starch biosynthesis or play a subsidiary role in to the α-
amylolytic pathway in starch in starch degradation
Figure 21 Schematic diagram illustrating the putative roles of plastidial (Pho1) and cytosolic (Pho2) SP in starch metabolism in plants The dashed lines indicate
that there may be intermediate steps in the pathways ADGP=ADP glucose pyrophosphorylase SS= starch synthases SBE= starch branching enzymes DBE= debranching enzymes DPE1DPE2= Disproportionating enzymes GWD=
glucan water dikinase PWD=phospho-glucan water dikinase Glc-1-P= glucose-1-phosphate GT= glucose transporter MEX1= maltose transporter TPT= triose
phosphate transporter (Modified from Rathore et al 2009)
49
The biochemical characteristics of plastidial SP such as the lower affinity
towards the high molecular starch and the higher affinity towards the low
molecular weight linear malto-oligosaccharides (MOS) in sweet potato tubers
(Young et al 2006) suggested the possibility that SP acts on elongating the
shorter glucan chains and might be also involved in the process of granule
initiation The 78 amino acid insertion (L-78) in the middle of the sequence in
Pho1 but not in cytosolic Pho2 is a prominent molecular characteristic in all the
plant species investigated This insertion prevents the binding of SP to large
highly branched polysaccharides in sweet potato tubers (Young et al 2006) In
contrast in cereals SP showed higher affinities towards to amylopectin than
glycogen in synthetic direction and to MOS in phosphorylitic direction (Mori et al
1993 Mu et al 2001 Schupp and Ziegler 2004)
The plastidial form of SP in maize endosperm amyloplasts is 112 kDa in
size and known to be the second most abundant enzyme presence next to the
SBEIIb (Yu et al 2001) In addition to the presence of the L-78 insertion in the
middle of the maize SP protein sequence the N-terminus of maize amyloplast
SP does not align with any other N-terminus sequences of SP available in the
gene bank (Yu et al 2001) Due to the variability in the N- terminus of the
enzyme SP in maize and other plastidial SP forms may have different regulatory
mechanism for example the N-terminus of the protein generally contain signal
recognition peptides targeting peptides and important in enzyme regulation
(Fig 22)
The first evidence for the post translational regulation of SP described the
phosphorylation of SP and its involvement in phosphorylation-dependent
50
protein-protein interactions in wheat amyloplast stroma with SBEI and SBEIIb
(Tetlow et al 2004) In the maize ae1 mutant amyloplasts lacking SBEIIb
novel protein complexes are found with SP these include SSI SSIIa SBEI and
SBEIIa (Liu et al 2009) The ae2 mutant contains an inactive form of SBEIIb
found to be associated in complex formation with SSI SSIIa and SBEI both in
the stroma and the granule (Liu et al 2012) Interestingly the SP is not involved
in complex formation in ae2 mutant as seen in ae1 mutant (Liu et al 2012)
Indirect evidence implicates interactions between SP and SSIV in
mutants of Arabidopsis The activity of both Pho1 and Pho2 increased in SSIV
mutants (Atssiv1 and Atssiv2) by 14 -2 fold compared with the wild-type in
Arabidopsis thaliana leaves where transient starch is synthesized (Roldan et al
2007) However there was no significant influence on starch structure or the
amyloseamylopectin ratio in these mutants and the concentrations of soluble
sugars remain unchanged (Roldan et al 2007) A double mutant produced by
the insertion of an heterologous T-DNA within the nucleic sequence of an intron
or an exon lacking both Pho 1 and SSIV activity produced 1-2 granules per
plastid (3-4 granules per plastid in wild-type) but increased the granule size by
at least four times higher than the starch granules originating from the their
single mutants plants in Arabidopsis (Planchot et al 2008 patent EP1882742)
However no evidence is currently available to show any direct relationship
between SP and SSIV in storage starch synthesizing tissues
The active Pho1 enzyme exists as an assembly of dimeric or tetrameric
subunits in maize and different multimeric forms of SP in maize might be
involved in the formation of different protein complexes (Liu et al 2009 Mu et
51
al 2001) Previous studies confirmed that SP activity can be modulated by the
substrates ratio of G-1-PPi (Schupp and Ziegler 2004 Mu et al 2001) and
ADP-glucose (Matheson and Richardson 1978) Comparatively less information
is available on SP regulation by protein phosphorylation in storage starch
synthesizing tissues Unlike the SP mutant lines developed in rice (Satoh et al
2008) and Arabidopsis (Roldan et al 2007 Planchot et al 2008) there are no
genetically developed mutants lines available in maize The shrunken-4 mutant
has reduced SP activity but this is probably due to alterations in levels of
pridoxal-5-phosphate the essential cofactor for SP activity in the endosperm
(Tsai and Nelson 1969)
The objectives of this study were to characterize and investigate the role
and regulation of Pho1 in maize wild-type amyloplasts by protein
phosphorylation and protein-protein interactions Moreover the possible
involvement of SP in granule initiation was tested specifically by testing the
possibility of interactions between SP and SSIV in the amyloplast
52
22 Materials and Methods
221 Materials
2211 Plant materials
The wild type maize (C G 102) (Zea mays) was used in all experiments
The cobs were collected at different growth stages (5-35 days after anthesis)
from wild type maize plants grown under the normal field conditions Cobs were
kept at +40C cold room until use for amyloplast extractions The kernels were
also collected and frozen at -800C for future use for whole cell (crude) extracts
2212 Chemicals
All chemicals were obtained from Sigma Aldrich unless otherwise stated
222 Methods
2221 Amyloplast purification from maize endosperms
Endosperms harvested at 22 days after anthesis (DAA) from the wild-type
of maize plants were mainly used to purify the amyloplasts in the experiments
unless otherwise stated This stage of endosperm development was found to be
the major grain-filling period (Liu et al 2009) Amyloplasts are purified to
remove any contaminating proteins that may be found in maize whole cell
lysates Maize amyloplast extraction was performed as described by Liu et al
2009
Approximately 100g of the endosperms were taken from the developing
kernels with a spatula and gently chopped with a razor blade in 40-50 mL of ice-
cold amyloplast extraction buffer (50 mM N-(2-hydroxyethyl) piperazine-Nrsquo-
53
ethanesulphonic acid (HEPES)KOH pH 75 containing 08 M sorbitol 1 mM
KCl 2 mM MgCl2 and 1 mM Na2-EDTA) on a petri dish on ice until firmly
chopped in to creamy solution The resulting whole cell extract was then filtered
through four layers of Miracloth (CalBiochem catalogue no 475855) wetted in
the same buffer Then the filtrate was then carefully layered onto 15 mL of 3
(wv) Histodenz (Nycodenz Sigma catalogue no D2158) in amyloplast
extraction buffer followed by centrifugation at 100xg at 40C for 20 min and the
supernatant was carefully removed The pellet with intact amyloplasts was
ruptured with 1 mL of ice-cold rupturing buffer containing 100mM N-tris
(hydroxymethyl) methyl glycine (Tricine)KOH pH 78 1 mM dithiothreitol
(DTT) 5 mM MgCl2 and a protease inhibitor cocktail (5μl per 1 mL buffer) (see
Appendix 09 for details) Then the mix was transferred into micro-centrifuge
tubes and centrifuged at 13000xg at 40C for 5 min to remove starch The
soluble fractions were frozen in liquid nitrogen and stored at -800C until further
use The amyloplast lysates were ultra-centrifuged at 100000xg for 15 min
before use to remove plastidial membranes
2222 Preparation of whole cell extracts
Whole cell extracts were prepared as described previously by (Tetlow et
al 2003) Approximately 10 g of endosperm tissue was quickly frozen in liquid
nitrogen and immediately ground into a fine powder adding liquid nitrogen on
ice using a chilled mortar and pestle The frozen powder was mixed with ice-cold
rupturing buffer (same rupturing buffer used in amyloplast purification) and a
protease inhibitor cocktail (5 μL per 1 mL buffer) (see Appendix 09 for details)
54
The mixture was further mixed and allowed to stand on ice for 5 min followed by
centrifugation at 13000xg for 5 min at 40C The supernatant was subjected to
ultracentrifugation at 100000x g for 15 min in a Beckman Coulter Optima-Maxndash
XP ultracentrifuge to remove membranes and particulate material The
supernatant obtained following the ultracentrifugation was used for experiments
2223 Localization of SP in the plastid
To investigate the proportional of SP and other starch biosynthetic
proteins in the stroma-granule interface where the proteins are imbedded on
granule surface the remaining pellet (approximately 1 g of fresh weight) from
the isolation of amyloplast lysates (as described in section 2221) was
subjected to a series of washings (for up to 10 times) with rupturing buffer (03
mLwashing stage) used in amyloplast extraction The supernatant was collected
after centrifugation at 13000xg for 5 min and the proteins were separated on
the SDS gels and the proteins are visualized by silver staining and identified by
immunoblotting
2224 Preparation of granule bound proteins
The granule bound protein was isolated as the method described by
(Tetlow et al 2004) After rupturing of the amyloplasts and the separation of
soluble protein fractions by centrifugation (as described in section 2221) the
remaining pellets (approximately 1g) were resuspended in 1 mL of cold aqueous
washing buffer [50 mM Tris (hydroxymethyl) aminomethane (TRIS)-acetate pH
75 1 mM Na2 -EDTA and 1 mM DTT] and centrifuged at 13000 rpm for 1 min
55
at 40C This washing step was repeated 8 times The pellet was then washed
three times with 1 mL acetone each time followed by three washes with 2
(wv) SDS (1 mL each time) Starch granule bound proteins were extracted by
boiling the washed starch in 2XSDS loading buffer [625 mM TRIS-HCl pH 68
2 (wv) SDS 10 (wv) glycerol 5 (vv) β-mercaptoethanol 0001 (wv)
bromophenol blue] for 5 min at 900C The boiled samples were cooled and
centrifuged at 13 000xg for 5 min and supernatants separated by SDS-PAGE
2225 Biochemical characterization of SP in maize endosperm
22251 Phosphorylation and dephosphorylation of amyloplast lysates
The amyloplast lysatescrude extracts were incubated with 1 mM ATP to
stimulate protein phosphorylation by protein kinases present in the endosperm
To prevent in vitro dephosphorylation the lysates were also incubated with
phosphatase inhibitor cocktail (10 μl1ml lysates) in a separate tube as a
control Another treatment involved the incubation of maize amyloplast lysates
with alkaline phosphatase conjugated to agarose beads (APase insoluble form
suspension in (NH4)SO4 final conc 25 unitsmL) to promote non-specific
dephosphorylation Untreated amyloplast lysates were used as the control in all
phosphorylation experiments All samples had gt1 mM MgCl2 Rupturing buffer
was added to balance the total end-volumes of the treatments Phosphatase
inhibitor (PI) was added to inhibit the endogenous alkaline phosphatases in the
sample as a control (see appendix 09 section 1 for the details about PI)
56
22252 Enzyme assays
222521 Starch phosphorylase glucan synthetic activity assay
The synthetic activity of SP was assayed in vitro by using amylopectin
glycogen and maltoheptaose as the substrates 80 μL of glucan substrates
(25 [wv] prepared in 100 mM MES-NaOH [pH 60] only amylopectin was
gelatinized before adding to the mixture) and 20 μL [U14C]-G-1-P (GE Health
care catalogue No CF0113 10 mM stock 01μCi prepared in 100 mM MES
[pH 60]) were added to a clean 15 mL micro centrifuge tube [U-14
C]-G1P was
used The reaction was initiated by adding 100 μL extract in 10 second intervals
and terminated after incubated for 30 minutes at 37degC by the addition of 1 mL
stop solution (75 [vv] methanol 1 [wv] KCl) Samples were then
centrifuged at 10000g for 5 minutes The supernatant was removed and the
remaining pellet was resuspended in 300 μL H20 before the addition of 1 mL
stop solution Samples were then centrifuged for a further 5 minutes at
10000xg for 5 min and the supernatant was removed The pellet was
resuspended in 300 μL H20 and added to 37 mL Ecoscinttrade scintillation cocktail
and radioactivity was measured in a liquid scintillation analyzer (Bekman
Coulter-USA ls-6500 Multi-purpose scintillation counter) Amount of [U-14
C]-G-
1-P incorporated into glucan was calculated
222522 Starch phosphorylase glucan degradative activity assay
SP phosphorolytic activity was determined based on the procedure
described by (Tickle et al 2009) The G-1-P formed in the phosphorolysis
57
direction was converted to glucose-6-phosphate (G-6-P) by
phosphoglucomutase and then the G-6-P converted to 6-phopsphogluconate by
glucose-6-phosphate dehydrogenase The amount of NADH was released at this
step was analyzed at 340nm the amount of NADH was equal to the amount of
G-1-P produced in the reaction In the procedure for one reaction (1 mL final
volume) final concentration of 20 mM HEPES (pH 70) was added to a 1 mL
plastic cuvette with final concentrations of 5 mM MgCl2 025 mM NAD 0024
mM glucose-16-bisphosphate and 1 [wv] substrate (glycogen amylopectin
and maltoheptose) (all solutions were prepared in 50 mM HEPES [pH 70]) 37
μL phosphoglucomutase (05 unitsμL-1
) 100 μL of amyloplast lysates (095
mgmL concentration) and 16 μL glucose-6-phosphate dehydrogenase (032
unitsμL-1
) This reaction was initiated by the addition of 45 mM Na2HPO
4 as the
source of Pi
22253 Gel filtration chromatography (GPC)
Extracts of soluble proteins from maize amyloplasts and whole cell
extracts (500 μL loading volume) were separated through a Superdex 200
10300GL gel permeation column (equilibrated with two column volumes of the
rupturing buffer) on an AKTA- FPLC system (Amersham Pharmacia Biotech
model No 01068808) The column was calibrated using commercial protein
standards from 137 kDa to 669 kDa (GE Healthcare Gel Filtration Calibration
Kits low molecular and high molecular weight) The column was pre-equilibrated
with two column volumes of running buffer containing 10 mM HEPES-NaOH pH
58
75 100 mM NaCl 1 mM DTT and 05 mM PMSF at a flow rate of 025 ml
min_1 05 ml fractions were collected
2226 Protein analysis
22261 Quantification of proteins
Protein content was determined using the Bio-Rad protein assay (Bio-Rad
Laboratories Canada) according to the manufacturerrsquos instructions and using
bovine serum albumin as the standard
22262 Sodium dodecyl sulfate polyacrylamide gel electrophoresis
(SDS-PAGE)
SDS-PAGE was performed using a Mini-Protean III Vertical Electrophoresis
System (Bio-Rad) according to the manufacturerrsquos instructions Proteins were
separated on SDS-PAGE on 10 acrylamide gels The compositions of 3
stacking gel and the separation gel was shown in Table 21 Prior to
electrophoresis proteins were mixed with SDS sample buffer (625 mM Tris-HCl
pH 68 2 [wv] SDS 10 [wv] glycerol 5 [vv] b-mercaptoethanol
0001 [wv] bromophenol blue) and boiled for 5 min at 900C The gel was run
using 025 M Tris (pH 72) 192 mM Glycine 04 SDS running buffer at 120V
for 15hr
59
Table 21 The composition of stacking and resolving gels for SDS-PAGE
Stock solution SDS-PAGE (10 mL) Stacking gel Resolving gel
(5 acrylamide) (10 acrylamide)
ProtoGelreg
Acrylamidebisacrylamide 168 34 (30[wv])
05M Tris (pH 68) 128 - 15M Tris (pH 88) - 26 10 (wv) SDS 01 01
10 (wv) ammonium persulfate 0112 01 Distilled water 7 38
TEMED 0008 001
22263 SP-Native affinity zymogram
Zmogram analysis was used to identify the activity of the proteins as
described by (Tickle et al 2009) The extracts were separated by substrate-
affinity (glycogen amylopectin and maltoheptaose) non-denaturing PAGE The
non-denaturing gels were prepared as 8 (wv) polyacrylamide gels containing
glycogen (01 wv) (Table 22) The composition of the stacking gel and the
resolving gel are shown in Table 22 Following electrophoresis the gels were
incubated for 16 hours at 28degC in substrate buffer containing (01 [wv]
glycogen 20 mM G-1-P made up in 100 mM sodium citrate [pH 65]) to test the
synthetic activity Phosphorylitic activity was tested by incubating the gel
containing (01 [wv] glycogen 20 mM Na2HPO4 made up in 100 mM sodium
citrate [pH 65]) and incubated under same conditions as used in synthetic
activity gels Gels were then rinsed briefly in sodium citrate (100 mM pH 65)
before covering the gel for up to 1 minute in Lugol solution (02 [vw] iodine
2 [vw] potassium iodide) Gels were subsequently rinsed in distilled water
and photographed immediately
60
Table 22 Composition of non- denaturing 8 acrylamide gels (without SDS)
containing 01 (wv) glycogen prepared as follows
Stock solution Resolving gel (10 mL) Stacking gel (5 mL) H2O 47 (mL) 355 (mL)
30Acrylamide 26 (mL) 084 (mL) 15M Tris pH 88 26 (mL) -
1M 5M Tris pH 68 - 064 (mL) 10 APS 01 0056 01 glycogen 10 (mg) -
TEMED 10 μL 4 μL
22264 Coomassie blue staining
Polyacrylamide gels were stained in Coomassie Blue stain (42 [vv]
methanol 18 [vv] acetic acid 01 [wv] Coomassie Brilliant Blue R 250) for
1hr and destained overnight in 42 [vv] methanol 18 [vv] acetic acid
Then the gel was washed in distilled water
22265 Silver staining
Following the electrophoresis the polyacrylamide gel was kept in 50 mL
fixing solution (50 Methanol [vv] 5 acetic acid [vv]) for 20min on a
shaker and washed the gel in washing buffer (50 Methanol [vv]) for 10min
and with distilled water at least for 1hr Then the gel was transferred to
sensitizing buffer (002 Na2S2O3 [wv]) for 1min and washed the gel twice in
distilled water for 2 min each time The gel was stained in ice-cold silver nitrate
buffer (01 AgNO3 [wv]) for 20 min and washed the gel in distilled water for 2
min each time Developed the gel in developing solution (2 Na2CO3 [wv]
004 formalin [vv]) for 5-7 min until the proteins bands were visualized
61
Staining was stopped by adding the stop solution (5 acetic acid [vv]) for 5
min and transferred to distilled water
22266 Mobility shift detection of phosphorylated proteins
(Phosphate affinity SDS-PAGE using Acrylamide-pendant Phos-TagTM
The Phos-Tag affinity ligand (10 μmolL Phos-tagTM AAL) was used to
detect phosphorylated proteins using the SDS-PAGE gels A dinuclear metal
complex (Mn2+) acts as a selective phosphate-binding tag molecule and the
Phos-Tag binds to the phosphate group of the phosphorylated protein and
retards the movement of the phospho protein in the SDS-PAGE gel The
phosphorylated and nonphosphorylated proteins were detected by immunoblot
analysis The composition of the gel prepared (see in Table 23) and the
experimental procedure is described as below The gel was run at 10 mA for 14
hours at room temperature
Solutions
1 Stock solution of 50 mmolL Phos-tagTM AAL Solution containing 3 (vv)
MeOH (Phos-tagTM AAL-107 10 mg was mixed with methanol 010 mL and
distilled water 32 mL) This oily product was stored in dark at 40C until use
2 10 mmolL MnCl2 Solution was prepared by dissolving 010 g MnCl2 (H2O)4
(FW 198) in 50 mL of distilled water
62
Table 23 The Gel preparations for Phos-TagTM analysis
Stock solution Resolving Gel (10 mL) Stacking Gel (10 mL)
10 (wv) acrylamide and (5 (wv) acrylamide) 50 μmolL Phos-tag TM AAL)
30 (wv) Acrylamide Solution 40 mL 150 mL
15 molL TrisHCl Solution pH 88 2 25 mL 250 mL (pH 68) 5 mmolL Phos-tag AAL Solution 01 mL - 10 mmolL MnCl2 Solution 01 mL -
10 (wv) SDS Solution 01 mL 010 mL 10 (wv) Diammonium Peroxydisulfate 01μL 010 μL
Distilled Water 31 mL 50 mL TEMED (tetramethylethylenediamine) 10 μL 80 μL
22267 Immunological techniques
222671 Preparation of peptides and antisera
Polyclonal antibodies were raised in rabbits against the synthetic peptides
derived from the sequence of maize SP (YSYDELMGSLEGNEGYGRADYFLV)
corresponding to residues 917ndash943 of the full length sequence (GenBank
accession no AAS33176) Synthetic polypeptides were raised to the polyclonal
rabbit antisera targeted to maize SSI SSIIa SBEI SBEIIa SBEIIb Iso-1 and
Iso-2 The specific peptide sequences used for the various antibodies were as
follows (Table 24)
63
Table 24 The synthetic peptides sequences derived from the primary amino acid sequences of starch biosynthetic enzyme isoforms of maize their location
in the full length sequence and the GenBank accession numbers
Enzyme Peptide Location GeveBank Accession Isoform Sequence in Full Length Number Sequence
SSI AEPTGEPASTPPPVPD 72-87 AAB99957 SSIIa GKDAPPERSGDAARLPRARRN 69-89 AAD13341
SSIV ANHRNRASIQRDRASASI 55-72 AAC197339 SBEI KGWKFARQPSDQDTK 809-823 AAC36471
SBEIIa FRGHLDYRYSEYKRLR 142-157 AAB67316 SBEIIb PRGPQRLPSGKFIPGN 641-656 AAC33764 Iso-1 FTKHNSSKTKHPGTYIAC-NH2 269-286 AAA91298
Iso-2 ARSYRYRFRTDDDGVV 37-52 NP001105666 GBSSI QDLSWKGPAKNWENV 442-456 ABW95928
222672 Antibody purification
The peptide affinity columns were used to purify the various crude
antisera The columns were prepared as follows To make a 1 mL column the
respective synthetic peptide (2 mg) was dissolved in 1 mL of TRIS-HCl pH 85
(50 mM TRIS-HCl 5 mM EDTA) 2 mL sulpholink resin slurry (Pierce) was
washed in 1 mL TRIS-HCl pH 85 for six times The dissolved peptide was added
to 1 mL washed resin in a falcon tube and incubated on a rotor for 15min in
room temperature and for additional 30 min without rotating and added to the
column and column was washed with 3 mL TRIS-HCl pH 85 and then blocked
with 1 mL of 50 mM cysteine in the same washing buffer 5 mL antisera
containing the polyclonal maize antibodies were applied to the column and mix
on a rotator for overnight at 4oC with 3 mL of PBS 001 Na azide [wv Then
64
the column was washed with 10 ml RIPA [50 mM TRIS-HCl pH 75 150 mM
NaCl 1 (wv) nonyl phenoxylpolyethoxyl ethanol (NP-40) 05 (wv) Na-
deoxycholate 01 (wv) sodium dodecyl sulphate (SDS)] The column was
further washed with 10 ml sarcosyl buffer [NETN (20 mM TRIS-HCl pH 80 1 M
NaCl 1 mM Na2-EDTA and 05 (wv) NP-40)] followed by washing again with
10 ml of 10 mM TRIS-HCl pH 78 The antibody bound to the column was eluted
with 05 mL of 100 mM glycine pH 25 to a tube contained 05 mL 1M TRIS-HCl
pH 78 and the protein contents were measures The column was neutralized by
adding 10 mL of 10 mM TRIS-HCl pH 78005 [wv] sodium azide
222673 Immunoblot analysis
After electrophoresis the proteins in polyacrylamide gels were
transferred to nitrocellulose membranes (Pall Life Sciences) using a Mini Trans-
Blotreg
Electrophoretic Transfer Cell (Bio-Rad) according to the manufacturerrsquos
instructions The transfer buffer contains 10 running buffer 20 methanol
and 70 water Then the membrane was blocked with 15 bovine serum
albumen (BSA) in 1XTBA buffer and incubated overnight in diluted antibodies
using the methods described by (Tetlow et al 2004) The anti-maize antisera
were used in immunoblot analyses were diluted in 15 BSA in 1XTBA buffer as
follows 11000 for SSI SSIIa SSIIb SBEI SBEIIb and 1500 for SP SSII and
SSIV The bound antibodies were detected with alkaline phosphatase-conjugated
anti-rabbit IgG using a 5-bromo-4-chloro-3-indolyl phosphatenitro blue
tetrazolium liquid substrate developing solution (BCIPNBT)
65
222674 Immunoprecipitation
Immunoprecipitation was performed with amyloplast lysates using
methods previously described by (Tetlow et al 2004) The SP SSIIa and SBEIIb
antibodies were added at 30 mgmL concentration and the SSIV antibodies at 60
mgmL to 10 mg of amyloplast lysates and incubated for 1hr on a rotator at
room temperature Proteins were immunoprecipitated by adding 40 μL of 50
(wv) Protein A-Sepharose slurry (60 μL of slurry for SSIV) The Protein A-
Sepharose slurry was made by adding the phosphate buffer saline (137 mM
NaCl 10 mM Na2HPO4 27 mM KCl 18 mM KH2PO4) to the Protein A-Sepharose
beads and incubated for 1hr at room temperature Protein A-Sepharoseprotein
complex was centrifuged at 100 g for 2 min at 40C in a refrigerated micro
centrifuge and the supernatant was collected and denatured with the sample
running buffer containing SDS to use as an indicator of the immunoprecipitation
efficiency The remaining pellet Protein A-Sepharoseprotein complex was
washed eight times each with 1 mL phosphate buffered saline (PBS) followed by
three similar washes with 10 mM HEPESKOH pH 75 buffer (at 100 g 1 min
centrifugation) The immunoprecipitation pellet was boiled in 2X SDS loading
buffer for 8 min Co-immunoprecipitation was tested by probing with specific
anti-peptide antibodies of major starch biosynthetic enzymes
66
23 Results
231 Subcellular localization of SP in maize endosperm
To determine the subcellular localization of SP the amyloplast lysates the
granule-bound proteins of the starch granules separated from amyloplast the
whole cell crude extracts of the endosperm and the amyloplast membrane
protein were extracted from 22 DAA wild-type maize plants Immunoblot
analysis using peptide specific anti-Pho1 antibodies showed that there is no SP
in granules and in amyloplast membranes (Fig 22) The SP is mainly found in
the amyloplast lysates The proportional existence of the SP in the interface of
the soluble fraction and the granule as the granule surface imbedded protein
was tested by collecting the extracts as the supernatants after repeatedly
washing the granules nine times with rupturing buffer Fig 23A showed the
protein profile of the extracts collected after each washing (silver stained SDS-
PAGE gel) The proteins which were separated on SDS gels were identified by
probing the immunoblots with anti-peptide specific antibodies of starch
biosynthetic proteins SP SSI SSIIa SSIII SSIV SBEI SBEIIa and SBEIIb (Fig
23B) Most of the SP was found in wash 1 and 2 and slightly in was 3 4 and 5
There was no band detectable from wash 6-9 and the protein profile of SP was
similar with SSI and SBEIIb (wash 1 to 3) and SBEI (wash 1 to 4) SSIII and
SSIV were found in only the first wash whereas SSII was found clearly from
wash 1 to 7 (Fig 23B) To determine the granule bound SP 005 mg (wet
weight) of starch was taken out after every centrifugation stage during granule
washing and it was boiled with 200 μL of 2XSDS Immunoblots were probed with
67
anti-SP and anti-SSIIa specific antibodies (Fig 24) SP was not found in the
granules as a granule-bound protein while SSIIa which was found in the granule
and could not be removed by the washing treatment (Fig 24)
Figure 22 Immunoblots showing the subcellular localization of plastidial SP in maize endosperm the amyloplast lysates contain soluble amyloplast proteins
the granule-bound proteins of the starch granules separated from amyloplast the soluble protein fraction and starch granule-bound proteins of whole cell crude extract of the endosperm and the soluble protein fraction of the
amyloplast membrane protein extracts (A) Leaf crude extracts were probed with anti-SP antibodies are shown in (B) All samples were extracted from 22
DAA wild-type maize plants The blots were developed in two different experiments and both were probed with pastidial peptide specific anti-SP antibodies after equal amounts (25 microg) of proteins were run on SDS-PAGE
Arrows indicate the location of SP
(A) (B)
68
Figure 23 Analysis of the localization of proteins imbedded in the granule
surface Approximately 1 g of fresh weight of starch granules from the amyloplast was subjected to a series of washings with the 03 mL of 100mM
rupturing buffer for 9 times The supernatant was collected at each time and separated on the SDS gels and the proteins are visualized by silver staining (A) and identified by probing immunoblots with anti-peptide specific antibodies of
starch biosynthetic proteins as indicated (B) The numbers indicate the number of washings L=protein marker Target protein is indicated by the arrow in each
immunoblot
(A)
(B)
69
Figure 24 Analysis of the localization of proteins imbedded in the granule surface and loosely bound to the granules Approximately 1g of fresh weight of
starch from the amyloplast lysates was subjected to a series of washings with the 03 mL of 100mM rupturing buffer for 9 times The supernatant (soluble fraction) and 005g of the pellet was denatured in 2XSDS (200 μL) at each
washing (granule association) was collected at each time and separated on the SDS gels and the proteins are visualized by silver staining and identified by
probing the immunoblots with anti-SP and anti-SSIIa peptide specific antibodies of starch biosynthetic proteins as indicated in the blots The numbers indicate the number of washings L=protein marker
232 The synthetic activity of SP in developing maize endosperm
The synthetic activity of plastidial SP in developing maize endosperm was
determined by native affinity zymogram containing 01 glycogen in the gel
The amyloplast lysates were extracted from the endosperm at 12 15 19 22
days after anthesis (DAA) Activity bands were observed for all the
developmental stages tested (Fig 24A) The immunoblot was probed with
peptide specific anti-SP antibodies confirmed the activity bands are due to
plastidial SP (Fig 24B) The equal volumes of amyloplast lysates (30 μLwell)
70
were loaded on the gel The activities of SP shown on the gel did not vary over
the various developmental stages tested Synthetic activity of SP (22 DAA) was
slightly reduced when SSIIa was removed from amyloplast lysates but not the
SSIV (Appendix 01)
The SP in amyloplast lysates at 22 DAA age showed both synthetic and
phosphorolytic activities when both activities were tested in a glycogen affinity
native zymogram containing 01 glycogen in the gel (Fig 26) In synthetic
and degradative directions the gels were incubated at 1 2 5 10 and 20 mM
G-1-P and sodium phosphate dibasic (Na2HPO4) respectively When the activity
bands were visualized by Lugolrsquos solution the dark synthetic activity bands were
shown in all concentrations of G-1-P tested and the activity band was clear at all
concentrations of Na2HPO4 Both synthetic and degradative activities were
increased with increasing substrate concentrations (Fig 26)
Figure 25 The activity of Pho1 was observed in developing wild-type maize amyloplast lysates isolated 12-22 days after anthesis (DAA) using non-denaturing affinity native zymogram containing 01 glycogen in the gel (A)
Immunoblot of the zymogram gel was probed by peptide specific anti-SP antibodies to detect the SP protein in maize amyloplast (B) Pho1 is localized in
the amyloplast stroma and showed consistent activity in all the developmental stages of amyloplast measured
Days After Anthesis
12 15 19 22 12 15 19 22
A B
Days After AnthesisDays After Anthesis
12 15 19 22 12 15 19 22
A B
Days After Anthesis(A) (B)
71
Figure 26 The activity of SP in amyloplast lysates at 22 DAA age in the synthetic and phosphorolytic direction was tested on glycogen affinity native
zymogram contained 01 glycogen in the gel Following electrophoresis the gel was incubated overnight at 280C with the incubation buffer containing 01 glycogen and 1 2 5 10 and 20 mM glucose-1-phosphate (G-1-P) or sodium
phosphate (Na2HPO4) in synthetic and phosphorolytic directions respectively The activity bands were visualized by Lugolrsquos solution Arrows indicate the bands
corresponding plastidial SP
323 Investigating the regulation of SP by protein phosphorylation
The activities of the phosphorylated and dephosphorylated isoforms of SP
were analyzed on 01 glycogen affinity SP-native zymogram using amyloplast
lysates endosperm crude extracts and leaf crude extracts collected at 22 DAA
The soluble form of plastidial (Pho1) isoforms from maize endosperm
amyloplasts (Fig 27A1) both plastidial (Pho1) and cytosolic (Pho2) isoforms of
SP in the whole cell extract of endosperm (Fig 27B1) and the isoforms in
transient starch biosynthetic maize leaves (Fig 27C1) did not show any
detectable qualitative differences in the activities in both phosphorylated
20 10 5 2 1
mM mM mM mM mM
20 10 5 2 1
mM mM mM mM mM
G-1-P Na2HPO4
SP Synthetic Activity SP Phosphorylitic Activity
20 10 5 2 1
mM mM mM mM mM
20 10 5 2 1
mM mM mM mM mM
G-1-P Na2HPO4
SP Synthetic Activity SP Phosphorylitic Activity SP Synthetic Activity SP Phosphorolytic Activity
72
(treated with 1 mM ATP) and dephosphorylated (treated with 25 units of APase)
extracts when compared with the untreated controls (Fig 27) Immunoblot
analyses of the zymograms are respectively shown in A2 B2 and C2 which are
probed with peptide specific anti-Pho1
The mobility shift detection of proteins on phosphate affinity SDS-PAGE
using ligand bound Acrylamide-pendant Phos-TagTM showed no retardation in the
mobility of ATP-treated and untreated SP from amyloplast lysates (Fig 28)
73
Figure 27 Determination of the different activity levels of plastidial (Pho1) and cytosolic (Pho2) isoforms of SP following treatment with ATP and APase
The amyloplast lysates seed crude extract and leaf crude extracts collected at 22 DAA were treated with either 1mM ATP or with alkaline phosphatase (APase) (25unitml) and incubated for 1hr at room temperature The activity was
compared with the untreated controls on native affinity zymograms (01 glycogen) in the synthetic reaction The activities of amyloplast lysates soluble
protein fractions of kernel crude extract and leaf crude extract (90 μg of proteins were loaded in a well) on zymograms are shown in A1 B1 and C1 respectively with their respective immunoblots A2 B2 and C2 which are probed
with peptide specific anti-Pho1 antibodies APase was used as a negative control
Control ATP APaseAPase
only Control ATP APaseAPase
only
A1 A2
B1 B2
C1 C2
Pho1
Pho2
Pho1
Pho1Pho2
Control ATP APaseAPase
only Control ATP APaseAPase
only
A1 A2
B1 B2
C1 C2
Pho1
Pho2
Pho1
Pho1Pho2
74
Figure 28 Mobility shift detection of phosphorylated proteins by Phosphate affinity SDS-PAGE using Phos-TagTM
Amyloplast lysates (22 DAA) treated with either 1 mM ATP APase (25unitml) or ATP+ PI (phosphatase inhibitor) 30 μg of proteins were loaded in each well
The gel was immunoblot following electrophoresis and probed with peptide-specific anti-SP antibodies and the mobility of the bands was compared with the untreated amyloplast lysates
234 Gel filtration chromatography (GPC) analysis of SP
Maize amyloplasts lysates (at 22 DAA) treated with ATP or APase (500
μgmL of proteins in each) were eluted through a Superdex 200 10300GL gel
permeation column to determine whether ATP or APase treatment influenced the
multimeric state of SP Fractions collected were run on the SDS-PAGE and the
elution pattern of the major starch biosynthetic enzymes were analyzed on the
immunoblots using peptide specific anti-SP SSI SSII SSIV SBEI and SBEIIB
antibodies (Fig 210BCDE) The elution patterns of SP at early (15 DAA) and
75
late developmental stages (35 DAA) in whole cell crude extracts of the maize
endosperm are shown in Fig 210A The gel permeation column was connected
to an AKTA Explorer FPLC was calibrated using commercial protein standards
from 137 kDa to 440 kDa and the calibration curve developed to estimate the
molecular weights of the proteins eluted by GPC is shown in Fig 29
Both in early and later stages of endosperm development SP eluted in
fractions (fraction 21-23) where the molecular weight corresponds to the
tetrameric form of SP (448 kDa) Dimeric forms were not visualized Amyloplast
lysates at 22 DAA the elution profile of SP was equal in untreated control
(fractions from 7-12) where as the ATP treated and APase treated fractions were
respectively from 8-13 and 6-12 (Fig 210B) The estimated molecular weights
of the eluted SP fractions showed the existence of monomeric (112 kDa)
dimeric (112 kDa X 2) and tetrameric forms (112 kDa X 4) of SP The elution
profile of SSI SSIV SBEI and SBEIIb were identical regardless of ATP or APase
treatments In contrast ATP-treated SSII eluted comparatively in low molecular
fractions (6-10) compared to APase treated fraction profile (fraction 4-8) (Fig
210C) Reprecentative graph of the elution from GPC is shown in Appendix 10
GPC-fractionated amyloplast lysates (22 DAA) were run on native affinity
zymograms The results indicated that ATP-treated SP eluted in fraction number
25-26 showed SP activity where as untreated or APase treated fractions
showed SP synthetic activity in fraction number 23-24 Approximate molecular
weights of these fractions were investigated as fraction 23-24 are tetrameric
and 25-26 fractions were dimeric forms of SP (Fig 211)
76
Figure 29 The standard curve developed to analyze the molecular weights of
the proteins eluted by GPC Superdex 200 10300GL gel permeation column was calibrated using commercial protein standards from 137 kDa to 440 kDa The
graph shows the relationship between natural log values of the molecular weight of the commercial proteins versus fraction numbers
0
1
2
3
4
5
6
7
8
9
0 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30
Fraction Number
Lo
gM
W
77
Figure 210A Gell filtration chromatography (GPC) analysis of maize whole cell
crude extracts at 15 DAA and 35 DAA 045 mg of proteins were separated by GPC through a Superdex 200 10300GL gel permeation column Elution of SP was detected by immunoblot are shown The size of the proteins in each fraction
was determined by calibrating the column using commercial protein standards from 137 kDa to 669 kDa and the sizes of the standards are also indicated L=
protein marker AP=amyloplast lysates C=crude extracts before loading onto the column
(A)
78
Figure 210B Gel filtration chromatography (GPC) analysis of amyloplast
lysates Maize amyloplast lysates at 22 DAA were treated with 1mM ATP or alkaline phosphatase (APase) (25unitmL) to the extracts and incubated for 1hr in room temperature 049 mg of protein was separated through a Superdex 200
10300GL gel permeation column In total 45 (500μL each) fractions were collected from each running for the analysis in total only the fractions where
the protein was detected by immunoblot analysis are shown The SP bands were shown by the arrows The size of the proteins in each fraction was determined by calibrating the column using commercial protein standards from 137 kDa to
669 kDa and the sizes of the standards are also indicated L= protein marker AP=amyloplast lysates C=crude extracts before loading onto the column
Arrows indicate the locations of the corresponding proteins
(B)
79
Figure 210C Gel filtration chromatography (GPC) separation of amyloplast stromal proteins Immunoblots probed with anti-SSI (74 kDa) and anti-SSIIa (85 kDa) antibodies of untreated ATP- or APase-treated maize amyloplast
lysates separated by GPC through a Superdex 200 10300GL gel permeation column The protein bands were shown by the arrows The size of the proteins in
each fraction was determined by calibrating the column by commercial protein standards from 137 kDa to 669 kDa and the sizes of the standards are also indicated L= protein marker AP=amyloplast lysates before loading onto the
column
(C)
80
Figure 210D Gel filtration chromatography (GPC) separation of amyloplast
stromal proteins Immunoblots probed with anti-SSIV (104 kDa) and anti-SBEI (80 kDa) antibodies of untreated ATP- or APase-treated maize amyloplast
lysates separated by GPC through a Superdex 200 10300GL gel permeation column The protein bands were shown by the arrows The size of the proteins in each fraction was determined by calibrating the column by commercial protein
standards from 137 kDa to 669 kDa and the sizes of the standards are also indicated L= protein marker AP=amyloplast lysates before loading onto the
column Arrows indicate the location of the corresponding proteins
(D)
81
Figure 210E Gel filtration chromatography (GPC) analysis of amyloplast lysates Immunoblots probed with anti-SBEIIb (85 kDa) antibodies of untreated
ATP- or APase-treated maize amyloplast lysates separated by GPC through a Superdex 200 10300GL gel permeation column The protein bands were shown by the arrows The size of the proteins in each fraction was determined by
calibrating the column by commercial protein standards from 137 kDa to 440 kDa and the sizes of the standards are also indicated L= protein marker
AP=amyloplast lysates before loading onto the column Arrows indicate the locations of the protein
(E)
82
Figure 211 Native affinity synthetic activity SP zymogram of the amyloplast lysates separated by GPC Untreated ATP- or APase-treated GPC fractions (10
μg of proteins) were run on native gels containing 01 glycogen Arrows indicate the synthetic activity bands
235 The synthetic and phosphorolytic activities of SP with different
glucan substrates
The glucan synthetic activity of ATP- or APase-treated SP was
quantitatively measured using maltoheptaose glycogen and amylopectin as
glucan primers at 25 mgmL concentration Amyloplast lysates were used as the
SP source and [U14_C]-G-1-P as the glucan donor (Table 25) The means of
enzyme activities were statistically compared using the One-Way ANOVA (at
Plt005 level F=8274 P=000028) (See Appendix 08 for the statistical
analysis of ANOVA by Statistix 9 statistical analysis program) The results
indicated that synthetic activities of SP were not significantly different in three
different glucans in SP present in untreated amyloplast lysates at 25 mgmL of
substrate concentration The synthetic activity was significantly higher with
amylopectin (1433152 nmolmgmin) compared to maltoheptaose
20 21 22 23 24 25 26 27 28 29 20 21 22 23 24 25 26 27 28 29
Untreated Control ATP Treated APase Treated
20 21 22 23 24 25 26 27 28 29
Fraction NumbersFraction NumbersFraction Numbers20 21 22 23 24 25 26 27 28 29 20 21 22 23 24 25 26 27 28 29
Untreated Control ATP Treated APase Treated
20 21 22 23 24 25 26 27 28 29
Fraction NumbersFraction NumbersFraction Numbers
83
(6000456 nmolmgmin) when amyloplast lysates were treated with ATP
There was no significant difference in the synthetic activity between
maltoheptaose and glycogen within untreated or ATP-treated amyloplasts SP
activities were decreased in all substrates in APase-treated amyloplast lysates
compared to both untreated and ATP-treated samples In addition synthetic
activity was significantly decreased when treated with APase with amylopectin
and glycogen compared to ATP-treated SP The synthetic activity was not
significantly decreased in ATP or APase-treated SP when maltoheptaose was
used as the glucan primer (Table 25)
Phosphatase inhibitor cocktail (PI) was added to inhibit the activity of
endogenous phosphatase present in the amyloplast (see Appendix 09 for the
details about PI) However ATP+PI treated SP recorded lower activity compared
to ATP treated SP in all three substrates The APase used was bound to agarose
beads (insoluble APase) and it was removed after amyloplast lysates were
treated for 1 hour to prevent under estimation of the enzyme activity due to
continuous dephosphorylation of substrates in the assays In general plastidial
SP had greater activities in synthetic direction over phosphorolytic direction
despite ATP or APase treatments or in high or low molecular glucan polymers at
25 mgmL concentration SP phosphorolytic activity was not significantly altered
within untreated ATP-treated or APase-treated samples when maltoheptaose
was used as the glucan primer (Table 25) Phosphorolytic activities of untreated
and ATP-treated SP were significantly different from APase-treated SP with
amylopectin (Table 25) (see Appendix 08 for the statistical analysis on One-way
ANOVA F= 3557 P= 00004)
84
The enzyme followed typical saturation kinetics toward amylopectin and
maltoheptaose when activity was measured in the phosphorolytic direction The
kinetic data were analyzed using the MichaelisndashMenten equation The Km and
Vmax values of SP in the phosphorolytic direction were analyzed at a range of
(5-25 mgmL) maltoheptaose and amylopectin concentrations using
LineweaverndashBurk plots (Table 26) SP had a higher Km value with
maltoheptaose compared to amylopectin in untreated or ATP-treated or APase
treated samples Km values increased with both maltoheptaose and amylopectin
with ATP treatment and decreased with APase treatment compared with the
untreated sample values The Vmax was increased in both substrates following
ATP treatment compared to the untreated samples by 13 and 12 times in
amylopectin and maltoheptaose respectively (Table 26)
Table 25 Synthetic and phosphorolytic activities of SP in different glucan substrates Both activities were calculated as nmolmgmin Significantly different means (at Plt005) from the One-way ANOVA followed by LSD are
indicated by identical symbols for synthetic and phosphorolytic activities
Substrate
Pre-treatment
Untreated ATP ATP+PI PI APase
Synthetic
Activity
Maltoheptaose
Amylopectin
Glycogen
69060
99453
100526
60056
143352Dagger
114410dagger
60250
90450
73312
59156
75874
74208
27238
32845Dagger
37420dagger
Phosphorolytic
Activity
Maltoheptaose
Amylopectin
24615
46913
27014
58840
- -
- -
16634
33418
85
Table 26 Km and Vmax values of SP in amyloplast lysates in the phosphorolytic direction The phosphorolytic activity of SP was assayed by spectrophotometry
and amount of NADH released was analyzed at 340nm as the amount of G-1-P produced in the reaction Amylopectin and maltoheptaose concentrations at 5-
25 mgmL were considered in the calculations Km and Vmax values were calculated using LineweaverndashBurk plots
Glucan Substrate
Treatment
Km (mgmL)
Vmax
(nmolmgmin)
Amylopectin
Untreated
ATP
APase
18plusmn002
31plusmn001
13plusmn005
483plusmn02
654plusmn006
337plusmn02
Maltoheptaose
Untreated
ATP
APase
33plusmn002
67plusmn0001
23plusmn0001
279plusmn001
339plusmn0003
176plusmn002
236 Immunoprecipitation of SP
The immunoprecipitation of SP from the amyloplast lysates was
attempted using peptide specific anti-SP antibodies Native SP protein was not
immunoprecipitated by protein A-Sepharose beads (Fig 212) therefore co-
immunoprecipitation was not possible SP was not immunoprecipitated by anti-
SP antibodies bound to Protein A-sepharose beads after removing the SSIIa
present in amyloplast lysates indicated that SSIIa is not cover up antibodies
binding epitopes of SP (Appendix 02) Recombinant maize SP with a S-tag was
produced by over expressing the protein in Ecoli The biochemical and
proteomic characterization and protein-protein interaction studies using the
recombinant SP is discussed in Chapter 3
86
Figure 212 Immunoprecipitation of SP by peptide specific anti-SP antibodies
(30 mgmL) with 1 mL amyloplast lysates 40 μL of 50 (wv) Protein A-Sepharose beads slurry made in phosphate buffer saline (PBS) was used to pull down the Protein A-Sepharose-antibody-proteins complex The
immunoprecipitated pellet was boiled in 2X SDS loading buffer and separated on SDS-PAGE followed by immunoblot analysis Pre-immune serum was used as a
control to show the specificity of the purified antibodies Figure illustrates the immunoblot probed with SP-specific antibodies The arrows denote the SP band L= protein marker
87
24 Discussion
241 Subcellular localization of SP in maize endosperm
The overall objective of the study was to elucidate the role and regulation
of plastidial starch phosphorylase (SP) and to investigate the possible post
translational modifications of SP in wild-type maize endosperm The subcellular
localization of SP was tested at 22 DAA which corresponds with the maximal
period of starch synthesis in maize endosperm (9-24 DAA) (Yu et al 2001 Tsai
and Nelson 1968) and the time when all the major starch biosynthetic enzymes
are expressed and active in amyloplasts (Liu et al 2009 Hennen-Bierwagen et
al 2008) The peptide specific anti-SP antibodies recognized the plastidial SP
only in the storage starch synthesizing amyloplasts and not in the transient
starch synthesizing chloroplasts (Fig 22B) The plastidial form of SP in
chloroplasts may be structurally different from the SP in the amyloplasts within
the same species Degradation of the proteins in crude extracts may be a
possible reason for SP not being detected effectively by antibodies Mutant
analysis suggested that the plastidial SP present in Arabidopsis thaliana leaves is
not involved in transient starch biosynthesis or degradation (Zeeman et al
2004) The SP mutants of Arabidopsis showed no change in the activity of other
enzymes of starch metabolism or show any significant change in the total
accumulation of starch or the starch structure during the day or its
remobilization at night (Zeeman et al 2004) Also leaves contain the cytosolic
form of SP (Pho2) abundantly compared to the plastidial SP (Satoh et al 2008)
which was not detected in leaf crude extracts with the antibodies
88
The results presented here confirmed the previous findings that the Pho1
is exclusively found in the amyloplast stroma (Satoh et al 2008 Grimaud et al
2008 Yu et al 2001) in the maize amyloplast (Fig 22) The existence of the SP
and other SSs and SBE in the interface of the soluble fraction and the granule
as the granule surface imbedded protein suggests their involvement in granule
synthesis The soluble protein fractions collected after the repeated washings of
the granules with the amyloplast rupturing buffer and tested on immunoblots
indicated that some of the major starch biosynthetic enzymes are present at the
granule surface (Fig 23) SP was present up to the fifth wash indicating the
tight association with the surface of the starch granule Similarly SSI and
SBEIIb (wash 1 to 3) and SBEI (wash 1 to 4) were also associated with the
granule periphery In contrast SSII was found clearly from wash 1 to 7 (Fig
22B) which is comparatively abundant in the granule surface By contrast SSIV
and the SSIII were found only in the first extract of the amyloplast and may be
regulated as purely soluble SSIV and SSIII are either not present in the granule
surface or present at the extremely low levels in the granule surface In the
wild-type maize amyloplast stroma it has been demonstrated that the protein
present in the assembly of heteromeric protein complexes (SSI SSII and
SBEIIb) are also entrapped in the starch granule (Liu et al 2009) However the
SP is regulated by protein complex formation with SBEI and SBEIIb in wheat
amyloplasts (Tetlow et al 2004) but the components of this protein complex do
not appear to become entrapped in the starch granule SP was only found as a
granule-associated protein in the ae- background when it was found to be
associated with SSI and SSIIa (Liu et al 2009 Grimaud et al 2008)
89
We were unable to conduct standard immuno-precipitation experiments
using the anti-maize SP antibodies since they did not appear to recognize the
native protein and could only detect the protein after SDS-PAGE (Fig 212) The
reason for this is unclear but the epitope (SVASDRDVQGPVS located at 73-85
amino acids in N-terminal) present on the SP monomer may well be hidden
when the native SP adopts is natural multimeric (dimeric and tetrameric)
configuration
As Tickle et al 2009 proposed SP may contribute to starch synthesis by
operating in two ways in the cereal endosperm First it has been suggested that
SP may degrade soluble malto-oligosaccharides in the stroma produced via the
action of DBE to G-1-P and then to ADP-glucose by ADP-glucose
pyrophosphorylase to produce starch Second SP may directly act at the surface
of the starch granule where it functions to phosphorolytically modify the
structure of starch to provide suitable substrates for other starch biosynthetic
enzymes ultimately producing G-1-P which can be recycled back to produce
starch Both of the models suggested the effect of SP on starch synthesis by
providing G-1-P via the degradative process to produce ADP-glucose by AGPase
enzyme Data in this thesis support a role of SP operating at the granule surface
as SP localization experiments clearly show SP associated with starch granule
(Fig 23 24) Analyses of metabolites in the amyloplast also indicate high PiG-
1-P levels which could suggest that the phosphorolytic SP reaction is favored in
vitro (Fettke et al 2010 Schupp and Ziegler 2004) In contrast previous
studies suggested that SP exists in the storage starch biosynthetic tissues and
operates in the synthetic reaction in monocots where it is available throughout
90
the endosperm development (Schupp and Ziegler 2004 Satoh et al 2008 Yu
et al 2001) Recently Hwang et al (2010) showed that the SP reaction in rice
endosperm amyloplasts is predominantly synthetic even in the presence of high
Pi levels
242 The synthetic activity of plastidial SP in developing maize
endosperm
The synthetic activity of SP in the amyloplast lysates was tested by SP-
native zymogram analysis using glycogen as a substrate SP was active
throughout the endosperm development at stages measured (12 15 19 and 22
DAA) (Fig 25) The activity of SP is being found as early as 9 DAA in the maize
endosperm and remains active throughout the endosperm development (Yu et
al 2001) In the 22 DAA amyloplast lysates SP showed activity in both
synthetic and degradative directions when tested on native affinity zymograms
which were respectively incubated with G-1-P and Pi (Fig 26) Accumulation of
Pho1 was detected throughout the endosperm development in maize was
similarly observed in wheat endosperm during 8-31 DAA and Pho1 was
undetectable until 8 DAA and reached to the maximum level at 18 DAA and
remained constant (Tickle et al 2009) The presence of Pho1 in cereal
endosperm correlates with the presence of other starch biosynthetic enzymes
SBEI SBEII AGPase and SSs (Liu et al 2009 Tetlow et al 2003 Morell et al
1997 Ainsworth et al 1995) suggesting that Pho1 may be involved in starch
biosynthesis or be involved in functional interaction with other starch
biosynthetic enzymes
91
243 Investigating the regulation of SP by protein phosphorylation
SP in cereal endosperms has been found to be regulated by protein
phosphorylation (Liu et al 2009 Pollack 2009 Tetlow et al 2004) However
the activities of the ATP-treated and APase-treated isoforms of SP on 01
glycogen zymograms showed no detectable differences in the activities between
treatments (Fig 27) The glycogen affinity SP-native zymogram may not be
sensitive enough to detect subtle alterations in catalytic activity associated with
phosphorylation
The mobility shift detection of proteins on phosphate affinity SDS-PAGE
using Acrylamide-pendant Phos-TagTM (10 μΜmL) (Fig 28) showed no
difference in mobility in ATP-treated or untreated SP suggesting SP is not
phosphorylated However the Pi present in the amyloplast lysates may have
affected the activity of SP
244 Gel filtration chromatography analysis of SP
Phosphorylases exist as homodimers or homotetramers and have similar
kinetic and structural properties but their regulatory mechanisms may vary
depending on the source of the enzyme in higher plants (Brisson et al 1989) in
bacterial forms (Dauvilleacutee et al 2006) and yeast (Tanabe et al 1987) Gel
filtration chromatography studies revealed that the native enzyme consisted of
two identical subunits in maize (Mu et al 2001) In the present study the SP
was found in multimeric tetrameric and dimeric forms in both early (15 DAA)
and late (35 DAA) developmental stages (Fig 210 A) in endosperm crude
extracts and at 22 DAA in maize wild-type amyloplast lysates (Fig 210B)
92
which has been observed previously (Liu et al 2009) Seed crude extracts of 15
DAA and 35 DAA had showed similar elution profiles for SP from 21-23 fractions
and amyloplast lysates at 22 DAA had wider elution profiles (from fraction 21 to
26) that may be due to less dimeric form of SP in crude extracts In addition
monomeric dimeric and tetrameric forms of SP separated by GPC were tested
for the synthetic activity by native SP zymogram (Fig 211) Synthetic activity
of ATP-treated SP showed an apparent molecular weight approximately similar
to the dimeric form (fraction 25-26) untreated and APase-treated SP showed
activity in (fraction 22-23) the fractions corresponding to a molecular weight
equal to a tetrameric form suggested that the dimeric forms were more active
compared to the tetrameric forms when the amyloplast lysates were treated
with ATP (Fig 211)
Phosphorylation may effect the multimeric status of SP However no
detectable difference in the elution profiles of phosphorylated and
dephosphorylated amyloplast lysates was observed (Fig 210B) The SP involved
in heteromeric protein complex formation with SSI and SSIIa recorded in the
ae1 mutant showed the same elution profile as in wild-type (Liu et al 2009)
suggesting that the observed elution profile of SP may be made up of a variety
of different SP-containing protein complexes as well as SP monomers
Immunoblot analysis of the GPC fractions illustrated that SSIV (104 kDa)
and SBEI (80 kDa) SBEIIb (85 kDa) showed no difference in their elution
profiles following ATP or APase treatment However SBEI and ATP-treated
SBEIIb eluted in two different molecular groups high apparent mass (greater
than the expected size of monomer) low apparent mass consistent with the
93
expected monomeric mass The results of SBEIIb elution can be explained by
the phosphorylation dependent SBEIIb complex formation previously observed
in maize and wheat amyloplasts (Liu et al 2009 Tetlow et al 2008) In
contrast there is no evidence for the existence of homo dimeric or multimeric
forms of SBEI in wild-type maize amyloplasts The higher molecular mass
fractions of SBEI are therefore probably due to the formation of heteromeric
protein complexes containing SBEI We observed no alteration of SSIV elution
following ATP or APase treatment (Fig210D) In ATP treated lysates SSI eluted
comparatively higher apparent molecular mass fractions (6-13) than in the
untreated and dephosphorylated treatments (Fig 210B) as previously observed
in Liu et al (2009) In wild-type maize amyloplast stroma SSI SSIIa and
SBEIIb form a phosphorylation-dependent heteromeric protein complex (Liu et
al 2009) By contrast SSIIa eluted in higher molecular fractions when the
enzyme was dephosphorylated (Fig 28B Table 21) suggesting that the
dephosphorylated SSIIa may form proteinndashprotein interactions or complex
formation in wild-type maize amyloplasts This suggestion is further supported
by Liu et al (2009) that the [γ-32P]ATP treated ae1 mutant and wild-type
amyloplast lysates immunoprecipitated with anti-maize SSIIa antibodies showed
that SBEIIb in wild-type and SBEI and SP in ae1 mutant were phosphorylated
but no evidence for phosphorylation of SSII in the complex
The effect of phosphorylation on the monomeric dimeric and tetrameric
forms of SP and their involvement of protein-protein interactions are discussed
in Chapter 3 using a catalytically active recombinant maize SP containing an S-
protein affinity tag
94
245 The synthetic and phosphorylitic activity of SP in different glucan
substrates
Glucan synthetic activity was significantly less with maltoheptaose
cpmpared with amylopectin and glycogen in untreated ATP or APase-treated SP
(Table 23) and the synthetic activity was significantly higher following ATP
treatment with amylopectin and glycogen compared to maltoheptaose indicating
that the activity of plastidial SP was greater with high molecular mass branched
glucans This was similarly observed in recombinant plastidial SP in rice the
ratio between the activities of synthetic and dedradative reaction rate
(equilibrium constant) was higher in amylopectin (45) compared to
maltopentaose (G5) maltohexaose (G6) maltoheptaose (G7) and amylose
respectively as 22 19 15 and 17 (Hwang et al 2010) Synthetic activity of SP
was inhibited by Pi produced in the reaction [inhibition constant (Ki) = 069 mM]
when amylopectin was used as the primer substrate but this inhibition is less
(Ki = 142 mM) when short α-glucan chains are used as primers and also
extends them to synthesize longer MOSs (DP= 4ndash19) (Hwang et al 2010) This
observation suggested that under physiological conditions of high PiG-1-P Pho1
extends the chain length of short MOSs which can then be used as subsequent
primer by starch synthase activities (Hwang et al 2010)
Phosphatase inhibitor cocktail (PI) was added to inhibit the activity of
endogenous protein phosphatases But its addition did not increase the synthetic
activity compared with ATP-treated samples with glycogen and amylopectin
suggesting that some compound in PI cocktail mixture may have inhibited the
activity of SP
95
The activity of SP in ATP and APase-treated amyloplast lysates in
phosphorolytic direction was greater in amylopectin in untreated ATP or APase-
treated SP compared to maltoheptaose (Table 25) In contrast Km was greater
in maltoheptaose over amylopectin in ATP-treated SP (Table 26) Similarly the
kinetics analysis of purified SP from maize endosperm recorded that the
phosphorylitic reaction was favored over the synthetic reaction when malto-
oligosaccharides were used as the substrate (Mu et al 2001) The Vmax and Km
values recorded in this study were approximately 7 and 58 times lower than
with purified SP respectively (Mu et al 2001) Unlike in the purified form of SP
the activity of SP present in amyloplast lysates may be regulated by other
enzymes [eg SBEs (Nakamura et al 2012)] and other metabolites For
instance G-1-P and Pi present in amyloplast lysates and high PiG-1-P ratios are
considered as the controlling mechanism of SP activity (Tiessen et al 2011 Mu
et al 2001 Fettke et al 2009 Schupp and Ziegler 2004) However according
to the findings of Hwang et al (2010) incorporation of [U14_C]-G-1-P into starch
was only partially affected by the concentration of Pi in rice Even under
physiological G-1-P substrate levels (02 mM) and 50-fold excess of Pi in vitro
than the normal physiological level the Pho1 from of rice was able to carry out
the biosynthetic reaction (Hwang et al 2010) ADP-glucose the major precursor
for starch biosynthesis inhibits the activity of SP in the synthetic direction
(Dauvilleacutee et al 2006 Matheson and Richardson 1978) and may reduce the
activity of plastidial SP in amyloplast lysates The effect of ADP-glucose on
plastidial SP in maize was not tested in this study
96
The preference of SP for different α-glucans has been studied in many
plant species (Young et al 2006 Dauvilleacutee et al 2006 Yu et al 2001 Mori et
al 1993 Shimomura et al 1982 Liddle et al 1961) In contrast to maize SP in
sweet potato tubers plastidial SP showed a low binding affinity toward starch
and a high affinity toward low molecular weight linear malto-oligosaccharides
(MOS) (Young et al 2006) In contrast the cytosolic isoform has a high affinity
towards highly branched polyglucan amylopectin (Young et al 2006) The
synthetic activity of SP with amylopectin (Km =013 mgmL) is higher when
compared to the highly branched glycogen (Km=045 mgmL) in maize (Yu et
al 2001) in potato tubers (Liddle et al 1961) and in spinach leaves
(Shimomura et al 1982) In sweet potato tubers the L-78 amino acid peptide
insertion located in the middle of the plastidial form of SP appears to block the
binding site of SP to high molecular weight α-glucans (Young et al 2006) We
found no evidence for the proteolytic cleavage of the L-78 peptide in maize
endosperm amyloplasts
In this chapter experiments were carried out to investigate the regulatory
properties of SP in maize amyloplasts Plastidial SP is present only in the
amyloplast stroma and is not found as a granule associated protein which is in
agreement with previous studies (Grimaud et al 2008) SP remains active
throughout the endosperm development and it is present in homodimeric or
tetrameric configurations throughout the developmental stages analyzed in this
study This study suggested that the tetrameric and dimeric forms have different
catalytic activities and may be involved in starch biosynthesis by differential
regulation The SP elution profile by GPC was not altered by ATP or APase
97
treatments suggesting phosphorylation may not alter the multimeric status of
SP The synthetic and phosphorylitic activity assays showed that SP was active
in both directions However SP showed greater activities with amylopectin
compared to glycogen and maltoheptaose in both synthetic and phosphorylitic
directions ATP treated SP showed higher activities in both directions with
amylopectin indicating that ATP may be involved in regulating SP by
phosphorylation Protein-protein interactions with the plastidial enzyme could
not be detected by co-immunoprecipitation since the native SP was unable to
be immunoprecipitated by Protein-A sepharose beads The development of a S-
tagged recombinant SP was used in future experiments to analyze protein-
protein interactions involving SP these experiments are described in Chapter 3
98
CHAPTER 3
99
Using recombinant plastidial SP to understand the regulation of starch
biosynthesis
31 Introduction
Glucan-phosphorylases are widely distributed enzymes in bacteria plant
and animal tissues (Dauvilleacutee et al 2006 Weinhaumlusel et al 1996 Newgard et
al 1989 Tanabe et al 1987 Preiss 1984) SP catalyzes both synthesis and
degradation of the α-glucan polymers The structure and the function of these
enzymes are best understood for glycogen phosphorylases the SP counterpart
of animals and bacteria (Dauvilleacutee et al 2006 Weinhaumlusel et al 1996 Newgard
et al 1989) Glycogen phosphorylase (GP) plays an important role by initiating
the degradation of glycogen in glycogen metabolism (Dauvilleacutee et al 2006
Roach 2002 Fischer et al 1971) Predominantly the physiological function of
SP was considered phosphorolytic rather than to synthesize glucan polymers is
based on the observations in glycogen phosphorylase in animal system and that
SP has a low affinity for G-1-P (Schupp and Ziegler 2004) Preiss and Sivak
1996)
SP has been shown to be regulated by protein phosphorylation in plants
(Pollack 2009 Grimaud et al 2008 Tetlow et al 2004) GP in animal systems
is found to be coordinated with the activity of glycogen synthase GP is required
to be phosphorylated in order to activate the glycogen synthases (Carabaza et
al 1992 Johnson 1992 Madsen 1991) to regulate glycogen synthesis and
breakdown Structural changes of GP occur at the interface of the subunits as a
result of conformational transition at the amino terminus by protein
100
phosphorylation residues surrounding the phosphorylation site (serine-14) that
participate in intrasubunit interactions in the dephopsphorylated state are
observed to adapt alternate side-chain conformations in the phosphorylated
state enabaling them to form intersubunit interactions to form homodimeric
structure of GP (Sprang et al 1988)
SP present in storage starch synthesizing tissues in plants is suggested to
be involved in starch synthesis since SP is active throughout endosperm
development in cereals (Tickle et al 2009 Satoh et al 2008 Schupp and
Ziegler 2004 Mu et al 2001) Also the shrunken 4 mutants which lack SP
activity in maize endosperm resulted in reduced starch contents (Tsai and
Nelson 1969) and SP mutants in rice produced shrunken endosperm
phenotypes with low starch contents (Satoh et al 2008) Further SP does not
appear to influence the starch degradation in Arabidopsis thaliana (Zeeman et
al 2004) suggesting SP plays a more dominant role in the storage starch
biosynthesis In addition the SP-L isoform (plastidial form of SP which has lower
affinity towards the high molecular starch) in potato tubers and the chimeric
form of SP-L enzyme which was developed by replacing the 18 residue
sequence of the SP-L isoform including a part of 78-residue insertion were over
expressed in Ecoli and the affinities of purified forms of recombinant proteins
were compared by Mori et al (1993) The purified chimeric phosphorylase was
five times less active in synthetic direction than the parental type SP-L isoform
However the affinity of the chimeric phosphorylase for glycogen (Km= 238
mgmL) and amylopectin (Km=53 mgmL) was much higher than that of the
type SP-L isoform (Km=10400 Km=82 mgmL mgmL respectively in glycogen
101
and amylopectin) and only slightly lower than that of the cytosolic SP-H the
high affinity isoform These results provide evidence for the role of the unique
78-residue insertion present in plant plastidial SP sequences which lowers the
affinity of the enzyme for large branched substrates (Mori et al 1993)
A possible function of SP in starch biosynthesis is that SP acts on malto
oligosaccharide (MOS) which are liberated by the activity of debranching
enzymes (DBE) to produce linear maltodextrin (MD) of a length sufficient for a
subsequent branching reaction by starch branching enzymes (SBE) (Nakamura
et al 2012 Ball and Morell 2003) In addition functional interactions between
SP and SBE isoforms were observed in rice endosperm strongly suggesting that
SP and SBE have mutual capacities for chain elongation and chain branching
(Nakamura et al 2012) Purified SP from rice endosperm synthesized glucans
from G-1-P in the presence of SBE without any exogenous glucan primer and
glucan production was higher with SBEI compared to SBEIIa or SBEIIb
(Nakamura et al 2012) Physical interaction between SP SBEI and SBEIIb was
also recorded in wheat amyloplasts and this protein complex was assembled in a
phosphorylation dependent manner (Tetlow et al 2004) Based on the
observations in ss4 and ss4sp mutants in Arabidopsis leaves which produce
reduced numbers of starch granules with increased granule surface (Roland et
al 2008 Planchot et al 2008) it has been suggested that SP may be involved
in granule initiation in starch biosynthesis process via functional or physical
interactions between SP and SSIV (Roland et al 2008 Planchot et al 2008)
Investigating possible interactions of SP with other starch biosynthetic enzyme
102
isoforms is therefore important to elucidate the role and regulation of SP in
storage starch biosynthesis in maize amyloplasts
All phosphorylases exist as dimers or tetramers of identical subunits
(Dauvilleacutee et al 2006 Mu et al 2001 Brisson et al 1989 Sprang et al 1988
Tanabe et al 1987) In Chlamydomonas reinhardtii identical subunits of dimeric
form have similar kinetic and structural properties but their regulatory
mechanisms may vary (Dauvilleacutee et al 2006) In maize amyloplasts SP is
present as dimeric and tetrameric assembles (Mu et al 2001 Liu et al 2009)
However catalytic and regulatory mechanisms of these individual configurations
are not well characterized in higher plants
Previous work showed that available SP antibodies are not capable of
effectively immunoprecipitating native SP in protein-protein interaction
experiments We therefore decided to provide a recombinant maize SP for such
studies In this chapter we discuss the production of catalytically active S-
tagged SP recombinant proteins from wild-type maize endosperm and the
biochemical characterization of the recombinant SP and the investigations of the
possible interactions of SP with other starch biosynthetic enzymes GPC analysis
showed that the S-tagged recombinant SP is present in tetrameric and dimeric
forms which were also observed in the amyloplast lysates and these fractions
were found as valuable tools in understanding their diverse regulatory
mechanisms The synthetic and degradative activities of these different
recombinant SP configurations in different glucan polymers and their regulation
by protein-protein interactions are discussed
103
32 Materials and Methods
321 RNA extraction from maize endosperm and synthesis of cDNA
The RNA was extracted from maize endosperm at 22 DAA by using the QIAGEN
RNeasy Plant Mini Kit (Catalog No 74104) Approximately 100 mg of the frozen
maize endosperm was used in a sample First strand cDNA was synthesized from
RNA by using Fermentas RevertAidTM H Minus Strand cDNA Synthesis kit
(Catalog No K1631) following manufacturerrsquos recommendations with some
modifications The mixture of 5 μL RNA (100 μgmL) 1 μL Oligo DT primer (05
μg μL) 6 μL RNase free H2O was mixed and incubated at 700C for 5 min and
chilled on ice Then 4 μL 5X reaction buffer 1 μL RiboLock ribonuclease
inhibitor 2 μL 10 mM dNTPs were added to the mix and incubated 370C for 5
min 1 μL RevertAidTM H Minus M-MuLV-RT reverse transcriptase was added and
incubated further at 420C for 1hr After stopping the reaction by heating at 700C
for 10 min the complementary RNA was removed by RNase H (05 Μl 29 μL
reaction) and further incubated 370C for 20 min The cDNA was stored in -200C
322 Quantification of nucleic acid
The amount of RNA and DNA were measured in a NanoDrop 2000 (Thermo
Fisher Scientific) spectrophotometer at the wavelength of 260 nm the optical
density (OD) of 1 corresponds to a concentration of 50 μgmL for double-
stranded DNA and 38 μgmL for the RNA
104
323 Agarose gel electrophoresis
Agarose gel electrophoresis was carried out using standard procedures
commonly use Agarose was added to TAE buffer (004M TRIS-acetate 1 mM
EDTA pH 80) to make the final concentration of 08-1 (wv) and heated in a
microwave until completely dissolved The resulting solution was allowed to cool
for approximately 5 minutes before the addition of ethidium bromide to a final
concentration of 02 μgmL
and pouring into an appropriately sized horizontal
electrophoresis unit Upon setting the gel was overlaid with TAE buffer Samples
were subsequently mixed with 016 volumes loading buffer (30 glycerol [vv]
025 bromophenol blue [wv]) and loaded onto the gel Electrophoresis was
carried out at 80V for 1-15 hours Nucleic acids immobilized in agarose gels
were visualized on a gel documentation system
324 Designing oligo-nucleotide primers and RT-PCR
The complete mRNA sequence (3053 bp) of plastidial maize SP (GenBank
EU8576402) was taken from the National Center for Biotechnology Information
data base (NCBI) The transit peptide (TP) sequence was detected as 70 amino
acids by using ChloroP 11 sequence analytical server after analyzing the correct
protein frame in the GeneRunner program The coding sequence including a part
of TP sequence was isolated using the forward primer (SP-F1) 5rsquo
GCGGAGGTGGGGTTCTCCT 3rsquo and the reverse primer (SP-R1) 5rsquo
GCGAAAGAACCTGATATCCAC 3rsquo The PCR product was purified from the agarose
gel by using QIAquick Gel Extraction Kit (QIAGEN Cat No 28704) 50-100
ngmL-1
was used as the template in next PCR to obtain the complete mRNA
105
sequence of the plastidial SP The next PCR primers were specifically designed
for the CloneEZreg PCR Cloning Kit (GenScript Cat No L00339) with a 15 bp
overhang sequence from the vector system pET29a on both forward (SP-F2) and
reverse (SP-R2) primers as the forward (SP-F2)
5rsquoGGTTCCATGGCTGATTCAGCGCGCAGCG 3rsquo and the reverse (SP-R2)
5rsquoGAATTCGGATCCGATCTAGGGAAGGATGGC 3rsquo (15 bp overhangs are
underlined) All forward and reverse primers were used as 30 pmol μL final
concentration in a 50 μL of the PCR reaction contained final concentration of 50-
100 ngmL-1
of the DNA template with 10 μL DMSO 4 μL of 25 mM MgSO4 10 μL
of 2 mM dNTPs and 2 μL of KOD Hot Start DNA Polymerase (Novagen 200 U
Cat No 71086-3) The same PCR program was run with both sets of primers as
3 cycles of Loop 1 980C for 15 seconds 420C for 30 seconds and 680C for
35min followed by 35 cycles of Loop 2 980C for 15 seconds 600C for 30
seconds and 680C for 35min and the reaction was further extended at 680C for
10 min The PCR product was purified from the gel as described before to use in
the ligation The consensus and complementary cDNA sequences and the
primers designed are shown in Fig 31
106
Figure 31 Schematic diagram of the consensus and complementary strands
showing the forward and reverse primers use to isolate the complete cDNA sequence of the plastidial SP from maize The coding sequence including a part of TP sequence was isolated using the forward primer (SP-F1) 5rsquo
GCGGAGGTGGGGTTCTCCT 3rsquo and the reverse primer (SP-R1) 3rsquoCACCTATAGTCCAAGAAAGCG 5rsquo The PCR product was purified from the
agarose gel and used in next PCR with forward (SP-F2) 5rsquoGGTTCCATGGCTGATTCAGCGCGCAGCG 3rsquo and reverse (SP-R2) 3rsquoGAATTCGGATCCGATCTAGGGAAGGATGGC 5rsquo primers with a 15 bp overhang
sequence from the vector system pET29a on both primers
Forward Primers
2291bp 5rsquo GCCATCCTTCCCTAG ACCAGGTGGATATCAGGTTCTTT CGCC TATATTT C 3rsquo- 3039bp3rsquo CGGTAGGAAGGGATCTGGTCCACCTATAGTCCAAGAAAGCGGATATAAAG ndash 5rsquo
Consensus DNA sequence
Complementary DNA sequence
Reverse Primers
CACCTATAGTCCAAGAAAGCGSP-R1
GAATTCGGATCCGATCTAGGGAAGGATGGC
SP-R2-3005bp
-2291bp15bp overhang from
pET29a vector
3030bp--3010bp
121bp- 5rsquoGTGGCGGCGGAGGTGGGGTTCTCCTCGCTGGCGGTTCCGGAGGTGGGGTCGCGCCAGGTTGGGGTCGAGGGCGATTGCAGCGGCGGGTGTCAGCGCGCAGCGTGGCGA 5rsquo -230bp3rsquoCACCGCCGCC TCCACCCCAAGAGGAGCGACCGCCAAGGCCTCCACCCCAGCGCGGTCCAACCCCAGCTCCCGCTAACGTCGCCGCCCACAGTCGCGCGTCGCACCGCT 3rsquo
SP-F2SP-F1
GCGGAGGTGGGGTTCTCCT127bp- -145bp
GGTTCCATGGCTGATTCAGCGCGCAGCG
15bp overhang from
pET29a vector-221bp-209bp
Consensus DNA sequence
Complementary DNA sequence
Forward Primers
2291bp 5rsquo GCCATCCTTCCCTAG ACCAGGTGGATATCAGGTTCTTT CGCC TATATTT C 3rsquo- 3039bp3rsquo CGGTAGGAAGGGATCTGGTCCACCTATAGTCCAAGAAAGCGGATATAAAG ndash 5rsquo
Consensus DNA sequence
Complementary DNA sequence
Reverse Primers
CACCTATAGTCCAAGAAAGCGSP-R1
CACCTATAGTCCAAGAAAGCGSP-R1
GAATTCGGATCCGATCTAGGGAAGGATGGC
SP-R2-3005bp
-2291bp15bp overhang from
pET29a vector
3030bp--3010bp
121bp- 5rsquoGTGGCGGCGGAGGTGGGGTTCTCCTCGCTGGCGGTTCCGGAGGTGGGGTCGCGCCAGGTTGGGGTCGAGGGCGATTGCAGCGGCGGGTGTCAGCGCGCAGCGTGGCGA 5rsquo -230bp3rsquoCACCGCCGCC TCCACCCCAAGAGGAGCGACCGCCAAGGCCTCCACCCCAGCGCGGTCCAACCCCAGCTCCCGCTAACGTCGCCGCCCACAGTCGCGCGTCGCACCGCT 3rsquo
SP-F2SP-F1
GCGGAGGTGGGGTTCTCCT127bp- -145bp
SP-F1
GCGGAGGTGGGGTTCTCCTGCGGAGGTGGGGTTCTCCT127bp- -145bp
GGTTCCATGGCTGATTCAGCGCGCAGCG
15bp overhang from
pET29a vector-221bp-209bp
Consensus DNA sequence
Complementary DNA sequence
107
325 Ligation of complete SP cDNA sequence to the pET29a expression
vector and transformation to DH5α competent cells
The complete coding sequence of SP in the PCR product was confirmed by
gene sequence analysis (Appendix 01) The pET29a expression vector encoded a
15 amino acid S-tag (LysGluThrAlaAlaAlaLysPheGluArgGlnHisMetAspSer) at the
N-terminus with a thrombin digestion site (LeuValProArgGlySer) and a T7
promoter (TAATACGACTCACTAT) (Fig 32) 20 μL of ligation mixture was
prepared by adding 8 μL of purified PCR (300 ng μL) 8 μL of linearized vector
(100-200 ngμl) 2 μL 10X CloneEZreg buffer 2 μL CloneEZreg ligation enzyme in
the CloneEZreg PCR Cloning Kit (GenScript Cat No L00339) and incubated in
room temperature for 40 min and transferred to ice for 5 min Then 8 μL of
ligated mix was added to 50 μL of DH5α competent cells and the mix was kept
on ice for 30 min The transformation was done by a heat shock at 420C for 90
seconds with a quick transfer to ice for 5 min and 600 μL of SOC bacterial
growth media (super optimal broth with catabolic repressor 20 mM glucose)
was added to the transformed mix and incubated at 370C on a rotor for 1hr
Then the cells were plated on 10 mL solid LB media contained 10 μL of 50 mM
kanamycin after remove the excess media by centrifugation and incubated
overnight at 370C A single colony was grown in 6 mL of LB media contained 6
μL of 50 mM kanamycin overnight at 370C and the plasmid DNA was extracted
by using QIAprep Spin Miniprep Kit Successful insertion of the SP sequence was
identified after restricted enzyme digested plasmid DNA was run on an agarose
gel Then 2 μL of 100-150 ngmL of the plasmid DNA with the correct size of
the insert was used for transformation into the Arctic Express expression cells
108
described above The transformed cells were grown on a plate contained 10 mL
of solid LB media 10 μL of 50 mM of kanamycin and 10 μL of 100 mM of
gentamycin and incubated overnight at 370C
326 Expression of plastidial maize SP in Escherichia coli
An individual colony of the Arctic express Ecoli with the insert was grown
in 6 μL of liquid LB broth with 6 μL of 50 mM kanamycin and 6 μL of 100 mM of
gentamycin and incubated overnight at 370C on a shaker Then the cultures
were further grown in LB liquid media without the selection antibiotics and the
expression of the recombinant protein was induced by adding the final
concentration of 1 mM IPTG (isopropyl β-D-1-thiogalactopyranoside) when the
density of the culture was at 05-06 at OD600 The cultures were further kept
in 100C and shaken at 250 rpm for 16 hrs The E coli cells were collected by
centrifugation (at 13000xg at for 20 min) lysed using lsquoBugBusterrsquo Protein
Extraction Reagentrsquo (Novagen catalogue no 70584) and the soluble fraction
containing recombinant SP was collected The expression level of the protein
was tested by running on SDS-PAGE gel followed by Coomassie staining
(Appendix 05 shows the alignment comparison of the predicted amino acid
sequence of SP with the amino acid sequence of the recombinant SP produced in
the study)
109
327 Testing the synthetic and degradative activity of recombinant SP
using glycogen affinity native zymogram
The glycogen affinity zymogarm analyses were carried out by using
soluble recombinant protein of SP The zymogram gel preparations
electrophoresis and incubation were carried out as described in chapter 2
(22253) to test the synthetic and degradative activity
328 Gel filtration chromatography analysis of the recombinant SP
The soluble extract of recombinant SP (15 mg of total protein) was eluted
through a Superdex 200 10300GL gel permeation column pre-equilibrated with
two column volumes of rupturing buffer using an AKTA- FPLC system
(Amershamp Pharmacia Biotech model No 01068808) In total 30 (500 μL
each) fractions were collected The column was calibrated using commercial
protein standards from 137 kDa to 669 kDa (GE Healthcare Gel Filtration
Calibration Kits low molecular and high molecular weight) and the fractions
contained different multimeric forms of SP were identified using immunoblotting
329 Immobilization of recombinant SP on S-Protein Agarose beads
and pulldown assay
The S-tagged GPC fractions of tetrameric dimeric and monomeric forms
of SP were each immobilized to S-protein agarose beads (Novagen catalogue
no 69704) as described by Liu et al (2009) with some modifications 675 μg of
different recombinant SP GPC fractions were incubated in room temperature on
a rotator with 05 mgmL of amyloplast lysates pretreated earlier with 1mM ATP
110
or alkaline phosphatase (APase the insoluble form of suspension in (NH4)SO4 in
agarose beads final conc 25 units1ml) or untreated amyloplast lysates The
APase in beads were removed after incubation by centrifugation 250 μL of 50
(vv) S-protein agarose beads slurry prepared in buffer (20 mM Tris-HCl pH
75 150 mM NaCl 01 (vv) Triton X-100 01 (wv) Na azide) was added
and further incubated for 1 hour The controls were prepared by incubating the
ATP APase and untreated amyloplast lysates with S-agarose beads without the
recombinant GPC fractions The mixture was transferred onto a 10 mL Bio-Rad
Polyprep chromatography column (Bio-Rad catalogue no 731-1550) and
washed with 300 mL washing buffer [20 mM TRIS-HCl pH 75 150 mM NaCl
01 (vv) Triton X-100)] to remove non-specifically bound proteins from the
beads The controls were prepared by incubating the amyloplast lysates with the
same amount of S-agarose beads without the recombinant GPC fractions The
washed pellets of S-agarose protein bead complex was then transferred back
into a micro-centrifuge tube and centrifuged at 40C for 5 min at 500xg micro
centrifuge Following the removal of the supernatant the pellet was boiled in
100 μL of 20mM Tris-HCl pH 75 and 5X SDS-loading buffer (031M Tri-HCl pH
675 25 (vv) 2-mercaptoethanol 10 (wv) SDS 50 (vv) glycerol
0005 (wv) Bromophenol Blue) for 6 min at 950C The proteins in the samples
were analyzed by SDS-PAGE and immunoblotting with primary antibodies of anti
SSI -SSII SSIII SSIV SBEI SBEIIa SBEIIb SP and S-tag specific antibodies
111
Figure 32 Novagen pET29a vector used to overexpress plastidial SP The
expression vector contained a 15 amino acid S-tag on the N-terminus with a thrombin digestion site and a T7 promoter
3210 Starch phosphorylase glucan synthetic activity assay
The synthetic activity of the SP recombinant protein in amylopectin
glycogen and maltoheptaose substrates was analyzed in vitro by using the
tetrameric and dimeric forms of the enzyme obtained from the GPC analysis by
using the procedure described earlier in Chapter 2 section 222421 Total
protein content in a reaction was 1515 μg
3211 Starch phosphorylase glucan degradative activity assay
SP phospholytic activity was determined as previously described in Chapter 2
section 222422 by using dimeric and tetrameric forms of recombinant SP
112
3 3 Results
331 Comparison of the protein sequence of plastidial SP of maize
endosperm from the cytosolic form and other species
The protein sequences of the plastidial SP of maize endosperm (SP1
Gene Bank ACF946921) Ipomoea batatas tubers (GenBank AAA632711)
Oryza sativa endosperm (Japonica type GenBank BAG493281) Triticum
aestivum endosperm (GenBank ACC592011) Solanum tuberosum tuber
(GenBank CAA520361) and the cytosolic form of maize (SP2 Gene Bank
ACF946911) were aligned by using CLUSTAL 21 multiple sequence alignment
program (Fig 33) The transit peptide sequence (TP) of maize SP was analyzed
and predicted to be 70 amino acids in size using the ChloroP11 sequence
analytical server and is indicated in green (Fig 33) The L-80 insertion of
plastidial form of maize is located at 510-590 amino acids (highlighted in red)
The epitope sequence of the synthetic peptide used to develop anti SP specific
antibodies (YSYDELMGSLEGNEGYGRADYFLV) is located at 916-940 amino acids
in the C-terminus In addition the serine threonine and tyrosine residues of
predicted phosphorylation sites of plastidial SP were analyzed using NetPhos 20
Server The results indicated that 28 serine residues are present in the protein
sequence except the TP and 25 of the total serine residues are located in the
L-80 insertion Also 285 of the total threonine residues are present in the L-
80 insertion but none of the tyrosine residues are located in the insert (Fig 34)
113
CLUSTAL 21 multiple sequence alignment
sweetpotato -----------------MSRLSG---ITPRARDDRSQFQNPR--LEIAVPDRTAGLQRTK 38
potato -----------------MATANGAHLFNHYSSNSRFIHFTSRNTSSKLFLTKTSHFRRPK 43
SP1 LISPHASHRHSTARAAMATTTSPPLQLASASRPHAS--ASGGGGGGGVLLAGGSGGGVAP 58
rice -----------------MATASAPLQLATASRPLPVGVGCGGGGGGGLHVGGARGGGAAP 43
wheat -----------------MATASPP--LATAFRPLAA---AGGAGGGGAHAVGAAG-RVAP 37
SP2 ------------------------------------------------------------
sweetpotato --------RTLLVKCVLDETKQTIQHVVTEKN-----EGTLLDAASIASSIKYHAEFSPA 85
potato --------RCFHVNNTLSEK---IHHPITEQGGESDLSSFAPDAASITSSIKYHAEFTPV 92
SP1 GWGRGRLQRRVSARSVASDRD--VQGPVSPAE-GLPSVLNSIGSSAIASNIKHHAEFAPL 115
rice ------ARRRLAVRSVASDRG--VQGSVSPEE-EISSVLNSIDSSTIASNIKHHAEFTPV 94
wheat R----RGRRGFVVRSVASDRE--VRGPASTEE-ELSAVLTSIDSSAIASNIQHHADFTPL 90
SP2 ---------MPEIKCGAAEK---VKPAASPEA---------EKPADIAGNISYHAQYSPH 39
sweetpotato FSPERFELPKAYFATAQSVRDALIVNWNATYDYYEKLNMKQAYYLSMEFLQGRALLNAIG 145
potato FSPERFELPKAFFATAQSVRDSLLINWNATYDIYEKLNMKQAYYLSMEFLQGRALLNAIG 152
SP1 FSPDHFSPLKAYHATAKSVLDALLINWNATYDYYNKMNVKQAYYLSMEFLQGRALTNAIG 175
rice FSPEHFSPLKAYHATAKSVLDTLIMNWNATYDYYDRTNVKQAYYLSMEFLQGRALTNAVG 154
wheat FSPEHSSPLKAYHATAKSVFDSLIINWNATYDYYNKVNAKQAYYLSMEFLQGRALTNAIG 150
SP2 FSPFAFGPEQAFYATAESVRDHLIQRWNETYLHFHKTDPKQTYYLSMEYLQGRALTNAVG 99
sweetpotato NLELTGEYAEALNKLGHNLENVASKEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLR 205
potato NLELTGDFAEALKNLGHNLENVASQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLR 212
SP1 NLEITGEYAEALKQLGQNLEDVASQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLR 235
rice NLELTGQYAEALQQLGHSLEDVATQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLR 214
wheat NLELTGQYAEALKQLGQNLEDVASQEPDPALGNGGLGRLASCFLDSMATLNYPAWGYGLR 210
SP2 NLGITGAYAEAVKKFGYELEALAGQEKDAALGNGGLGRLASCFLDSMATLNLPAWGYGLR 159
sweetpotato YKYGLFKQRITKDGQEEVAEDWLELGNPWEIIRMDVSYPVKFFGKVITGSDGKKHWIGGE 265
potato YKYGLFKQRITKDGQEEVAEDWLEIGSPWEVVRNDVSYPIKFYGKVSTGSDGKRYWIGGE 272
SP1 YEYGLFKQIITKDGQEEIAENWLEMGYPWEVVRNDVSYPVKFYGKVVEGTDGRKHWIGGE 295
rice YKHGLFKQIITKDGQEEVAENWLEMGNPWEIVRTDVSYPVKFYGKVVEGTDGRMHWIGGE 274
wheat YRYGLFKQIIAKDGQEEVAENWLEMGNPWEIVRNDVSYPVKFYGKVVEGTDGRKHWIGGE 270
SP2 YRYGLFKQHIAKEGQEEVAEDWLDKFSPWEIPRHDVVFPVRFFGHVEILPDGSRKLVGGE 219
sweetpotato DILAVAYDVPIPGYKTRTTISLRLWSTKVPSEDFDLYSFNAGEHTKACEAQANAEKICYI 325
potato DIKAVAYDVPIPGYKTRTTISLRLWSTQVPSADFDLSAFNAGEHTKACEAQANAEKICYI 332
SP1 NIKAVAHDVPIPGYKTRTTNNLRLWSTTVPAQDFDLAAFNSGDHTKAYEAHLNAKKICHI 355
rice NIKVVAHDIPIPGYKTKTTNNLRLWSTTVPSQDFDLEAFNAGDHASAYEAHLNAEKICHV 334
wheat NIKAVAHDVPIPGYKTKTTNNLRLWSTTVPSQNFDLGAFNAGDHAKANEAHLNAEKICHV 330
SP2 VLKALAYDVPIPGYKTKNAISLRLWEAKATAEDFNLFQFNDGQYESAAQLHARAQQICAV 279
sweetpotato LYPGDESIEGKILRLKQQYTLCSASLQDIIARFERRSGEYVK--WEEFPEKVAVQMNDTH 383
potato LYPGDESEEGKILRLKQQYTLCSASLQDIISRFERRSGDRIK--WEEFPEKVAVQMNDTH 390
SP1 LYPGDESLEGKVLRLKQQYTLCSASLQDIIARFESRAGESLN--WEDFPSKVAVQMNDTH 413
rice LYPGDESPEGKVLRLKQQYTLCSASLQDIIARFERRAGDSLS--WEDFPSKVAVQMNDTH 392
wheat LYPGDESSEGKILRLKQQYTLCSASLQDIISRFESRAGDSLN--WEDFPSKVAVQMNDTH 388
SP2 LYPGDATEEGKLLRLKQQFFLCSASLQDMIARFKERKSDRVSGKWSEFPTKVAVQLNDTH 339
sweetpotato PTLCIPELIRILIDLKGLSWKEAWNITQRTVAYTNHTVLPEALEKWSYELMEKLLPRHIE 443
potato PTLCIPELMRILIDLKGLNWNEAWNITQRTVAYTNHTVLPEALEKWSYELMQKLLPRHVE 450
SP1 PTLCIPELMRILMDVKGLSWSEAWSITERTVAYTNHTVLPEALEKWSLDIMQKLLPRHVE 473
rice PTLCIPELMRILIDVKGLSWNEAWSITERTVAYTNHTVLPEALEKWSLDIMQKLLPRHVE 452
wheat PTLCIPELMRILMDIKGLSWNEAWSITERTVAYTNHTVLPEALEKWSLDIMQKLLPRHVE 448
SP2 PTLAIPELMRLLMDEEGLGWDEAWDITYRTISYTNHTVLPEALEKWSQIVMRKLLPRHME 399
114
sweetpotato IIEMIDEQLINEIVSEYGTSDLDMLEKKLNDMRILENFDIPSSIANLFTKPKETSIVDPS 503
potato IIEAIDEELVHEIVLKYGSMDLNKLEEKLTTMRILENFDLPSSVAELFIKP-EISVDDDT 509
SP1 IIETIDEELINNIVSKYGTTDTELLKKKLKEMRILDNVDLPASISQLFVKPKDKKESPAK 533
rice IIEKIDGELMNIIISKYGTEDTSLLKKKIKEMRILDNIDLPDSIAKLFVKPKEKKESPAK 512
wheat IIETIDEKLMNNIVSKYGTADISLLKQKLKDMRILDNVDLPASVAKLFIKPKEKTG---- 504
SP2 IIEEIDKRFKELVISKH-----KEMEGKIDSMKVLD------------------------ 430
sweetpotato EEVEVSGKVVTESVEVSDKVVTESEKDE----------LEEKDTELEKDED--------P 545
potato ETVEVH-----DKVEASDKVVTNDEDDTGKKTSVKIEAAAEKDIDKKTPVS--------P 556
SP1 SKQKLLVKSLETIVDVEEKTELEEEAEVLSEIEEEKLESEEVEAEEESSED---ELDPFV 590
rice LKEKLLVKSLEPSVVVEEKTVSKVEINEDSEEVEVDSE-EVVEAENEDSED---ELDPFV 568
wheat ---KLLVQSLESIAEGDEKTESQEEENILSETAEKKGGSDSEEAPDAEKEDPVYELDPFA 561
SP2 ------------------------------------------------------------
sweetpotato VPAPIPPKMVRMANLCVVGGHAVNGVAEIHSDIVKEDVFNDFYQLWPEKFQNKTNGVTPR 605
potato EPAVIPPKKVRMANLCVVGGHAVNGVAEIHSEIVKEEVFNDFYELWPEKFQNKTNGVTPR 616
SP1 KSDPKLPRVVRMANLCVVGGHSVNGVAEIHSEIVKQDVFNSFYEMWPTKFQNKTNGVTPR 650
rice KSDPKLPRVVRMANLCVVGGHSVNGVAAIHSEIVKEDVFNSFYEMWPAKFQNKTNGVTPR 628
wheat KYDPQLPRVVRMANLCVVGGHSVNGVAEIHSEIVKQDVFNSFYEMWPTKFQNKTNGVTPR 621
SP2 NSNPQKP-VVRMANLCVVSSHTVNGVAELHSNILKQELFADYVSIWPTKFQNKTNGITPR 489
sweetpotato RWIRFCNPALSNIITKWIGTEDWVLNTEKLAELRKFADNEDLQIEWRAAKRSNKVKVASF 665
potato RWIRFCNPPLSAIITKWTGTEDWVLKTEKLAELQKFADNEDLQNEWREAKRSNKIKVVSF 676
SP1 RWIRFCNPALSALISKWIGSDDWVLNTDKLAELKKFADNEDLHSEWRAAKKANKMKVVSL 710
rice RWIRFCNPELSAIISKWIGSDDWVLNTDKLAELKKFADDEDLQSEWRAAKKANKVKVVSL 688
wheat RWIRFCNPELSAIISKWIGSDDWILNTDKLAGLKKFADDEDLQSEWRTAKRNNKMKVVSL 681
SP2 RWLRFCNPELSEIVTKWLKSDQWTSNLDLLTGLRKFADDEKLHAEWAAAKLSCKKRLAKH 549
sweetpotato LKERTGYSVSPNAMFDIQVKRIHEYKRQLLNILGIVYRYKQMKEMSAREREAKFVPRVCI 725
potato LKEKTGYSVVPDAMFDIQVKRIHEYKRQLLNIFGIVYRYKKMKEMTAAERKTNFVPRVCI 736
SP1 IREKTGYIVSPDAMFDVQVKRIHEYKRQLLNILGIVYRYKKMKEMSTEERAKSFVPRVCI 770
rice IREKTGYIVSPDAMFDVQVKRIHEYKRQLLNILGIVYRYKKMKEMSAKDRINSFVPRVCI 748
wheat IRDKTGYVVSPDAMFDVQVKRIHEYKRQLLNILGIVYRYKKMKEMSAKDRIKSFVPRVCI 741
SP2 VLDVTGVTIDPTSLFDIQIKRIHEYKRQLLNILGAVYRYKKLKGMSAEEK-QKVTPRTVM 608
sweetpotato FGGKAFATYVQAKRIAKFITDVGATINHDPEIGDLLKVIFVPDYNVSAAELLIPASGLSQ 785
potato FGGKAFATYVQAKRIVKFITDVGATINHDPEIGDLLKVVFVPDYNVSVAELLIPASDLSE 796
SP1 FGGKAFATYIQAKRIVKFITDVAATVNHDSDIGDLLKVVFVPDYNVSVAEALIPASELSQ 830
rice FGGKAFATYVQAKRIVKFITDVAATVNHDPEIGDLLKVVFIPDYNVSVAEALIPASELSQ 808
wheat FGGKAFATYVQAKRIVKFITDVAATVNYDPDVGDLLKVVFVPDYNVSVAEKLIPASELSQ 801
SP2 IGGKAFATYTNAKRIVKLVNDVGAVVNNDPEVNKYLKVVFIPNYNVSVAEVLIPGSELSQ 668
sweetpotato HISTAGMEASGQSNMKFAMNGCILIGTLDGANVEIRQEVGEENFFLFGAEAHEIAGLRKE 845
potato HISTAGMEASGTSNMKFAMNGCIQIGTLDGANVEIREEVGEENFFLFGAQAHEIAGLRKE 856
SP1 HISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGEENFFLFGAEAHEIAGLRKE 890
rice HISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGEENFFLFGAEAHEIAGLRKE 868
wheat HISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGEENFFLFGAHAPEIAGLRQE 861
SP2 HISTAGMEASGTSNMKFSLNGCVIIGTLDGANVEIREEVGEDNFFLFGAKADEVAGLRKD 728
sweetpotato RAEGKFVPDERFEEVKEFIKRGVFGSNTYDELLGSLEGNEGFGRGDYFLVGKDFPSYIEC 905
potato RADGKFVPDERFEEVKEFVRSGAFGSYNYDDLIGSLEGNEGFGRADYFLVGKDFPSYIEC 916
SP1 RAEGKFVPDPRFEEVKEFVRSGVFGTYSYDELMGSLEGNEGYGRADYFLVGKDFPSYIEC 950
rice RAQGKFVPDPRFEEVKRFVRSGVFGTYNYDDLMGSLEGNEGYGRADYFLVGKDFPSYIEC 928
wheat RAEGKFVPDPRFEEVKEYVRSGVFGTSNYDELMGSLEGNEGYGRADYFLVGKDFPSYIEC 921
SP2 RENGLFKPDPRFEEAKQFIRSGAFGSYDYEPLLDSLEGNSGFGRGDYFLVGYDFPSYIDA 788
sweetpotato QEKVDEAYRDQKIWTRMSILNTAGSYKFSSDRTIHEYAKDIWNIQPVVFP 955
potato QEKVDEAYRDQKRWTTMSILNTAGSYKFSSDRTIHEYAKDIWNIEAVEIA 966
SP1 QEKVDEAYRDQKLWTRMSILNTAGSSKFSSDRTIHEYAKDIWDISPAILP 1000
rice QEKVDKAYRDQKLWTRMSILNTASSSKFNSDRTIHEYAKDIWDIKPVILP 978
wheat QQKVDEAYRDQKLWTRMSILNTAGSPKFSSDRTIHEYAKDIWDISPVIMP 971
SP2 QDRVDAAYKDKKKWTKMSILNTAGSGKFSSDRTIAQYAKEIWDIKASPVV 838
115
Figure 33 The protein sequences of the plastidial SP of maize endosperm (SP1 Gene Bank ACF946921) the cytosolic form of maize (SP2 Gene Bank ACF946911) Ipomoea batatas tubers (GenBank AAA632711) Oryza sativa
endosperm (Japonica type GenBank BAG493281) Triticum aestivum endosperm (GenBank ACC592011) and Solanum tuberosum tuber (GenBank
CAA520361) were aligned by using CLUSTAL 21 multiple sequence alignment program The Transit peptide sequence (TP) of maize SP (70 amino acids) is indicated in green The L-80 insertion of plastidial form of maize is located at
510-590 amino acids (highlighted in red) The epitope sequence for the synthetic peptide used to develop anti SP specific antibodies
(YSYDELMGSLEGNEGYGRADYFLV) is located at 916-940 amino acids
116
Serine predictions
Name Pos Context Score Pred
_________________________v_________________
Sequence 3 --LISPHAS 0014
Sequence 7 SPHASHRHS 0927 S
Sequence 11 SHRHSTARA 0996 S
Sequence 22 ATTTSPPLQ 0159
Sequence 29 LQLASASRP 0126
Sequence 31 LASASRPHA 0020
Sequence 36 RPHASASGG 0363
Sequence 38 HASASGGGG 0637 S
Sequence 52 LAGGSGGGV 0006
Sequence 70 QRRVSARSV 0995 S
Sequence 73 VSARSVASD 0987 S
Sequence 76 RSVASDRDV 0989 S
Sequence 85 QGPVSPAEG 0993 S
Sequence 92 EGLPSVLNS 0160
Sequence 96 SVLNSIGSS 0495
Sequence 99 NSIGSSAIA 0006
Sequence 100 SIGSSAIAS 0023
Sequence 104 SAIASNIKH 0058
Sequence 117 APLFSPDHF 0144
Sequence 122 PDHFSPLKA 0242
Sequence 133 ATAKSVLDA 0898 S
Sequence 161 AYYLSMEFL 0018
Sequence 199 EDVASQEPD 0852 S
Sequence 216 GRLASCFLD 0007
Sequence 221 CFLDSLATL 0003
Sequence 272 RNDVSYPVK 0018
Sequence 321 LRLWSTTVP 0075
Sequence 336 AAFNSGDHT 0018
Sequence 362 PGDESLEGK 0826 S
Sequence 378 YTLCSASLQ 0009
Sequence 380 LCSASLQDI 0882 S
Sequence 390 ARFESRAGE 0713 S
Sequence 395 RAGESLNWE 0546 S
Sequence 403 EDFPSKVAV 0004
Sequence 432 VKGLSWSEA 0992 S
Sequence 434 GLSWSEAWS 0040
Sequence 438 SEAWSITER 0375
Sequence 460 LEKWSLDIM 0004
Sequence 488 NNIVSKYGT 0777 S
Sequence 516 DLPASISQL 0296
Sequence 518 PASISQLFV 0004
Sequence 530 DKKESPAKS 0994 S
Sequence 534 SPAKSKQKL 0584 S
Sequence 542 LLVKSLETI 0725 S
Sequence 563 AEVLSEIEE 0985 S
Sequence 572 EKLESEEVE 0973 S
Sequence 581 AEEESSEDE 0996 S
Sequence 582 EEESSEDEL 0993 S
Sequence 592 PFVKSDPKL 0138
Sequence 612 VGGHSVNGV 0038
Sequence 621 AEIHSEIVK 0012
Sequence 631 DVFNSFYEM 0041
Sequence 661 NPALSALIS 0019
Sequence 665 SALISKWIG 0004
Sequence 670 KWIGSDDWV 0009
Sequence 694 EDLHSEWRA 0465
Sequence 709 MKVVSLIRE 0953 S
Sequence 720 GYIVSPDAM 0052
Sequence 756 MKEMSTEER 0996 S
Sequence 763 ERAKSFVPR 0944 S
Sequence 800 VNHDSDIGD 0526 S
Sequence 817 DYNVSVAEA 0179
Sequence 826 LIPASELSQ 0075
Sequence 829 ASELSQHIS 0164
Sequence 833 SQHISTAGM 0013
Sequence 840 GMEASGTSN 0020
Sequence 843 ASGTSNMKF 0053
Sequence 911 EFVRSGVFG 0433
Sequence 918 FGTYSYDEL 0124
Sequence 925 ELMGSLEGN 0913 S
Sequence 946 KDFPSYIEC 0610 S
Sequence 968 WTRMSILNT 0561 S
Sequence 975 NTAGSSKFS 0933 S
Sequence 976 TAGSSKFSS 0468
Sequence 979 SSKFSSDRT 0988 S
Sequence 980 SKFSSDRTI 0808 S
Sequence 995 IWDISPAIL 0037
NetPhos 20 Server - prediction results
117
_________________________^________________
Threonine predictions
Name Pos Context Score Pred
_________________________v_________________
Sequence 12 HRHSTARAA 0985 T
Sequence 19 AAMATTTSP 0074
Sequence 20 AMATTTSPP 0697 T
Sequence 21 MATTTSPPL 0660 T
Sequence 130 AYHATAKSV 0546 T
Sequence 145 NWNATYDYY 0020
Sequence 171 GRALTNAIG 0117
Sequence 180 NLEITGEYA 0032
Sequence 224 DSLATLNYP 0021
Sequence 246 KQIITKDGQ 0099
Sequence 285 VVEGTDGRK 0186
Sequence 311 PGYKTRTTN 0063
Sequence 313 YKTRTTNNL 0107
Sequence 314 KTRTTNNLR 0341
Sequence 322 RLWSTTVPA 0615 T
Sequence 323 LWSTTVPAQ 0024
Sequence 340 SGDHTKAYE 0029
Sequence 375 KQQYTLCSA 0238
Sequence 412 QMNDTHPTL 0028
Sequence 415 DTHPTLCIP 0513 T
Sequence 440 AWSITERTV 0309
Sequence 443 ITERTVAYT 0150
Sequence 447 TVAYTNHTV 0013
Sequence 450 YTNHTVLPE 0063
Sequence 477 EIIETIDEE 0921 T
Sequence 492 SKYGTTDTE 0274
Sequence 493 KYGTTDTEL 0367
Sequence 495 GTTDTELLK 0233
Sequence 545 KSLETIVDV 0637 T
Sequence 553 VEEKTELEE 0855 T
Sequence 638 EMWPTKFQN 0195
Sequence 644 FQNKTNGVT 0031
Sequence 648 TNGVTPRRW 0569 T
Sequence 677 WVLNTDKLA 0471
Sequence 715 IREKTGYIV 0920 T
Sequence 757 KEMSTEERA 0420
Sequence 778 KAFATYIQA 0089
Sequence 790 VKFITDVAA 0051
Sequence 795 DVAATVNHD 0134
Sequence 834 QHISTAGME 0075
Sequence 842 EASGTSNMK 0158
Sequence 857 ILIGTLDGA 0499
Sequence 916 GVFGTYSYD 0027
Sequence 965 QKLWTRMSI 0007
Sequence 972 SILNTAGSS 0033
Sequence 983 SSDRTIHEY 0468
_________________________^_________________
Tyrosine predictions
Name Pos Context Score Pred
_________________________v_________________
Sequence 127 PLKAYHATA 0057
Sequence 146 WNATYDYYN 0411
Sequence 148 ATYDYYNKM 0262
Sequence 149 TYDYYNKMN 0559 Y
Sequence 158 VKQAYYLSM 0035
Sequence 159 KQAYYLSME 0385
Sequence 183 ITGEYAEAL 0332
Sequence 227 ATLNYPAWG 0043
Sequence 232 PAWGYGLRY 0042
Sequence 236 YGLRYEYGL 0176
Sequence 238 LRYEYGLFK 0010
Sequence 262 LEMGYPWEV 0023
Sequence 273 NDVSYPVKF 0124
Sequence 278 PVKFYGKVV 0016
Sequence 309 PIPGYKTRT 0269
Sequence 343 HTKAYEAHL 0125
Sequence 357 CHILYPGDE 0013
Sequence 374 LKQQYTLCS 0035
Sequence 446 RTVAYTNHT 0780 Y
Sequence 490 IVSKYGTTD 0134
Sequence 633 FNSFYEMWP 0768 Y
Sequence 717 EKTGYIVSP 0980 Y
Sequence 735 RIHEYKRQL 0049
Sequence 747 LGIVYRYKK 0009
Sequence 749 IVYRYKKMK 0033
Sequence 779 AFATYIQAK 0207
Sequence 814 FVPDYNVSV 0357
Sequence 917 VFGTYSYDE 0025
Sequence 919 GTYSYDELM 0045
Sequence 932 GNEGYGRAD 0911 Y
Sequence 937 GRADYFLVG 0162
Sequence 947 DFPSYIECQ 0744 Y
Sequence 958 VDEAYRDQK 0770 Y
Sequence 987 TIHEYAKDI 0017
_________________________^_________________
Figure 34 The predicted phosphorylation sites of the plastidial maize SP protein sequence were analyzed using NetPhos 20 Server
118
332 Development of recombinant SP
3321 PCR
The complete mRNA sequence (3053 bp) of plastidial SP of maize
(GenBank EU8576402) was obtained from the National Center for
Biotechnology Information data base (NCBI) Initially the coding sequence
including a part of TP sequence was isolated using the forward primer (SP-F1) 5rsquo
GCGGAGGTGGGGTTCTCCT 3rsquo and the reverse primer (SP-R1) 5rsquo
GCGAAAGAACCTGATATCCAC 3rsquo and the purified PCR product was used as the
template in next PCR to obtain the 2805 bp of complete mRNA coding sequence
which produces plastidial SP with 935 amino acids Fig 35 shows the PCR
product of the full length sequence (2805 bp) of SP visualized on a agarose gel
For the next PCR the primers were specifically designed for the CloneEZreg PCR
Cloning Kit (GenScript Cat No L00339) with a 15 bp overhang sequence from
the vector system pET29a on both forward (SP-F2) and reverse (SP-R2) primers
to facilitate the homologous recombination (Appendix 03 and 04 shows the
sequences of all the primers used in the study in PCR and sequence analysis)
119
Figure 35 The PCR product of complete mRNA coding sequence (2805 bp) of
plastidial SP of maize was visualized on a 1 (wv) agarose gel contained
ethidium bromide
3322 Testing the expression level and the synthetic and degradative
activity of recombinant SP on glycogen affinity zymogram
The expression level of the cloned gene was qualitatively tested by SDS-
PAGE analysis of produced proteins (Fig 36) Soluble extract of recombinant SP
obtained after the culture was induced by 1mM IPTG was run on the gel (30 μg
of total protein per well) and compared with equal amounts of soluble proteins
obtained from the uninduced cultures (control) the induced Arctic Expression
Ecoli cells without the plasmid induced Arctic Expression Ecoli cells only with
2805bp
5000
3000
2000
bp
2805bp
5000
3000
2000
bp
120
the plasmid but without the insert (Fig 36A) Induced Ecoli cells with the insert
(Lane 1) showed higher level of expression and the immunoblot probed with
anti-SP specific antibodies confirmed the higher expression was due to
recombinant SP (Fig 36B)
The synthetic activity of the recombinant SP was analyzed on 01
glycogen affinity zymogram (Fig 37A) 90 μg of proteins were run on the
zymogram The soluble recombinant proteins obtained after the cultures were
induced by 1 mM IPTG (Lane 1) showed higher activity than the amyloplast
lysates (Lane 6) There was no activity observed in the soluble fractions of
induced Arctic Express cells without plasmid (Lane 2) uninduced Arctic Express
cells with both the plasmid and the insert (Lane 3) and induced Arctic Express
cells with the plasmid (Lane 4) or in uninduced Arctic Express cells with the
plasmid but without the insert (Lane 5) The immunoblot of the zymogram
probed with anti-SP specific antibody recognized the SP in the recombinant
soluble fraction (Fig 37B) However the faint band in lane 3 in uninduced
culture in the immunoblot is due to the leaky promoter since there was no band
observed in other samples (Fig 37B) Corresponding immunoblots of the native
zymogram of SP recombinant proteins showed four distinct bands and may
represent the monomeric dimeric tetrameric and multimeric (consisting of
more than four subunits) configurations of the recombinant SP (Fig 37B)
The synthetic activity and degradative activity of the recombinant protein
was qualitatively tested on the zymogram by incubating the zymogram gel in 20
mM of G-1-P and Na2HPO4 as the inorganic phosphate substrate respectively
(Fig 38) Multiple bands on the samples may correspondent to the different
121
multimeric forms (dimeric and tetrameric) of SP The observation that the
activity bands shown in synthetic activity zymogram disappeared in the
degradative activity zymogram (38D) indicates that the recombinant SP is
active in both synthetic and degradative directions in a manner that is similar to
the SP presence in the amyloplast lysates (Fig 38)
122
Figure 36 Over expression of recombinant SP in Arctic express Ecoli was
analyzed by running the soluble recombinant protein on a 10 SDS gel followed by Coomassie staining (A) and immunoblot analyses by probing with anti-SP specific antibodies (B) 30 μg of proteins were run in each lane The expression
of the recombinant protein was induced by adding the final concentration of 1 mM IPTG (Lane 1) Uninduced cultures (Lane 2) IPTG induced Arctic Express
cells without the plasmid (Lane 3) IPTG induced Arctic Express cells with the plasmid but without the insert (Lane 4 and 5) and the amyloplast lysates(Lane 6) are shown Arrow indicated the expressed SP in lane 1
(A) (B)
kDa
150
100
75
50
L 1 2 3 4 5 6 L 1 2 3 4 5 6
L ndash Protein marker
1 Recombinant SP obtained after the cultures were induced by 1mM IPTG
2 Uninduced control
3 Only the induced Arctic Expression E-coli cells without the plasmid
4 and 5 Induced Arctic Expression E-coli cells with the plasmid no insert
6 Amyloplast lysates
123
Figure 37 The synthetic activity of recombinant SP in a glycogen affinity
native zymogram that contained 01 glycogen in the gel (A) and corresponding immunoblot of the native zymogram probed with anti-SP specific
antibodies (B) are shown 90 μg of proteins were run in a well and following electrophoresis the native gel was incubated overnight at 280C with the incubation buffer containing 01 glycogen and 20 mM G-1-P in the synthetic
direction The activity bands were visualized by Lugolrsquos solution and are indicated with arrows (A) Multiple bands which were recognized by SP-specific
antibodies on immunoblot are shown by arrows (B)
(B)
(A)
124
Figure 38 Testing the synthetic and degradative activity of recombinant SP on
glycogen affinity native zymogram The synthetic activity of recombinant SP in glycogen affinity native zymogram (A) and the corresponding immunoblot of the zymogram probed with anti-SP specific antibodies (B) immunoblot probed with
anti-S-tag antibodies (C) and degradative activity on zymogram (D) are shown 30 μg of protein were run in a well and following electrophoresis the native gel
was incubated overnight at 280C with the incubation buffer contained 20 mM G-1-Pin the synthetic direction (A) and 20 mM sodium phosphate dibasic (Na2HPO4) in phosphorylitic direction (D) Bands were visualized by Lugolrsquos
solution Suggested dimeric and multimeric forms of SP and are indicated with arrows
(A) (B) (C) (D)
SP synthetic
activity zymogramImmunoblot of SP
synthetic zymogram
probed with anti-SP
antibodies
Immunoblot of SP
synthetic zymogram
probed with anti-S-
tag antibodies
SP degradative
activity zymogram
SP
Recom
bin
ant
Am
ylo
pla
stly
sate
s
SP
Recom
bin
ant
Am
ylo
pla
stly
sate
s
SP
Recom
bin
ant
Am
ylo
pla
stly
sate
s
SP
Recom
bin
ant
Am
ylo
pla
stly
sate
s
SP synthetic
activity zymogramImmunoblot of SP
synthetic zymogram
probed with anti-SP
antibodies
Immunoblot of SP
synthetic zymogram
probed with anti-S-
tag antibodies
SP degradative
activity zymogram
SP
Recom
bin
ant
Am
ylo
pla
stly
sate
s
SP
Recom
bin
ant
Am
ylo
pla
stly
sate
s
SP
Recom
bin
ant
Am
ylo
pla
stly
sate
s
SP
Recom
bin
ant
Am
ylo
pla
stly
sate
s
125
333 Gel filtration chromatography analysis of recombinant SP
The soluble fraction of the recombinant SP was separated through a
Superdex 200 10300GL gel permeation column and the fractions collected were
analyzed by SDS-PAGE and immunoblotting using peptide specific anti-SP
antibodies (Fig 39A) Recombinant SP was eluted in for different peaks and the
predicted molecular weights of the eluted SP fractions (based on the elution of
the standards) showed the existence of monomeric (112 kDa) dimeric (112 kDa
X 2) tetrameric (112 kDa X 4) and multimeric forms (more than four subunits)
The synthetic activity of the various multimers of recombinant SP was tested on
the native zymograms by loading the equal amounts of proteins on the gel (Fig
39B) Activity bands were observed in the dimeric tetrameric and multimeric
forms but no activity was detected in the monomeric form on the zymogram
(Fig 39B)
126
Figure 39 Gel filtration chromatography (GPC) analysis of recombinant SP Recombinant SP soluble fraction was separated by GPC through a Superdex 200 10300GL gel permeation column The fractions were run (30 μg of proteins in a
well) on SDS-PAGE followed by immunoblot analysis with anti-SP antibodies Monomeric (112 kDa) dimeric tetrameric and multimeric forms of SP were
detected (A) Fractions containing SP were tested for synthetic activity on a glycogen affinity zymogram (B) and corresponding immunoblot of the zymogram probed with the anti-SP specific antibodies (C) The SP bands correspond to the
various SP multimers and are shown by the arrows and the fraction numbers of the bands were shown The sizes of the known protein standards eluted in the
column were indicated in the boxes AP=amyloplast lysates
(A)
(B)
(C)
127
334 Immobilization of recombinant SP on S-Protein Agarose beads
The S-tagged GPC fractions of tetrameric dimeric and monomeric forms
of SP were separately immobilized to S-protein agarose beads following
incubation with 05 mgmL of pretreated amyloplast lysates The success of
immobilization of the recombinant tetrameric and dimeric forms to the S-
agarose beads was tested by probing immunoblots of washed beads with anti-SP
specific and anti S-tag specific antibodies (Fig 310) Both the dimeric and
tetrameric SP incubated with both untreated and ATP-treated amyloplast lysates
showed very strong immuno-reactive bands The tetrameric form showed
nonspecific binding with the proteins in the amyloplast lysates however the
level of binding is negligible when compare with the immobilized samples (Fig
310)
To test the protein-protein interactions of the tetrameric and dimeric
forms of recombinant SP with major starch biosynthetic enzymes the beads
containing protein complexes were separated on SDS-PAGE gels and
immunoblots probed with various peptide-specific antibodies Interactions were
observed between recombinant SP forms only with SSIIa SBEI and SBEIIb (Fig
311) The tetrameric form of recombinant SP interacted with SSIIa and SBEI
when the amyloplast was treated with ATP but not in the untreated amyloplast
lysates or APase treated samples In contrast there was no interaction with
SBEIIb and the tetrameric form In ATP-treated amyloplasts SBEI and SBEIIb
interact with the dimeric form but not with the ATP treated SSIIa SSIIa
interacted with the dimeric form of SP in the untreated amyloplast lysates
Further the interaction between SBEI and dimeric forms was independent of
128
ATP treatment The dimeric form of SP showed much stronger interaction with
SBEIIb in ATP-treated sample than in the untreated samples The APase-treated
samples did not show any interaction with any of the enzymes tested Fig 313
is a schematic diagram summarizing the possible interactions of the recombinant
forms of SP with SSIIa SBEI and SBEIIb enzymes
129
Figure 310 Immunoblots probed with anti-SP and anti-S-tag peptide specific antibodies to confirm the immobilization of the recombinant GPC fractions by S-Agarose beads The S-tagged GPC fractions (675 μg of protein) were
immobilized to S-protein agarose beads after the fractions were incubated with 05 mgmL of untreated and pretreated amyloplast lysates with 1mM ATP
APase The ATP or APase and untreated amyloplast lysates were incubated with the S-agarose beads without the recombinant fractions as the controls (lane 4-6) The washed pellets of S-agarose protein bead complexes were subjected to
SDS-PAGE and immunoblot analysis L= protein marker and the size of SP is 112 kDa
Dimeric form of SPTetrameric form of SP
1 Untreated amyloplast lysates (AP) incubated with recombinant SP forms
2 ATP Treated AP incubated with recombinant SP forms
3 APase Treated incubated with recombinant SP forms
4 Beads+ Untreated AP (no recombinant SP forms)
5 Beads+ ATP treated AP (no recombinant SP forms)
6 Beads+ APase treated AP (no recombinant SP forms)
7 SP forms + beads only
8 Amyloplast lysates
L 1 2 3 4 5 6 7 8
kDa
150
100
75
L 1 2 3 4 5 6 7 8
L 1 2 3 4 5 6 7 8 L 1 2 3 4 5 6 7 8
kDa
150
100
75
Anti-SP
Anti-S-Tag
130
Figure 311 Immunoblots of the immobilized GPC fractions of the recombinat
SP by S-Agarose beads probed with anti-SSIIa anti-SBEI and anti-SBEIIb peptide specific antibodies The S-tagged tetrameric and dimeric GPC fractions
(675 μg of protein) were immobilized to S-protein agarose beads after the fractions were incubated with 05 mgmL of untreated and pretreated amyloplast lysates with 1mM ATP or APase The ATP APase and untreated
amyloplast lysates were incubated with the S-agarose beads without the recombinant fractions as the controls The washed pellets of S-agarose protein
bead complexes were subjected to SDS-PAGE and immunoblot analysis to test the protein-protein interactions L= protein marker The arrows indicate the enzyme SSIIa at 76 kDa SBEI at 80 kDa and SBEIIb at 85 kDa
131
Figure 312 Immunoprecipitation of recombinant tetrameric and dimeric forms
of SP by peptide specific anti-SP antibodies bound to Protein A- Sepharose beads
132
Figure 313 Schematic diagram summarizing the protein-protein interactions between tetrameric and dimeric forms of recombinant SP with starch biosynthetic enzymes present in the amyloplast lysates
335 The glucan synthetic and phospholytic activity of recombinant SP
The synthetic activity of the tetrameric dimeric and monomeric forms of
recombinant SP was analyzed in vitro by using [U14
C]-G-1-P as the substrate
The transfer of glucosyl units from radio labeled G-1-P to glycogen amylopectin
and maltoheptaose were assayed using 25 mgmL substrate concentration for
30 minutes and the synthetic activity was calculated as nmolmghr (Fig 314)
The tetrameric form of SP had the highest activity with amylopectin
(928961255) which was approximately 24 greater than with glycogen
(665121356) Synthetic activities were statistically analyzed by Statistix 9
statistics analytical program at (Plt005) probability using by One-Way ANOVA
= Phosphorylation of the enzyme by ATP+plastidial protein kinase
133
followed by LSD analysis (F= 24766 P=000001 see appendix 09 for the
statistical analysis of the data) There was no significant difference between the
activity of the tetrameric form of SP between amylopectin and glycogen
substrates Both glycogen and amylopectin showed significant differences in
synthetic activity compared to maltoheptaose for given substrate
concentrations The activity was much lower for the dimeric form in amylopectin
(174710) and glycogen (1746914) compared to the activities of the
tetrameric form with these substrates However the dimeric form showed
slightly higher in synthetic activity (503017) compared to tetrameric form
(29711) with maltoheptaose Synthetic activity of the dimeric form of SP was
not significantly different for glycogen amylopectin or maltoheptaose substrates
(Fig 313) The tetrameric form of SP with amylopectin and glycogen showed
significantly higher phosphorylitic activity at 25 mgmL substrate concentration
compared to maltoheptaose but no significant difference was observed between
amylopectin and glycogen The variation of the activity of tetrameric SP from
synthetic direction to phosphorylitic direction was greater in maltoheptaose (147
fold) compared to amylopectin (20 fold) and glycogen (11) (Fig 314) (see
Appendix 09 for the analysis of ANOVA)
The Vmax and Km of the tetrameric form of recombinant SP was greater
with amylopectin and lower in maltoheptaose in phosphorylitic direction (Table
31) Vmax of the tetrameric form was approximately 142 times greater than
the dimeric form (Table 31) The Km value of the dimeric form was
approximately 112 times greater than the tetrameric form for amylopectin and
about 275 times greater for glycogen (Table 31)
134
Figure 314 Synthetic and degradative activities of the tetrameric and dimeric forms of recombinant SP in different glucan substrates The activities were
compared at 25 mgmL substrate concentration in glycogen amylopectin and maltoheptaose Significantly different means (at Plt005) are shown with similar symbols S= Synthetic direction P= Phosphorolytic direction
Table 31 The Km and Vmax values of dimeric and tetrameric forms of
recombinant SP in the phosphorolytic direction
Glucan Substrate
Tetrameric form of
recombinant SP
Vmax Km (nmolmgmin) (mgmL)
Dimeric form of
recombinant SP
Vmax Km (nmolmgmin) (mgmL)
Glycogen
Amylopectin
Maltoheptaose
89429 0024
131648 0078
49711 00298
5952 0066
9786 873
- -
Tetrameric form of Recombinant
SP
0250500750
1000
1250150017502000
S P S P S P
Gly Amy Malto
En
zym
e A
ctivity (
nm
olm
gm
in)
Dimeric form of
Recombinant SP
0
20
40
60
80
100
120
S P S P S P
Gly Amy MaltoE
nzym
e A
ctivity (
nm
olm
gm
in)
+
+
Dagger
Dagger
Dagger
Tetrameric form of Recombinant
SP
0250500750
1000
1250150017502000
S P S P S P
Gly Amy Malto
En
zym
e A
ctivity (
nm
olm
gm
in)
Dimeric form of
Recombinant SP
0
20
40
60
80
100
120
S P S P S P
Gly Amy MaltoE
nzym
e A
ctivity (
nm
olm
gm
in)
+
+
Dagger
Dagger
Dagger
135
34 Discussion
341 Development of recombinant SP
The investigations presented in this chapter tested the hypothesis that
plastidial SP has a role in starch biosynthesis and it is regulated by protein-
protein interaction with other starch biosynthetic enzymes Previous studies
confirm the involvement of SP in protein complex formation with other major
starch biosynthetic enzymes SP was involved in the formation of heteromeric
protein complexes with SBEI and SBEIIb in a phosphorylation dependent
manner in wheat amyloplasts (Tetlow et al 2004) In the ae mutant which
lacks SBEIIb SP formed complexes with SBEI SSI SSIIa and SBEIIa (Liu et al
2009) However in the present study the interaction of SP with other starch
biosynthetic enzymes in maize amyloplast stroma was not detected by co-
immunoprecipitation since the native protein was not immunoprecipated by
peptide specific anti-SP antibodies bound to Protein-A sepharose beads (Chapter
2 section 236) Dimeric and tetrameric configurations of SP may reduce
accessibility of the SP antibodies to the epitopes thus preventing
immunoprecipitation of recombinant dimeric and tetrameric forms by SP-specific
antibodies and Protein-A sepharose beads (Fig 314) We therefore developed
a recombinant SP with an affinity ligand S-tag on the N-terminus of the protein
in order to detect protein-protein interactions involving SP
The complete mRNA sequence (2805 bp) of plastidial SP of wild-type
maize without the transit peptide (TP) sequence of 70 amino acids was directly
136
cloned into pET29a expression vector and the complete protein with 935 amino
acids was over expressed in Acrtic Express Ecoli system
The amino acid sequence alignment of plastidial SP of maize wild-type
endosperm (Zea mays) (SP1 Gene Bank ACF946921) with the TP Ipomoea
batatas tubers (GenBank AAA632711) Oryza sativa endosperm (Japonica
type GenBank BAG493281) Triticum aestivum endosperm (GenBank
ACC592011) Solanum tuberosum tuber (GenBank CAA520361) and the
cytosolic form of maize (SP2 Gene Bank ACF946911) showed that C-terminus
is highly conserved among the species tested It further confirmed the previous
sequence analysis of Yu et al (2001) that the peptide sequences of maize SP
showed higher identities to potato sweet potato and spinach but the N-terminus
sequence did not align with any other N-terminal sequences
The L-78 amino acid insertion located in the middle of plastidial SP is a
unique characteristic of plastidial SP and is not seen in the cytosolic form of SP
(Young et al 2006 Yu et al 2001 Mori et al 1993) Computational analysis
also found that the unique L-80 insertion of the plasitidial form is located at 510-
590 amino acids in maize (Fig 32) The exact role of this insertion is not well
documented in maize SP Phosphorylation site prediction analysis indicated that
the L-80 insertion consists of 7 serine (Ser) (out of 28) and 2 (out of 7) of the
threonine (Thr) residues These observations are similar to the finding of Young
et al (2006) indicating that there are 10 Ser and 5 Thr residues on L-78
insertion in the plastidial SP in sweet potato tubers and also the serine and
threonine residues are intensively involved in the phosphorylation of the enzyme
137
(Young et al 2006) L-78 insertion of plastidial SP also prevents affinity towards
higher molecular branched glucans such as starch and glycogen (Young et al
2006 Mori et al 1993) Recombinant form of plastidial SP developed by
replacing the L-78 insertion with a cytosolic SP sequence in potato showed the
activity of the chimeric protein was five times lesser than the parent type
isoform but its affinity for glycogen was much higher (Mori et al 1993) In
contrast a higher affinity of the SP to low molecular malto-oligosaccharides
(MOS) is recorded in maize (Yu et al 2001)
Qualitative analysis of the synthetic activity of the recombinant SP on
01 glycogen affinity zymogram (Fig 37A) showed catalytic activity of the
protein The lower activity shown in lane 5 (uninduced Ecoli cells with the
plasmid but without the insert) may be due to the endogenous glucan
phosphorylase present in Ecoli However no such activity was found in induced
Ecoli cells with the plasmid but without the insert (lane 4) and the activity level
is negligible when compared with the recombinant SP activity The immunoblot
of the zymogram probed with anti-SP specific antibody recognized the SP in
recombinant soluble fraction (Fig 37B) However the faint band on the lane 3 in
uninduced culture in the immunoblot is due to the leaky promoter since there
was no band observed in other samples (Fig 37B) Further the degradative
activity of the recombinant SP on zymogram indicates that the protein is also
active in degradative direction (Fig 38D)
138
342 Gel filtration chromatography of recombinant SP
Native SP exists as monomeric dimeric or tetrameric forms with identical
subunits in maize amyloplast stroma (Albrecht et al 1998 Mu et al 2001 Liu et
al 2009) These different molecular confirmations remain throughout the
development of the endosperm Immunoblot analysis of soluble fraction of the
recombinant SP eluted through the GPC column indicated that the fractions
contained monomeric and high molecular dimeric tetrameric and multimeric
forms The synthetic activity was detected in the dimeric tetrameric and
multimeric forms of GPC-fractionated recombinant SP Inactivity shown in the
monomeric form was due to the lack of activity of the monomeric form or
relatively lower levels of protein are present in the fractions that could not be
detected on western blots
Glycogen phosphorylase in animals and bacteria is homodimeric and each
subunit linked to a pyridoxal phosphate co-factor which is involved in enzyme
catalysis (Buchbinder et al 2001) Two plastidial phosphorylases (PhoA and
PhoB) in Chlamydomonas reinhardtii which produces starch are shown to
function as homodimers containing two 91-kDa (PhoA) subunits and two 110-
kDa (PhoB) subunits (Dauvilleacutee et al 2006) Both of the Chlamydomonas SPs
lack the L-80 amino-acid insertion found in higher plant plastidial forms PhoB is
exquisitely sensitive to inhibition by ADP-glucose and has a low affinity for
malto-oligosaccharides PhoA is moderately sensitive to ADP-glucose inhibition
and has a high affinity for unbranched malto-oligosaccharides which is similar to
the observation in higher plants (Dauvilleacutee et al 2006 Mu et al 2001) Further
the mutation in STA4 gene in Chlamydomonas reinhardtii display a significant
139
decrease in amounts of starch with abnormally shaped granules (Dauvilleacutee et al
2006) Similarly sh4 (shrunken4) mutant of maize displays a strong reduction
in starch content and this reduction was identified as lack of the SP cofactor
pyridoxal-5-phosphate (Tsai and Nelson 1969) However external addition of
pyridoxal-5-phosphate to the assay system for SP activity of the mutant did not
affect the activity (Yu et al 2001) The product of the sh4 gene is still unknown
and this gene may or may not control the supply of pyridoxal phosphate (Yanase
et al 2006 Dauvilleacutee et al 2006 Burr and Nelson 1973 Yu et al 2001)
Formation of multi-subunit configurations of SP and direct involvement of
pyridoxal phosphate in this process in higher plants is yet to be investigated
The recombinant SP developed in this study consisting of catalytically active
dimeric and tetrameric forms were useful in understanding the different
biochemical and regulatory mechanisms of these structures
343 Investigating protein-protein interactions using immobilized
recombinant SP on S-Protein Agarose beads
The SP in maize amyloplast lysates exist as different conformational
structures the tetrameric dimeric forms (Liu et al 2009 Mu et al 2001)
However the relative availability quantity or the regulatory mechanisms of
these identical subunits in developing maize endosperm are not known The S-
tagged GPC fractions of tetrameric dimeric and monomeric forms obtained from
GPC analysis were used to analyze the protein- protein interactions of SP with
other enzymes The fractions were separately immobilized to S-protein agarose
beads after the fractions were incubated amyloplast lysates Immunoblot
140
analysis revealed that the tetrameric and dimeric forms were more strongly
immobilized to the beads The monomeric form present in the fractions may be
less than the other two forms and not strongly immobilized to agarose beads
The tetrameric form of recombinant SP interacted with SSIIa and SBEI
when the amyloplast extract was treated with 1 mM ATP but not in the
untreated amyloplast lysates or APase treated samples suggesting a
phosphorylation-dependent interaction In contrast no interaction was detected
with SBEIIb and the tetrameric form ATP-treated SBEI and SBEIIb strongly
interact with the dimeric form Similar interactions were found in wheat
amyloplast lysates SBEI and SBEIIb interacted with SP in a phosphorylation-
dependent manner (Tetlow et al 2004) However the multimeric status of SP
involved in these interactions in wheat amyloplast lysates is not known SSIIa
interacted with the dimeric form only in the untreated amyloplast lysates
Further the interaction between SBEI and the dimeric form of SP was
independent of ATP treatment APase-treated samples did not show any
interaction with any of the enzymes tested The isoforms of the major enzymes
involved in starch biosynthesis are regulated by protein phosphorylation
protein-protein interaction in maize amyloplast stroma (Liu et al 2009 Hennen-
Bierwagen et al 2008) Experiments in which isolated maize endosperm
amyloplasts were incubated with [γ-32P]-ATP provide direct evidence for
phosphorylation of SP (Pollack 2009) The heteromeric complexes of starch
synthesis enzymes assembled in the amylose extender (ae) mutant (lacking
SBEIIb) in maize amyloplast stroma was found by Liu et al (2009) The complex
formed by SSI SSII with SBEIIb in wild-type was replaced by forming SBE1
141
combined with SP in ae mutant (Liu et al 2009) The assortment of different
multimeric forms in the wild-type stroma may be available in different
compositions that may prevent interactions or the level of interactions may be
weak and not detectable
Functional interactions observed between SP and SBE isoforms in rice
endosperm suggested the mutual capacities for chain elongation and chain
branching (Nakamura et al 2012) The activity of SP and SBE isoforms also
depended on the mutual availability of each group of enzyme and purified SP
from rice endosperm could synthesize glucans from G-1-P in the presence of
SBE even without any exogenous glucan primer (Nakamura et al 2012) In vitro
glucan production was higher when SBEI presence compared to SBEIIa or
SBEIIb (Nakamura et al 2012) Functional and physical interactions between
SBE isoforms and SP (Nakamura et al 2012 Tetlow et al 2004 Ball and Morell
2003) and the high affinity towards low molecular malto oligosaccharide (MOS)
(Mu et al 2001) suggested that SP acts on MOS which are liberated by the
activity of debranching enzymes (DBE) to produce linear maltodextrin (MD) of a
length sufficient for a subsequent branching reaction by starch branching
enzymes (SBE) (Nakamura et al 2012 Ball and Morell 2003) Therefore direct
interactions between SP and SBE isoforms different multimeric forms interact in
unique and selective manner and phosphorylation and dephosphorylation of
these multimeric forms may play a major role in starch biosynthesis by
controlling the catalytic activity and assembly of protein complexes
Reduced numbers of Less number of starch granules with increased
granule surface observed in ss4 and ss4sp mutants in Arabidopsis leaves
142
suggested that SP may be involved in granule initiation in starch biosynthesis
process via any kind of functional or physical interaction between SP and SSIV
(Roland et al 2008 Planchot et al 2008) Investigating possible interactions of
SP with SSIV was one of the major objectives of this study in order to elucidate
the regulation of SP ATP treated amyloplast lysates showed a weak interaction
between SSIV and SP (Chapter 2) Phosphorylation of SP may be a vital
requirement for this interaction since SSIV was not regulated by
phosphorylation However no strong interaction was detected between SSIV
and the dimeric and tetrameric forms of recombinant SP The reason may be
due to the small amounts of SSIV that were available in the assays or
recombinant SP forms were not sufficiently phosphorylated or these proteins do
not interact
Dimeric and tetrameric forms of SP showed higher activities in
amylopectin in both synthetic and degradative directions and degradative
activity was greater in phosphorylitic direction compared to synthetic direction
(Fig 313) Both multimeric forms show higher activity with highly branched
glucan substrates The Km of the tetrameric form in the phosphorylitic direction
was about 25 times greater with amylopectin compared to glycogen or
maltoheptaose indicating the lower affinity of the tetrameric form towards
highly branched large molecule substrates (Table 31) The affinity of dimeric SP
for amylopectin was smaller than the tetramer (Km was increased by 111 times
and by 3 times in glycogen compared to tetrameric form) indicating that
different multimeric forms have different affinity levels for similar substrates
The reaction of the dimeric form in the phosphorylitic direction was not detected
143
in the given range of substrate concentrations of maltoheptaose that were
tested
Previous work with purified SP from maize amyloplasts recorded that the
phosphorylitic reaction was favored over the synthetic reaction when malto-
oligosaccharides were used as the substrate (Mu et al 2001) The Vmax and Km
of SP in maize amyloplast lysates recorded in this study was approximately 7
and 58 times lower than with purified SP in phosphorolytic reaction (Mu et al
2001) Unlike the purified form of SP the activity of SP present in amyloplast
lysates is regulated by other starch biosynthetic enzymes and metabolites such
as Pi G-1-P and ADP-glucose present in the lysates (Tiessen et al 2011 Mu et
al 2001 Schupp and Ziegler 2004 Matheson and Richardson 1978) For
instance G-1-P and Pi present in amyloplast lysates and high PiG-1-P ratios are
thought to control SP activity (Mu et al 2001 Schupp and Ziegler 2004)
However according to the findings of Hwang et al (2010) the incorporation of
[U14C]-G-1-P into starch was only partially affected by the concentration of Pi in
rice Even under physiological G-1-P substrate levels (02 mM) and a 50-fold
higher level of Pi in vitro than the normal physiological level the Pho1 from of
rice was able to carry out the biosynthetic reaction Partially purified
recombinant tetrameric and dimeric forms produced in this study had 115 times
greater and 088 times less Vmax compared to purified-SP by Mu et al (2001) in
phosphorolytic direction in amylopectin The activity of SP in recombinant
multimers may be changed by desalting of the extracts which was not carried
out in the experiments
144
The preference of SP for different α-glucans has been recorded in many
plant species (Schupp and Ziegler 2004 Mu et al 2001 Yu et al 2001 Young
et al 2006 Mori et al 1993) Differentiating from maize SP in sweet potato
tubers plastidial SP showed a low binding affinity toward starch and a high
affinity toward low molecular weight linear MOS (Young et al 2006) In contrast
the cytosolic isoform has a high affinity towards highly branched polyglucan
amylopectin (Young et al 2006) The synthetic activity of SP to amylopectin
(Km =013) is higher when compared to the highly branched glycogen
(Km=045) in maize (Yu et al 2001) in potato tubers (Liddle et al 1961) and in
spinach leaves (Shimomura et al 1982) In sweet potato tubers the unique L-
78 amino acid peptide insertion located in the middle of plastidial form of SP
appears to block the binding site of SP to high molecular weight α-glucans
(Young et al 2006) However it was not observed in maize amyloplast SP
whether the L-78 insertion influences the kinetics of the enzyme In fact there is
no clear evidence for cleavage of L-78 in plastidial isoforms of SP from cereals
In this chapter experiments were carried out to elucidate the regulation of
SP in maize amyloplasts SP is a stromal enzyme and remains active throughout
the endosperm development and exists as homodimeric or homotetrameric
configurations throughout the developmental stages This study suggested that
the tetrameric and dimeric forms have different catalytic activities and may be
involved in starch biosynthesis by being regulated differently from each other
The synthetic and phosphorolytic activity assays showed that the SP multimers
are variously active in both directions SP showed greater activities with
amylopectin compared to glycogen and maltoheptaose in both synthetic and
145
phosphorylitic directions ATP-treated SP showed higher activities in both
directions in amylopectin substrate indicating that ATP may be involved in
regulating the SP through protein phosphorylation However the protein-protein
interactions could not be detected by co-immunoprecipitation as the native SP
could not be immunoprecipitated by SP-antibodies and Protein-A sepharose
beads This may be due to lack of accessibility of the epitopes in the dimeric
and tetrameric configurations Therefore the development of S-tagged
recombinant SP was used for analyzing protein-protein interactions of SP
146
CHAPTER 4
147
Biochemical Investigation of the Regulation of Starch Synthase IV in Maize Endosperm
41 Introduction
The glucan synthases catalyze the elongation of glucan chains by
transferring a glucosyl moiety to the non-reducing end of an α-(1-4)-linked
glucan primer Glucan synthases are found in both eukaryotes and prokaryotes
but the most intensively studied enzyme in this class is glycogen synthase which
is responsible for α-glucan elongation of glycogen (Szydlowski et al 2011 Ball
and Morell 2003 Roach 2002 Cao et al 1999 Denyer et al 1995 Madsen
1991 Preiss 1988 Preiss 1984) Glycogen is a water-soluble polyglucan that is
produced in mammals fungi bacteria cyanobacteria and archaebacteria (Ball
and Morell 2003 Roach 2002 Furukawa et al 1993 Furukawa et al 1990) In
contrast starch is a water-insoluble polyglucan produce in plants green algae
and some cyanobacteria (Nakamura et al 2005 Ball and Morell 2003) One of
the principle differences between glycogen and starch synthesis is the nucleotide
sugar substrate of the glucan synthases involved in biosynthesis UDP-glucose is
the glucan donor for glycogen synthesis (Leloir et al 1961) and ADP-glucose is
the substrate of starch synthesis (Nakamura et al 2005 Ball and Morell 2003
Roach 2002) Structurally glycogen is distinct from starch in that glycogen is
water-soluble and possesses a higher degree of branching (10) and has a
more open structure that expands in a globular fashion (Ball and Morell 2003
Roach 2002) Starch is characterized by clustered branch points (about 6 of
branching frequency) creating a water-insoluble granule (Manners 1989)
Several isoforms of starch synthases and branching enzymes are found in plants
148
whereas glycogen synthase and glucan branching enzyme each exist as a single
isoforms (Fujita et al 2011 Ball and Morell 2003)
The starch synthesized in higher plants consists of two types of glucose
polymers amylose and the amylopectin Amylose is a sparsely branched linear
molecule found to be about 1000 to 50000 glucose units whereas highly
branched amylopectin has 105ndash106 glucose units Both amylose and amylopectin
are elongated by the starch synthases (SS) by transferring the α-D-glucose
units from ADP-glucose the precursor of the starch biosynthesis to the non
reducing end of the glucan chain (Leloir et al 1961) Five major isoforms of
starch synthases (SS) have been recorded in higher plants SSI SSII SSIII
SSIV and GBSS (Tetlow 2011 Ball and Morell 2003) GBSS is essential for
amylose synthesis and is exclusively bound to the starch granule (Nakamura et
al 1993 Sano 1984 Echt and Schwartz 1981) SSI SSII SSIII and SSIV
isoforms are thought to be responsible for amylopectin synthesis (Dian et al
2005 Denyer et al 1999 Gao et al 1998 Denyer et al 1995) Mutant analysis
and biochemical studies have shown that each class of SS has a distinct role in
the synthesis of amylopectin (Nakamura 2002 Fontaine et al 1993 Morell et
al 2003) SSI is responsible for producing DP= 8-12 glucan chains (Commuri
and Keeling 2001) SSII and SSIII respectively produce 12-25 (Zhang et al
2004 Morell et al 2003) and DP= 25-40 or greater glucan chains in
amylopectin (Tomlinson and Denyer 2003) However there is little information
available about the functionrole of SSIV The role and the regulation of the
SSIV in storage starch biosynthesis are largely unknown The different isoforms
of starch biosynthetic enzymes are differentially expressed at different stages of
149
endosperm development in cereals (Dian et al 2005) The SSIIa SSIII-1 and
SBEIIa are expressed in early stage and SSI SSII-3 SSIII-2 and SBEIIb are
expressed in the middle stage of the grain filling and GBBSSI SSIV and SBE1
are differentially expressed at the later stage of the grain filling in cereals (Liu et
al 2009 Fujita et al 2006 Dian et al 2005 Morell et al 1997 Gao et al
1996)
Sequence analysis revealed that there are some similarities and
differences of the SSIV in different plant species (Leterrier et al 2008 see
figure 41) The predicted protein sequence of SSIV in maize endosperm is 104
kDa in size and has a highly conserved C-terminal region compared with other
SSs The C-terminus contains the catalytic and the starch-binding domains of
SSs (Cao et al 1999) In common with other SSs (Fig 15 and Fig 41) the N-
terminal region of SSIV is different from other SS isoforms (Leterrier et al
2008) (Fig 42) In addition two coiled-coil domains were found in the SSIV-
specific region from amino acids 1ndash405 which are thought to be involved in
protein-protein interactions (Leterrier et al 2008 Jody et al 2004) (Fig 42)
14-3-3-protein recognition sites [RKXXpSXP and RKXXXpSP Muslin et al
(1996)] are also found in the N-terminal region of SSIV and may be involved in
the regulation of the enzyme [14-3-3 proteins are commonly linked to binding
with various signaling proteins such as kinases and phosphatases and act as
lsquoadaptor proteinsrsquo in various phosphorylation-dependent protein-protein
interactions (Comparot et al 2003)] (Fig 42) Expression of SSIV is tissue-
dependent and found to be highest in non-endosperm tissues such as in leaf
embryo and roots in wheat and the level of expression in the endosperm was
150
relatively low independent from the regulation of the circadian clock Therefore
the transcript accumulation levels did not coincide with the period of high carbon
flux to starch in the wheat endosperm (Leterrier et al 2008)
SSIV is exclusively localized in the amyloplast stroma (Leterrier et al
2008 Roldan et al 2007) Two different genes the OsSSIV-1 was expressed in
the endosperm and OsSSIV-2 was expressed in leaves in rice (Dian et al 2005)
In addition the cDNA sequence of SSIV expressed in developing wheat seedling
is similar to rice SSIV-2 and shares a similar exon-intron arrangement
(Leterrier et al 2008) These findings suggest that two different SSIV isoforms
may be responsible in transient and storage starch biosynthesis No such
different isoforms of SSIV have been identified in maize Further the SSIV
protein in Arabidopsis thaliana (11299 kDa in size Roldan et al 2007) shows
87 intron sequence identity to rice (OsSSIV-2 in leaves accession number
AY373258) (Leterrier et al 2008)
151
CLUSTAL 21 multiple sequence alignment
Ta -------MACS-------------AAAGVEATALLSPRCPAPSPPDGRSRRRLALASGTR 40
Os -------MAC--------------LAAGAEAAPLLFRRRLAPSPVAAR--RRLLVSCRAR 37
Zm PHPPRLPMSCS-------------AAAGAEATALLIR-SAAPSTIVGR--HRLAMSRRTS 90
At KGSPKPILSINSGLQSNNDEESDLENGSADSVPSLKSDAEKGSSIHGSIDMNHADENLEK 120
Ta HRSLRAAAQRPHKSATGAD--PLYNNRANVRSDEAS-------VSAEKERQRKYNDGDGI 91
Os RRGLRLVAQSAGSRGCGVVGAPGCDYWVNMQRDEAS-------VSSDKERQEKYGDENGI 90
Zm RRNLRTGVHPHQKSAPSAN----HRNRASIQRDRAS-------ASIDEEQKQMSEDENGL 139
At KDDIQTTEVTRRKSKTAKKKGESIHATIDIGHDDGKNLDNITVPEVAKALSLNKSEGEQI 180
Ta SNLKLEDLVGMIQNTEKNILLLNQARLQAMEHADKVLKEKEALQRKINILETRLSETDEQ 151
Os SNLQLEDLIQMIQNTEKNIMLLNQARLQALEHVETVLKEKEDLQRKLKILETRLSETDAR 150
Zm LDIQLEDLVGMIQNTQKNILLLNQARLQALERADKILKEKETLQQKINILEMKLSETGKQ 199
At SDGQFGELMTMIRSAEKNILRLDEARATALDDLNKILSDKEALQGEINVLEMKLSETDER 240
Ta HKLSSEGNFS----DS--------------------PLALELGILKEE--NILLKEDIEF 185
Os LKLSAEGQFGTEINDS--------------------LPVLELDDIKEENMETLLKDDIQF 190
Zm SVLSSEVKSD--------------------------EESLEFDVVKEE--NMLLKDEMNF 231
At IKTAAQEKAHVELLEEQLEKLRHEMISPIESDGYVLALSKELETLKLE--NLSLRNDIEM 298
Ta FKTKLIEVAEIEEGIFKLEKERALLDASLRELESRFIAAQADTMKLGPR----DAWWEKV 241
Os LKTMLIEVAETENSIFTLEKERALLDASLRELESRFIDAQADMLKSDPRQY--DAWWEKV 248
Zm LKGKLIEITETEESLFKLEKECALLNASLRELECTSTSAQSDVLKLGPLQQ--DAWWEKV 289
At LKSELDSVKDTGERVVVLEKECSGLESSVKDLESKLSVSQEDVSQLSTLKIECTDLWAKV 358
Ta EKLEDLLETTANQVEHAAVILDHNHDLQDRLDNLEASLQAANISKFSCS----LVDLLQQ 297
Os ENLGDLLETATNKVENAAMVLGRNHDLEDKVDKLEASLAEANISKFSCY----FVDLLQE 304
Zm ENLEDLLDSTANQVEHASLTLDGYRDFQDKVDKLKASLGTTNVSEFCLY----LVDILQQ 345
At ETLQLLLDRATKQAEQAVIVLQQNQDLRNKVDKIEESLKEANVYKESSEKIQQYNELMQH 418
Ta KVKLVEDRFQACNSEMHSQIELYEHSIVEFHDTLSKLIEESEKRSLENFTGNMPSELWSK 357
Os KIKSVEERFQVCNHEMHSQIELYENSIAEFHDILSKLVEETEKRSLEHSASSMPSELWSR 364
Zm RVKSVEERFQACNHEMHSQIELYEHSIVEFHGTLSKLINESEKKSMEHYAEGMPSEFWSR 405
At KVTLLEERLEKSDAEIFSYVQLYQESIKEFQETLESLKEESKKKSRDEPVDDMPWDYWSR 478
Ta ISLLIDGWLLEKKIAYNDASMLREMVRKRDSRLREAYLSYRGTENRDVMDSFLKMALPGT 417 Os ISLLIDGWLLEKRISYNDANTLREMVRKRDSCLREAYLSCRGMKDREIVDNFLKITLPGT 424 Zm ISLLIDGWSLEKKISINDASMLREMAWKRDNRLREAYLSSRGMEERELIDSFLKMALPGT 465
At LLLTVDGWLLEKKIASNDADLLRDMVWKKDRRIHDTYIDVKDKNERDAISAFLKLVSSPT 538
Ta SSGLHIAHIAAEMAPVAKVGGLADVISGLGKALQKKGHLVEIILPKYDCMQVDQVSNLKV 477
Os SSGLHIIHIAAEMAPVAKVGGLADVISGLGKALQKKGHLVEIILPKYDCMQNDQVNNLKV 484
Zm SSGLHIVHIAAEMAPVAKVGGLADVISGLGKALQKKGHLVEIILPKYDCMQHNQINNLKV 525
At SSGLYVVHIAAEMAPVAKVGGLGDVVAGLGKALQRKGHLVEIILPKYDCMQYDRVRDLRA 598
Ta LDVLVQSYFEGNMFNNKIWTGTVEGLPVYFIEPQHPAMFFSRAQYYGEHDDFKRFSYFSR 537
Os LDVVVQSYFEGNLFNNKIWTGTVEGLPVYFIEPQHPAKFFWRAQYYGEHDDFKRFAYFSR 544
Zm LDVVVKSYFEGNMFANKIWTGTVEGLPVYFIEPQHPGKFFWRAQYYGEHDDFKRFSYFSR 585
At LDTVVESYFDGKLYKNKIWIGTVEGLPVHFIEPQHPSKFFWRGQFYGEQDDFRRFSYFSR 658
Ta AALELLYQSGKKVDIIHCHDWQTAFVAPLYWDVYANLGFNSARICFTCHNFEYQGTAPAR 597
Os AALELLYQSQKKIDIIHCHDWQTAFVAPLYWEAYANLGFNSARICFTCHNFEYQGAAPAQ 604
Zm VALELLYQSGKKVDIIHCHDWQTAFVAPLYWDVYANLGFNSARICFTCHNFEYQGIAPAQ 645
At AALELLLQSGKKPDIIHCHDWQTAFVAPLYWDLYAPKGLDSARICFTCHNFEYQGTASAS 718
CC
152
Ta DLAWCGLDVEHLDRPDRMRDNSHG-RINAVKGAIVYSNIVTTVSPTYALEVR-SEGGRGL 655
Os DLACCGLDVQQLDREDRMRDNSHG-RINVVKGAIVYSNIVTTVSPTYALEVR-SEGGRGL 662
Zm DLAYCGLDVDHLDRPDRMRDNSHG-RINVVKGAVVYSNIVTTVSPTYAQEVR-SEGGRGL 703
At ELGSCGLDVNQLNRPDRMQDHSSGDRVNPVKGAIIFSNIVTTVSPTYAQEVRTAEGGKGL 778
Ta QDTLKVHSRKFLGILNGIDTDTWNPSTDRYLKVQYNAKDLQGKAANKAALREQLNLASAY 715
Os QDSLKLHSRKFVGILNGIDTDTWNPSTDRHLKVQYNANDLQGKAANKAALRKQLNLSSTN 722
Zm QDTLKVHSKKFVGILNGIDTDTWNPSTDRFLKVQYSANDLYGKSANKAALRKQLKLASTQ 763
At HSTLNFHSKKFIGILNGIDTDSWNPATDPFLKAQFNAKDLQGKEENKHALRKQLGLSSAE 838
Ta PSQPLVGCITRLVAQKGVHLIRRAIYKTAELGGQFVLLGSSPVPEIQREFEGIADHFQNN 775
Os ASQPLVGCITRLVPQKGVHLIRHAIYKTAELGGQFVLLGSSPVPHIQREFEGIADHFQNN 782
Zm ASQPLVGCITRLVPQKGVHLIRHAIYKITELGGQFVLLGSSPVQHIQREFEGIADQFQNN 823
At SRRPLVGCITRLVPQKGVHLIRHAIYRTLELGGQFVLLGSSPVPHIQREFEGIEQQFKSH 898
Ta NNIRLILKYDDALSHCIYAASDMFVVPSIFEPCGLTQMIAMRYGSVPIVRKTGGLNDSVF 835
Os NNIRLLLKYDDSLSHWIYAASDMFIVPSMFEPCGLTQMIAMRYGSVPIVRKTGGLNDSVF 842
Zm NNVRLLLKYDDALAHMIFAASDMFIVPSMFEPCGLTQMVAMRYGSVPVVRRTGGLNDSVF 883
At DHVRLLLKYDEALSHTIYAASDLFIIPSIFEPCGLTQMIAMRYGSIPIARKTGGLNDSVF 958
Ta DFDDETIPMEVRNGFTFVKADEQGLSSAMERAFNCYTRKPEVWKQLVQKDMTIDFSWDTS 895
Os DFDDETIPKELRNGFTFVHPDEKALSGAMERAFNYYNRKPEVWKQLVQKDMRIDFSWASS 902
Zm DLDDETIPMEVRNGFTFLKADEQDFGNALERAFNYYHRKPEVWKQLVQKDMKIDFSWDTS 943
At DIDDDTIPTQFQNGFTFQTADEQGFNYALERAFNHYKKDEEKWMRLVEKVMSIDFSWGSS 1018
Ta ASQYEDIYQKAVARARAVA--- 914
Os ASQYEDIYQRAVARARAAA--- 921
Zm VSQYEEIYQKTATRARAAA--- 962
At ATQYEELYTRSVSRARAVPNRT 1040
Figure 41 Amino acid sequence alignment of SSIV in different plant species
Ta- Triticum asetivum (GenBank DQ4004161) At- Arabidipsis thaliana
(GenBank FW3015601) Os- Oryza sativa (GenBank FB7025731) Zm- Zea mays (GenBank AAC197339) The epitope for the peptide specific anti-SSIV antibodies of maize is highlighted in red The coiled-coil domain (CC) and the
conserved catalytic domains in the Cndashterminal region (K-V-G-G-L and K-T-G-G-K) are shown in blue boxes
153
Figure 42 A schematic diagram showing the major domains found within the predicted amino acid sequence of SSIV in wheat endosperm The starch catalytic domain (GT-5) and glycosyltranferase domain (GT-1) characteristic of the SS
family are shown Predicted 14-3-3 recognition sites and the coiled-coil domains (blue boxes and CC respectively) as well as the two highly conserved KVGGL
and KTGGL domains are also shown (Leterrier et al 2008)
Although the involvement of SSIV in glucan chain length elongation is not clear
the growth rate in the mutant alleles of ss4 in Arabidopsis thaliana was
decreased without changing total SS activity (Roldan et al 2007) Further the
starch content was deceased by 35-40 in the mutant lines while the size of
silique number of seeds per silique and germination ratios remained unchanged
(Roldan et al 2007) Interestingly the total activity of starch phosphorylase
(SP) was increased by 14ndash2-fold in both cytosolic and plastidial forms in
Arabidopsis ssiv mutants (Roldan et al 2007) More importantly the
amyloseamylopectin ratio or the structure of the starch were not altered in the
ss4 mutants the starch granule surface area was increased by 15 times and by
4 times in ss4sp double mutants indicating the increase in granule size
(Planchot et al 2008) In contrast the number of granules per chloroplast
14-3-3 14-3-3
154
decreased to 2-3 in ss4 single mutants where as the wild-type contains
contained 4ndash5 starch granules per chloroplast Interestingly the double mutants
of ssivsp had 1-2 granules per chloroplast (Planchot et al 2008) These
observations suggested that the SSIV potentially interacts (either functionally or
physically) with SP and both are involved in the priming of the starch granule
(Planchot et al 2008 Roldan et al 2007) The mechanism of starch granule
initiation is largely unknown (DrsquoHulst et al 2010 DrsquoHulst and Merida 2012)
The homologous double mutants of starch synthases produced in
Arabidopsis thaliana (ss1ss4 ss2ss4 and ss3ss4) are helpful in understanding
the interactive role of SS in starch biosynthesis (Szydlowski et al 2009) Starch
accumulation deceased in ss1ss4 and ss2ss4 double mutants equal to the sum
of the decreased starch levels in their respective single mutant lines However
starch accumulation in the single mutants of ss4 and ss3 were recorded as
122 (Zhang et al 2005) and 62 (Rolden et al 2007) respectively compared
to their wild- types at the end of 12h light period However the double mutant
of ss3ss4 did not accumulate any measurable amounts of starch irrespective of
light conditions (Szydlowski et al 2009) Therefore the presence of either SSIII
or SSIV appears to be a crucial requirement in transient starch biosynthesis
(Szydlowski et al 2009) In addition the significant increase in the activity of SP
in the ss3ss4 double mutants suggested the existing of alternative SP-mediated
starch biosynthetic pathway using hexose phosphates as glycosyl donors
(Szydlowski et al 2009 Fettke et al 2010)
The investigations discussed in this chapter tested the hypothesis that
SSIV is involved in storage starch biosynthesis in maize amyloplasts and that
155
the enzyme is regulated by protein phosphorylation and protein-protein
interactions The cellular localization and biochemical analyses were performed
to characterize and understand the regulatory mechanism of the enzyme
Recent evidence from Arabidopsis thaliana suggested that SP and SSIV may
physically andor functionally interact and may be involved in priming the starch
granule The possible interactions of SSIV specifically with SP and with other
starch biosynthetic enzymes were tested in maize amyloplast stroma
156
42 Materials and Methods
421 Analysis of the localization of SSIV in the plastid
To investigate the localization of SSIV in the amyloplast amyloplasts were
isolated and the soluble and granule bound proteins and plastid envelop
membrane proteins were separated from 22 DAA (days after anthesis) old maize
endosperms as described earlier in chapter 2 The presence of SSIV and other
SS isoforms SSI SSII and SSIII in the amyloplast stroma and the granule was
determined by running the protein extracts on 10 SDS gels and the
immunoblotted proteins were identified using peptide-specific anti-maize
antibodies The purified SSIV antibody generated using the synthetic peptide
ANHRNRASIQRDRASASI from the first bleed serum developed in rabbit was used
after dilution by 1800 in 15 BSA (antibodies were purified as described in
chapter 2) The procedures for SDS-PAGE and immunoblot analysis were as
described in chapter 2
422 Determination of the protein expression of SSIV in developing
endosperm
The equal amounts of proteins from the amyloplast lysates extracted from
the maize kernels at 12 15 17 22 DAA were run on 10 SDS gels Following
the electrophoresis the immunoblots were probed with peptide specific SSIV
antibodies
157
423 Determination of SSIV catalytic activity by zymogram analysis
Zymogram analysis was performed to estimate the activity of SSIV and
other SS isoforms of amyloplast stroma following incubation of the lysates with
ATP or APase to respectively phosphorylate and dephosphorylate amyloplast
proteins
SS zymograms were carried out according to the methods described by
(Tetlow et al 2004) 90 μg of proteins were run in a well after gels were
prepared as native 5 (wv) polyacrylamide gels in 375 mM TRIS-HCl pH 88
and 10 mg of the α-amylase inhibitor Acarbose (Bayer lsquoPrandasersquo) and 03
(wv) rabbit liver glycogen (type III Sigma-Aldrich) The gel was run using
025M Tris 192 mM glycine running buffer without SDS at 120V for 15hr in the
cold room After electrophoresis the gel was incubated for 48ndash72 h in a buffer
containing 50 mM glycylglycine pH 90 100 mM (NH4)2SO4 20 mM DTT 5 mM
MgCl2 05 mg mL-1 BSA and 4 mM ADP-glucose
424 Substrate-affinity electrophoresis
Affinity electrophoresis was carried out as described earlier by Commuri
and Keeling (2001) using different glucan substrates at various concentrations
amylopectin glycogen and maltoheptaose (at 0 5 10 25 mgmL
concentrations) in the native gels Amyloplast lysates (22 DAA) were run on the
gel at a protein content of 30 microgmL per well The migration distances of specific
enzyme were measured after immunoblotting Affinity electrophoresis served as
a means of measuring protein-glucan interactions and the dissociation
constants (Kd) were calculated from the retardation of the electrophoretic
158
mobility of enzymeprotein by the substrate contained in the supporting
medium
425 Gel filtration chromatography (GPC)
GPC analysis was performed as described in Chapter 2 section 22243
426 Co-Immunoprecipitation of SSIV
In order to identify protein-protein interactions of SSIV and other starch
biosynthetic enzymes co-imunoprecipitation was performed with amyloplast
lysates of 22 DAA using the methods previously described in Chapter 2 section
222574 using peptide specific anti-SSIV antibodies
427 Phosphorylation of SSIV using -32P-ATP
Phosphorylation of SSIV was investigated by incubating 400 μL of
amyloplast lysate with 05 uCi of -32P-ATP in a final concentration of 1 mM ATP
on a rotator for an hour at 250C and then the SSIV was immunoprecipitated by
using SSIV specific antibodies bound to Protein-A sepharose beads following the
procedure described in section 424 in Chapter 2 Non-specifically bound
proteins were removed by washing the remaining pellet for eight times each
with 1 mL phosphate buffered saline (PBS) followed by three similar washes
with 10 mM HEPESKOH pH 75 buffer (at 100 g 1 min centrifugation)
Following washing the immunoprecipitated pellet was boiled in 2X SDS loading
buffer for 8 min and separated by SDS-PAGE Following electrophoresis proteins
in the gel were transferred to nitrocellulose membranes exposed to X-ray film
159
for two weeks at -800C The phosphorylation of SSIV was detected by alignment
of X-ray film with the developed immunoblot which was probed with anti-SSIV
specific antibodies
160
43 Results
431 Testing the specificity of peptide specific anti-SSIV antibodies
The SSIV isoform in maize is predicted to be 104 kDa based on its amino
acid sequence The SSIV-specific antibody (ANHRNRASIQRDRASASI) was
derived against amino acids located at position 55-72 at the N-terminal end of
full length amino acid sequence of maize SSIV (909 amino acids see figure 41)
(Accession number - EU990361) Immunoblots of the amyloplast lysates run on
SDS-PAGE were probed with purified SSIV antibodies and pre-immune serum to
detect the specificity of the purified antibodies in detecting SSIV (Fig 43A) The
purified anti-SSIV specific antibodies were subjected to a series of dilutions and
the optimal concentration of antibodies required to detect SSIV in amyloplast
lysate was 1800 dilution (Fig 43B)
432 Localization of SSIV
Localization of SSIV in maize amyloplast was investigated by
immunodetection using the peptide-specific antibodies to SSIV Analysis of the
proteins extracted from the wild-type amyloplast stroma and the loosely-bound
proteins from the starch granule at 22 DAA confirmed that SSIV is localized only
in the amyloplast stroma while SSI and SSII and in some cases SSIII can be
seen in both amyloplast stroma and as granule-associated proteins (Fig 44)
161
Figure 43 Immunoblots of amyloplst proteins probed with purified SSIV-specific antibodies (A) Purified anti-SSIV specific antibodies were diluted to
1800 11000 12000 and 15000 in 15 BSA to determine the optimal concentration of the antibodies required to detect SSIV (B)
MW MW MW MW
(A)
kDa
150
100
50
MW
(B)
162
Figure 44 Immunodetection of SSI SSII SSIII and SSIV in stroma and starch granules of wild-type maize amyloplasts at 22 DAA Amyloplast lysates (25 μg
proteins) were separated on 10 acrylamide gels electroblotted onto nitrocellulose membranes and developed with peptide-specific anti-maize antibodies The expected mass (predicted from the amino acid sequence) of
each protein is given below the respective immunoblot
433 Determination of the expression of SSIV in developing endosperm
Testing of equal amounts of proteins from the amyloplast lysates
extracted from the maize kernels at 12 15 17 22 DAA with the peptide specific
SSIV antibodies showed that the SSIV protein is expressed in the later stages of
endosperm development (Fig 45)
163
Figure 45 Immunodetection of SSIV at different stages of endosperm
development in maize wild-type amyloplasts Amyloplast lysates from 12 15 17 and 22 old endosperms were run (25 μg proteins per well) in SDS-PAGE and immunoblot was developed by the peptide specific anti-SSIV antibodies
434 Determination of the affinity of the SSIV in amyloplast lysates to
different α-glucan substrates
The affinity of SSIV in amyloplast lysates for α-glucans was established by
affinity electrophoresis (Fig 46A) The amyloplast lysates (approximately 30 μg
proteins) were subjected to native PAGE in the presence of different
concentrations (0 05 1 25 mgmL) of amylopectin glycogen and
maltoheptaose (see Fig 46A) The relative migration (Rm) and then dissociation
constant (Kd) of the SSIV were calculated from the plot of the graph developed
by 1Rm vs substrate concentration as described by Commuri and Keeling
(2001) (Fig 46B) The SSIV showed a relatively higher Kd value in glycogen
(25 mgmL) followed by maltoheptaose (15 mgmL) and the amylopectin (10
mgmL) (Fig 54B) (Table 41)
164
Figure 46A A representative western blot of the native zymogram gel showing
the mobility of SIIV in different glucan substrates used to determine the relative mobility of the SSIV in amyloplast lysates The relative mobility of SSIV was determined by the transferring the native zymogram to nitrocellulose
membranes and probing with anti-SSIV antibodies The mean relative mobility (Rm) was determined as the ratio of the migration of the activity band and the
migration of the dye from three different experiments
(A)
Amylopectin (mgmL) Maltoheptaose (mgmL) Glycogen (mgmL)
0 05 1 25 0 05 1 25 0 05 1 25
Amylopectin (mgmL) Maltoheptaose (mgmL) Glycogen (mgmL)
0 05 1 25 0 05 1 25 0 05 1 25
165
Figure 46B Plots of the reciprocal of the relative mobility (1Rm) of maize SSIV against the concentration of different glucan substrates The dissociation constant (Kd) of SSIV is shown as the intersect at the X-axis
y = 04885x + 12983
000
100
200
300
-3 -25 -2 -15 -1 -05 0 05 1 15 2 25 3
1R
m
Substrate Concentration (mgmL)
Glycogen
y = 10576x + 11474
000
200
400
600
-25 -2 -15 -1 -05 0 05 1 15 2 25
1R
m
Substrate Concentration (mgmL)
Amylopectin
y = 07772x + 11909
0
1
2
3
4
-25 -2 -15 -1 -05 0 05 1 15 2 25 3 35
1R
m
Substrate Concentration (mgmL)
Maltoheptaose
(B)
166
Table 41 Comparison of Kd values of maize SSIV (from present study) with SSI SSIIa and SP in different glucan substrates SSI SSIIa and SP values were
estimated by Commuri and Keeling (2001)
Glucan
Substrate
Kd values (mgmL)
SSI
SSIIa
SP
SSIV
Amylopectin Starch Glycogen
Maltoheptaose
02004
049001 -
-
024001
049001 -
-
002001
008001 -
-
10001 -
25002
1507
435 Investigating the regulation of SSIV by phosphorylation using -
32P-ATP
Possible phosphorylation of SSIV was investigated by pre-incubating
amyloplast lysates with -32P-ATP immunoprecipitating SSIV with peptide-
specific antibodies and analyzing the immunoblots by autoradiography Figure
45 shows the developed nitrocellulose membrane of immunoprecipitated SSIV
after treatment of amyloplast lysates with -32P-ATP (47A) and the
autoradiograph developed from the same nitrocellulose membrane (47B) The
immunoblot developed by anti-SSIV antibodies showed that the SSIV was
successfully immunoprecipitated no SSIV band was detected in the remaining
supernatant after the SSIV was immunoprecipitated (Fig 47A) However the
autoradiograph did not show any radioactivity corresponding to SSIV indicating
that SSIV was not phosphorylated under these conditions (Fig 47B) (Apendix
06 shows the predicted phosphorylation sites of maize SSIV)
167
Figure 47 SSIV from amyloplast lysates was immunoprecipitated following
incubation of amyloplast lysates with -32P-ATP 400 μL of amyloplast lysates
(approximately 1 mg mL) were treated with final concentration of 05 uCi of -32P-ATP + 1 mM ATP mixture on a rotator for in hour SSIV was immunoprecipitated by using anti-SSIV specific antibodies After the non-
specifically bound proteins were removed the pellet was boiled in 1X SDS loading buffer for 8 min and run the SDS-PAGE The proteins in the gel were
transferred to nitrocellulose membranes and developed with anti-SSIV antibodies (A) and the autoradiograph was developed from the same membrane after the proteins were transferred to the X-ray film for two weeks at -800C (B)
The phosphorylation of SSIV was tested by aligning the X-ray film with the developed immunoblot with anti-SSIV specific antibodies Arrows indicate the
location of SSIV
(A) (B)
168
436 Determination of the activity of ATP or APase treated SSIV on
zymogram
ATP-treated or APase-treated SS activity was measured qualitatively by
an in-gel activity assay Maize amyloplast lysates were pre-incubated with 1mM
ATP and SS activity was detected on zymogram and compared with the
untreated amyloplast lysates (Fig 48A) The SS activity banding profile in
untreated amyloplast lysates was changed equally in ATP or ATP+PI
(PI=phosphatase inhibitor) treated samples PI was added to inhibit the activity
of endogenously available protein phosphatases No difference in the banding
pattern was observed between untreated PI treated and APase treated samples
Immunoblot analysis of the SS activity zymogram for SSI and SSII
activities showed that the samples treated with ATP (with or without PI) became
more mobile and therefore showed less affinity to the given glycogen
concentration (03) than in untreated PI treated and APase treated samples
However no clear band corresponding to SSI was seen in APase treated
samples (Fig 48A) The peptide-specific SSIII antibodies did not recognize the
SSIII in any treatment (Fig 48B) The synthetic activity corresponding to SSIV
was reduced when treated with APase and the activities were higher in ATP
treated samples when compared with untreated controls (Fig 48B) However
the mobility of SSIV indicated by immunoblots was similar in all treatments (Fig
48B) SSIV in amyloplast lysates was removed by immunoprecipitation with
anti-SSIV specific antibodies SSIV immunoprecipitation was used in conjugation
with zymogram analysis to understand the mobility of the enzyme and the
changing of overall SS activity profile in the absence of SSIV The zymogram
169
lacking SSIV showed loss of a major activity band (as indicated by the arrow) on
the zymogram (Fig 48C) in addition to at least two other minor (unidentified)
bands of SS activity
170
Figure 48 Zymogram analysis of SS activity in amyloplast lysates of wild-type
maize endosperm at 22 DAA Amyloplast lysates were separated (90 μg protein per well) on a native 5 acrylamide gels containing 03 (wv) glycogen and
developed for 48 h at in a buffer containing 4 mM ADP-glucose SS activities were visualized by staining with Lugolrsquos solution Identical gels were electroblotted onto nitrocellulose membranes and probed with peptide specific
anti-SSI SSIIa (A) SSIII and SSIV peptide specific antibodies (B)
(B)
(A)
171
Figure 48C The activity of SS in the amyloplast lysates in the absence of
SSIV The native SSIV was removed by immunoprecipitation with anti-SSIV specific antibodies bound to Protein A-sepharose beads and the remaining supernatant was run with amyloplast lysates to compare the relative position of
SSIV and to detect the change of SS activity profile of other starch synthases (C)
437 Gel filtration chromatography of SSIV
The amyloplast lysates at 22 DAA from wild-type maize were treated with
ATP and APase and separated through a Superdex 200 10300GL gel permeation
column The fractions were subjected to SDS-PAGE followed by immunoblot
analysis to identify the SSIV eluted fractions SSIV eluted in fraction numbers
2930 in all treatments of amyloplast lysates Approximate molecular weight of
the fraction that SSIV eluted was determined by eluting the standard proteins
with known molecular weights from the same column which is approximately at
100 kDa (Fig 49)
1 2
1 Amyloplast lysates after removal of SSIV by immunoprecipitation
2 Amyloplast lysates with SSIV
(C)
172
Figure 49 Gel filtration chromatography analysis of SSIV in amyloplast lysates 450 μg of total protein in a volume of 500 microL from each treatment was
separated by size exclusion chromatography (GPC) through a Superdex 200 10300GL gel permeation column The fraction numbers from 16 to 41 were run on SDS-PAGE followed by immunoblot analysis using peptide specific anti SSIV
antibodies The SSIV bands are shown by the arrows at 104 kDa The column was calibrated by protein standards with known molecular weights and predicted
molecular weights of the fractions are indicated in boxes L= protein marker C=amyloplast lysates before loaded in the column Arrows indicate the location of SSIV
L 15 16 17 18 19 20 21 22 23 24 25 26 2 28 29 30 31 32 33 34 35 36 37 38 39 40 C L
440 kDa 232kDa
SSIV-Untreated
Control
SSIV- ATP
Treated
SSIV- APase
Treated
100kDa
kDa
150
100
75
150
100
75
150
100
75
Fraction Numbers
173
458 Detection of protein-protein interactions of SSIV by co-
immunoprecipitation
To investigate the protein-protein interaction of SSIV with other starch
biosynthetic enzymes the co-immunoprecipitation was performed with maize
wild-type amyloplast lysates at 22 DAA The SSIV antibodies (30 mgmL) were
used to immunoprecipitate the native SSIV protein from amyloplast lysates (1
mL) using Protein-A Sepharose beads Figure 410 shows immunoblots of
immunoprecipitated SSIV probed with SSIV (Fig 410A) and other peptide-
specific starch biosynthetic enzymes antibodies of SSI SSIIa SSIII SBEI
SBEIIb ISOI and SP (Fig 410B)
SSIV in amyloplast lysates was completely immunoprecipitated since no
SSIV was detected in the remaining supernatant (Fig 410A) There is no non-
specific binding to the beads and only the purified SSIV antibodies were bound
to the beads since no band was observed in the immunoprecipitation carried out
by using pre-immune serum (Fig 410A) When the immunoblots were incubated
with SSI SSII and SSIII no bands were detected from SSIV
immunoprecipitated beads (Lane 1 in Fig 410B) and the enzyme levels showed
in supernatants remained same after the pull down Similarly SSIV
immunoblots probed with SBEI SBEIIb and ISOI antibodies showed no bands
(Fig 410B) The SSIV immunoblot probed with anti-SP specific antibodies
showed no clear interaction of SSIV with SP (Fig 410B) The faint band
observed in SSIV-pulldown beads may be from non-specific bounding of SP to
the beads Therefore no clear protein-protein interactions were detected
recorded between SSIV and other starch biosynthetic enzymes tested under
174
these conditions (Fig 410) In addition co-immunoprecipitation experiments
were performed with amyloplast lysates treated with 1 mM ATP or 30U APase
No interactions between SSIV and other starch biosynthetic enzymes were
detected but a weak interaction was detected with SP when amyloplast lysates
were treated with ATP (Fig 411) (Appendix 07 shows the Co-
immunoprecipitation of stromal proteins from wild-type maize amyloplasts using
peptide specific anti-SBEIIb antibodies to investigate the protein-protein
interactions of SBEIIb with SSIV and SP No interaction was detected between
SBEIIa and SSIV or SBEIIa and SP)
175
Figure 410A Immunoprecipitation of stromal SSIV from wild-type maize amyloplasts using peptide specific anti-SSIV antibodies to investigate the
protein-protein interactions 1 ml amyloplast lysates (1 mgmL) prepared from wild-type maize endosperm at 22 DAA were incubated with peptide-specific anti-
SSIV antibodies (30 mgmL final concentration) at room temperature for 1 hr and then immunoprecipitated with Protein-A-Sepharose beads The washed Protein-A-Sepharose-antibody-antigen complexes were boiled in 200 μL 1XSDS-
loading buffer and 30 μL was loaded onto 10 SDS gels Immunoblotted membrane was developed with maize anti-SSIV antisera (A) Arrow indicates
the immunoprecipitation of SSIV using SSIV specific antibodies The IgG is approximately showed at 50 kDa as a large thick band
(A)
176
Figure 410B Co-Immunoprecipitation of of stromal proteins from wild-type maize amyloplasts using peptide specific anti-SSIV antibodies to investigate the
protein-protein interactions SSIV in maize amyloplast lysates was immunoprecipitated by peptide-specific anti-SSIV antibodies (30 mgmL final concentration) with Protein-A-Sepharose beads (Fig 410A) and the washed
Protein-A-Sepharose-antibody-antigen complexes were boiled in 200 μL 1XSDS-loading buffer and 30 μL was loaded onto 10 SDS gels Immunoblotted
membranes were developed with various anti-maize antisera as shown Arrow indicates the expected position of different starch biosynthetic enzymes in the Protein-A-Sepharose-antibody-antigen complexes The MW of the enzymes are
SSI at 74 kDa SSIIa at 85 kDa SBEI at 80 kDa SBEIIb at 85 kDa SP at 112 kDa and Iso-1 at 80 kDa The IgG is approximately showed at 50 kDa as a
large thick band
(B)
177
Figure 411 Co-immunoprecipitation of ATP or APase treated stromal proteins
from wild-type maize amyloplasts using peptide specific anti-SSIV antibodies to investigate the protein-protein interactions of SSIV with other starch
biosynthetic enzymes 1 ml amyloplast lysates (1 mgmL) prepared from wild-type maize endosperm at 22 DAA were incubated by adding 1mM ATP and APase
(25 unitml) for 1 hr and incubated further with peptide-specific anti-SSIV antibodies (30 mgmL final concentration) at room temperature for 1 hr The SSIV was immunoprecipitated with Protein-A-Sepharose beads The washed
Protein-A-Sepharose-antibody-antigen complexes were boiled in 200 μL 1XSDS-loading buffer and 30 μL was loaded onto 10 SDS gels Immunoblotted
membranes were developed with various anti-maize antisera as shown Arrows indicate the immunoprecipitation of SSIV using SSIV specific antibodies and the enzymes at SSI at 74 kDa SSIIa at 85 kDa SBEI at 80 kDa SBEIIb at 85 kDa
and SP at 112 kDa The IgG is seen at 50 kDa as a large thick band
Anti- SSIV
Anti- SSI
Anti- SSII
Anti- SBEI
Anti- SBEIIb
Anti- SP
L 1 2 3 4 5 6 7 8
L 1 2 3 4 5 6 7 8
L 1 2 3 4 5 6 7 8
L 1 2 3 4 5 6 7 8
L 1 2 3 4 5 6 7 8
L 1 2 3 4 5 6 7 8 kDa150
100
75
kDa150
100
75
kDa150
100
75
kDa150
100
75
kDa150
100
75
kDa150
100
75
L Protein marker
1 SSIV Co-IP+ATP-treated amyloplast lysates in beads
2 SSIV Preimmune Co-IP+ATP in beads
3 SSIV Co-IP+ATP supernatant
4 SSIV Co-IP+APase-treated amyloplast lysates in beads
5 SSIV Preimmune Co-IP+APase in beads
6 ATP treated amyloplast lysates (No SSIV antibody) in beads
7 APase treated amyloplast lysates (No SSIV antibody) in beads
8 Amyloplast lysate
178
4 4 Discussion
Maize SSIV (Accession number ndash EU5990361) is the most recently
identified isoform of starch synthases and 104 kDa in size (Yan et al 2008)
Among the isoforms of starch synthases (SS) GBSS is essential for amylose
synthesis and is exclusively bound to the starch granule where as SSI SSII and
SSIII isoforms are found to be responsible for amylopectin biosynthesis (Ball
and Morell 2003) All isoforms are unique and probably play a distinct role in
the synthesis of amylopectin SSI is responsible for producing DP 8-12 glucan
chains (Nakamura 2002) SSII and SSIII respectively produce DP=12-25
(Zhang et al 2004 Morell et al 2003) and DP 25-40 or greater glucan chains in
amylopectin (Tomlinson and Denyer 2003) However the biochemical role of
SSIV in storage starch biosynthesis remains unclear The investigations
discussed in Chapter 4 are based on the hypotheses that SSIV in maize
regulates starch synthesis through the interactions between other starch
synthesis related enzymes by the formation of phosphorylation-dependent
protein complexes This study also tested the hypothesis that the SSIV and SP
proteins interact To investigate the role and regulation of SSIV its localization
and various biochemical characterizations were carried out
Immunodetection of SSIV indicated that the enzyme is exclusively
localized in the amyloplast stroma of the wild-type maize endosperm as similarly
observed in wheat endosperm by Leterrier et al (2008) (Fig 44) SSIV was not
detected as a granule bound protein in the starch granules SSI and SSIIa
isoforms are found both in the stroma and as granule bound proteins (Grimaud
et al 2008 Mu-foster et al 1996 Rahman et al 1995) However the
179
antibodies were not able to detect the SSIII in the granule The granule
association of the SSIV was investigated mostly in the Arabidopsis thaliana
chloroplast where transient starch is synthesized (Roldan et al 2007 Szydlowski
et al 2009) SSIV is thought to be a vital requirement to determine the correct
number of starch granules found in chloroplasts of Arabidopsis leaves and has
been suggested to be involved in granule initiation (Szydlowski et al 2009
Planchot et al 2008 Roldan et al 2007 DrsquoHulst and Merida 2012) However
loss of SSIV does not completely prevent starch granule formation in
chloroplasts suggesting that other factors may be involved in initiation process
other than SSIV Mutation in both SSIV and SSIII completely prevent starch
biosynthesis indicating a mutual requirement for SSIII and SSIV in starch
biosynthesis in the chloroplasts (Szydlowski et al 2009) To investigate the
process of granule initiation by SSIV the specific localization of SSIV in the
chloroplast was investigated by the florescence microscopic techniques
(Szydlowski et al 2009) The results indicated that the SSIV has a plastidial
localization and is present among the grana in the central part of the
chloroplast as well as in the grana-free peripheral part of the chloroplast
Further SSIV is not uniformly distributed within the stroma but was mainly
located in specific regions at the boundary of starch granules (Szydlowski et al
2009) Immunoblot analysis indicated that no SSIV was found inside the
granules in Arabidopsis leaves (Szydlowski et al 2009)
In this study SSIV was shown to be expressed at later stages of
endosperm development (Fig 45) Immunodetection of proteins from
amyloplast lysates extracted from maize kernels at 12 15 17 22 DAA showed
180
that SSIV is expressed at greater levels in the later stage of endosperm
development (Fig 45) In rice endosperm a greater level of SSIV-1 expression
was found after 14 DAP (Dian et al 2005) SSIIa and SSIII are expressed in
early stage (8 DAA) (Dian et al 2005) and SSI in maize is expressed in the
middle stage (16-20 DAA) of endosperm development (Cao et al 1999) and
studies in other plants indicate that different SS isoforms are expressed at
different developmental stages (Dian et al 2005) In chapter 2 it was reported
that SP is actively expressed thoughout the various developmental stages in
maize endosperm Since the later stage of endosperm development shows
higher levels of SSIV expression SSIV may have other catalytic andor
regulatory roles in starch biosynthesis other than the proposed function of
granule initiation This idea is supported by the sequence analysis of SSIV in
maize endosperm The highly conserved C-terminal region of SSs has the
catalytic and the starch-binding domains (Cao et al 1999) (Fig 15) The C-
terminal domain of SSIV is conserved with other SS isoforms but the N-terminal
domain of SSIV protein is unique in cereal endosperms (Fig 15) SSIV in wheat
(at 1-405 specific region) has two coiled-coil domains which are thought to be
involved in protein-protein interactions (Leterrier et al 2008 Jody et al 2004)
The 14-3-3-proteins are commonly linked to binding with various signaling
proteins such as kinases and phosphatases (Comparot et al 2003) and the N-
terminus of SSIV in wheat has recognition sites for 14-3-3 proteins (Leterrier et
al 2008) which are conserved in other SS isoforms in barley (Alexander and
Morris 2006) and Arabidopsis (Sehnke et al 2001) Arabidopsis chloroplast
SSIII contains a conserved phosphoserine binding motif (RYGSIP) identifying it
181
as a putative target for binding with 14-3-3 proteins (Sehnke et al 2001)
Moreover GBSSI SSI SSII and SBEIIa were shown to interact with 14-3-3
proteins in wheat amyloplasts (Alexander and Morris 2006)
Determination of the affinity of the SSs in amyloplast lysates for different
α-glucan substrates was important characteristic to discriminate between the
different SS isoforms (Commuri and Keeling 2001) The substrate-enzyme
dissociation constant (Kd) is inversely proportional to the affinity of the enzyme
to the substrate The affinity of SSIV towards different glucan substrates in
different concentrations was evaluated in terms of relative migration (Rm) and
the dissociation constant (Kd) (Fig 46AB) The results indicated that the SSIV
has relatively higher affinity to amylopectin (Kd=10 mgml) compared to
glycogen (Kd=25 mgml) and maltoheptaose (Kd=15 mgml) (Fig 46B) In
previous studies the affinity of SSI and SSII was found to be higher in
amylopectin compared to starch (Kd=02 and 049 mgml respectively)
(Commuri and Keeling 2001) (Table 41) Deletion of the N-terminal arm of
maize SSI did not affect the Kd value suggesting that the starch-affnity domain
of SSI is probably associated with or close to the catalytic domain at the C-
terminus (Cao et al 1999 Leterrier et al 2008) SSI and SSII elongate different
lengths of glucan chains but share similar affinities towards amylopectin (Cao et
al 1999) Affinity of SSIII (Km=428 mM) and SSIV (Km=096 mM) for ADP-
glucose was varied in Arabidopsis chloroplasts suggesting that the substrate
binding capacity may be different in different isoforms of SSs (Valdez et al
2008) Phylogenic analysis showed that the SSI SSII and GBSSI have distinct
evolutionary origins compared with SSIIIs and SSIV which have similar
182
evolutionary origins (Leterrier et al 2008) However the valine residue in the
common K-V-G-G-L substrate binding domain in evolutionary related SSIII and
SSIV may be different in primersubstrate binding capacities than the other SS
isoforms (Leterrier et al 2008) A slight reduction in the number of shorter
glucan chains (DP 7-10) in the starch of Arabidopsis SSIV mutants compared to
the wild-type indicated that SSIV may involved in producing shorter glucan
chains (Roldan et al 2007)
Protein phosphorylation has been shown to play an important role in the
regulation of enzymes involved in storage starch biosynthesis (Liu et al 2009
Hennen ndashBierwagen et al 2008 Tetlow et al 2008 Tetlow et al 2004) The
effect of protein phosphorylation on the activity of SSIV was investigated by
native affinity zymograms (Fig 48AB) Zymogram analysis of the activity of
SSIV indicated that the mobility of the protein was not altered following
treatment with ATP or APase However the activity of SSIV (based on
zymogram analysis) was reduced when treated with APase compared to ATP-
treated and untreated samples (Fig 48B) SSIV was not found to be
phosphorylated when the protein was tested with pre-incubated amyloplast
lysates with -32P-ATP (Fig 47) Therefore the reduction in the activity by APase
treatment may be due to the indirect effect of dephosphorylation of another
protein(s) that causes alterations in protein folding or has other regulatory
effects on SSIV Protein phosphorylation was identified as a mechanism for
regulating starch biosynthesis in developing wheat endosperm by Tetlow et al
(2004) and starch branching enzymes SBEI SBEIIa and SBEIIb and also SP in
amyloplast stroma were phosphorylated and further involved in protein-protein
183
interactions forming phosphorylation-dependent multi sub-unit complexes In
wheat endosperm amyloplasts protein phosphorylation enhanced the activity of
SBEIIb whereas dephosphorylation using alkaline phosphatase (APase) reduced
its catalytic activity (Tetlow et al 2004) The granule bound SS isoform of SSIIa
was also found to be phosphorylated (Tetlow et al 2004) In maize amyloplast
stroma two functional protein complexes one containing SSI SSII and another
containing SSII SSIII SBEIIa and SBEIIb were identified confirming the
phosphorylation-dependent physical interactions between SSs and SBEs
(Hennen ndashBierwagen et al 2008 Liu et al 2009) In zymogram analysis (Fig
48AB) SSI and SSII had less mobility in the gel than SSIV and formed dense
activity band in ATP-treated samples which could be due to the formation of
protein complexes In wheat and maize endosperms SSIIa can be
phosphorylated and a high molecular weight functional protein complex
consisting of SS isoforms (SSI SSIIa SSIII) and SBEs (SBEIIa and SBEIIb)
formed which showed higher affinity towards glucan substrate than the
respective monomers (Liu et al 2009 Hennen-Bierwagen et al 2008 Tetlow et
al 2008) GPC analysis showed no difference in the elution of SSIV when
amyloplast lysates were treated with ATP or APase (compared to untreated
samples) and SSIV eluted in fractions suggestive of a monomeric protein (Fig
49)
Mutant analysis in Arabidopsis suggests that SSIV in chloroplasts is
involved in starch granule formation since distruption of this enzyme resulted in
lower numbers of starch granules per chloroplast with increased granule sizes
(Roland et al 2008 Planchot et al 2008) This work suggested a possibility of a
184
functional or physical interaction between SP and SSIV (Roland et al 2008
Planchot et al 2008) In co-immunoprecipitation experiments amyloplast
lysates treated with 1 mM ATP detected interaction between SSIV and SP (Fig
411) Since SSIV was not phosphorylated by ATP under given experimental
conditions (Fig 47) phosphorylation of SP may be required to drive this
interaction (Fig 411) No protein-protein interaction was found between SSIV
and SSI SSIIa SSIII SBEI SBEIIb or ISOI in amyloplast lysates under these
experimental conditions (Fig 410B)
Recent work on the investigation of transient starch biosynthesis in
Arabidopsis thaliana suggests that SP and SSIV may interact and may be
involved in priming the starch granule (Roldan et al 2007 Planchot et al
2008 (Szydlowski et al 2009 Zhang et al 2005) The presence of either SSIII
or SSIV is recognized as a vital requirement in producing transient starches
(Szydlowski et al 2009) However given the expression of SSIV throughout
endosperm development it is possible that SSIV also plays a role in starch
biosynthesis despite its lack of interaction with other major SSs or SBEs SSIV
may be involved in protein-protein interactions with proteins which we could not
detect by co-immunoprecipitaion
185
General Discussion
The aim of the investigations presented in this thesis were to test the
hypothesis that the plastidial form of starch phosphorylase (SP) in cereal
endosperm is involved in starch synthesis by its direct interaction with other
enzymes of the pathway This study also tested the hypothesis that these
protein-protein interactions are regulated by protein phosphorylation A
biochemical approach was employed in order to address these questions In this
study maize was used as an example of a cereal maize is a widely grown crop
in OntarioNorth America and its endosperm produces high yields of starch
Maize has been used as a model plant in many starch biosynthetic studies and
efficient extraction procedures of amyloplasts and peptide-specific antibodies of
major starch biosynthetic enzymes of maize have been developed by our
laboratory
SP is the second most abundant enzyme present in maize amyloplasts
next to SBEIIb (Yu et al 2001) In the localization analysis SP is found only in
the amyloplast stroma of the wild-type maize endosperm (section 231 in the
thesis and Yu et al 2001) which was similarly observed in wild-type wheat
(Tetlow et al 2004) and rice (Satoh et al 2008) amyloplasts Interestingly the
ae- mutant of maize endosperm lacking SBEIIb in the plastid SP is not only
found in the stroma but also in the starch granule as a granule-bound protein
thought to be a result of its association within a multi sub-unit protein complex
formed by interaction with other starch biosynthetic enzymes (Liu et al 2009
Grimaud et al 2008) Further in the amyloplast stroma of the same ae- mutant
SP was shown to form larger multi sub-unit complexes with SBEI SBEIIa SSI
186
and SSIIa (Liu et al 2009) In the ae- mutant lacking SBEIIb increased
amounts of granule bound SBEI SBEIIa SSIII and SP are found without
affecting SSI or SSIIa (Grimaud et al 2008) These observations suggest a
functional role for SP in starch biosynthesis at least in the absence of SBEIIb It
was suggested that the presence of SP in the amyloplast stroma could
compensate for the activity of missing isoforms of major starch biosynthetic
enzyme (SBEIIb) in the ae- mutant (Liu et al 2009) In wild-type maize SP is
not bound to the granule but closely associated with the granule surfaces as are
some other enzymes eg SSI SBEI and SBEIIb (Fig 22) In contrast SSII was
comparatively abundant at the granule surface and very little of this enzyme is
detected in the stroma Recent evidence suggests that SSIIa is a central
component of the trimeric protein complex involved in amylopectin cluster
synthesis and directs it self and SSI and SBEIIb into the starch granule (Liu et
al 2012) As Tickle et al (2009) suggested in wheat amyloplasts SP could act
directly on the surface of the starch granule in a degradative manner where SP
modifies the granule structure in a phosphorolytic manner to produce G-1-P
which can be recycled back to produce starch via AGPase However more
investigations are required to analyze this hypothesis
In the wild-type maize amyloplast SP remains active in the synthetic
direction throughout the various developmental stages observed from 12 to 24
DAA (days after anthesis) in maize amyloplast (Chapter 2 section 232) This
observation was parallel to the observations in other storage starch producing
plants such as in wheat rice and in potato tubers suggesting that the SP has a
certain involvement in the starch synthesis process in plants (Tickle et al 2009
187
Satoh et al 2008 Schupp and Ziegler 2004 Yu et al 2001 Brisson et al
1989 Tsai and Nelson 1968) despite earlier suggestions that SP had a
primarily degradative role (Preiss 1982 Preiss 1984) Early studies of starch
synthesis suggested that SP was the enzyme responsible for glucan elongation
(Leloir 1964) However the fact that α-glucan phosphorylase (EC 2411)
found in animals fungi and prokaryotes plays a major role in glucan catabolism
(Alonso-Casajuacutes et al 2006 Ball and Morell 2003 Newgard et al 1989 Preiss
1984) led many researchers to believe that SP had an essentially degradative
role in plant cells In rice endosperm zymogram analysis of mutants lacking SP
showed no change in the activities of DBE isofoms (isoamylase and pullulanase)
SBE isoforms (SBEI SBEIIa and SBEIIb) and SS isoforms (SSI and SSIIIa) but
a reduction in total starch content was observed in the rice endosperm forming a
shrunken phenotype (Satoh et al 2008) The starch content per grain in
mutants lacking SP was even less than in the shrunken 2 mutants of rice
lacking the AGPase large subunit (Satoh et al 2008) Mutants of rice
endosperms lacking SP grown at 300C produced about 6 of the shrunken
phenotypes the starch content was similar in the wild-type Percentages of
shrunken phenotype was increased in SP mutant plants grown at 250C and 200C
by 35-39 and 66 respectively with a severe reduction in starch
accumulation suggesting that SP may play an important role in starch
biosynthesis at fluctuating andor adverse temperature conditions (Satoh et al
2008) Further the reduced starch content produced by mutants lacking SP and
the fact that SP is actively expressed in early stages of endosperm development
188
in rice endosperm suggest that SP is essential for the early steps of starch
biosynthesis in rice endosperm (Satoh et al 2008)
Peptide specific anti-SP antibodies recognized the plastidial SP in
amyloplasts but not in chloroplasts This may be due to reduced levels of SP in
chloroplasts or the chloroplastic SP may have different amino acid sequences in
the region where epitopes were designed (Chapter 2 Fig 21) In rice mutants
lacking plastidial SP the endosperm had severely reduced levels of starch and
had a shrunken phenotype (Satoh et al 2008) and in Arabidopsis leaves lacking
SP in chloroplasts no significant change in the total accumulation of starch was
observed compared to their wild-types (Zeeman et al 2004) suggesting a
divergent role of plastidial SP present in storage starch biosynthesis compared
to transient starch biosynthesis in chloroplasts
Recent research confirmed that SP in cereal endosperms is regulated by
protein phosphorylation as similarly observed in some other isoforms of the
major starch biosynthetic enzymes (Liu et al 2009 Pollack 2009 Hennen-
Bierwagen et al 2008 Grimaud et al 2008 Tetlow et al 2008 Tetlow et al
2004) Phosphorylation of SP may promote the formation of protein-protein
interactions (Liu et al 2009 Hennen-Bierwagen et al 2008 Grimaud et al
2008 Tetlow et al 2004) SP in wheat endosperm was shown to be involved in
the formation of protein complexes with SBEI and SBEIIb (Tetlow et al 2004)
From the research presented in this thesis the mobility of SP on phosphate
affinity SDS-PAGE using Phos-TagTM ligand-acrylamide gel showed no alteration
following treatment in ATP compared to untreated SP in the SDS-PAGE gel
(Chapter 2 Fig 26) Treatment of amyloplasts with 1 mM ATP [under
189
conditions previously determined to cause phosphorylation of SP by Pollack
(2009)] or APase (known to cause non-specific protein dephosphorylation) did
not alter the catalytic activity of SP (Chapter 2 Fig 25) Phosphorylation of SP
therefore may have a role in complex formation either with other enzymes of
starch synthesis (Chapter 3 section 334 and Chapter 4 section 458) or in the
formation of SP multimers but does not appear to play a role in regulating its
catalytic activity
In the present study GPC analysis confirmed that the SP exists in the
amyloplast stroma mainly as tetrameric and dimeric forms throughout the
developmental stages (both multimeric states were observed at 15-35 DAA) in
maize endosperm (Fig 28) These conformational structures of SP are found to
be as a natural molecular characteristic of SP which has previously been
observed in higher plants (Liu et al 2009 Mu et al 2001 Brisson et al 1989)
and the dimeric forms are observed in bacteria (Dauvillee et al 2006) and yeast
(Tanabe et al 1987) In the GPC analysis the elution profile of the ATP-treated
and APase treated native SP did not drastically change from the untreated
amyloplast lysates (Fig 28) suggesting that the formation of the homodimeric
or homotetrameric forms of SP is probably not controlled by protein
phosphorylation (Chapter 2 Fig 28)
It was previously reported that SP from wheat endosperm amyloplasts
formed protein complexes with SBEI and SBEIIb in a phosphorylation-dependent
manner (Tetlow et al 2004) In the maize ae- mutant lacking SBEIIb SP was
shown to interact with different proteins The complex in ae- contained SSI
SSIIa and SBEI and SP In this complex it was suggested SBEI and SP in some
190
way compliment the loss of SBEIIb in the mutant (Liu et al 2009) In addition
SP which is part of the novel protein complex was found as a granule-bound
protein reinforcing the fact that protein complex components become granule
bound by an as yet unknown mechanism (Liu et al 2009 Grimaud et al 2008)
The multimeric status of the SP in the wild-type wheat endosperm complex and
the complex in ae- mutant endosperm is not known
In this study peptide specific anti-maize SP antibodies were used to
immunoprecipitate the native SP from the wild-type maize amyloplast stroma
using Protein-A Sepharose beads to investigate possible protein-protein
interactions (Chapter 2 section 236) It was not possible to immunoprecipitate
the native SP using the Protein-A Sepharose beads (Fig 210) and consequently
we were unable to employ the antibodies in immunoprecipitation and co-
immunoprecipitation experiments The reason for the inability of the peptide-
specific antibodies to recognize the native protein is unclear but it is possible
that the native SP in someway shields the epitope irrespective of the multimeric
state of the protein Therefore an S-tagged recombinant SP was developed by
over expressing the full length mRNA sequence (3053 bp) of plastidial maize SP
in Artic Express Ecoli cells after cloning in pET29a expression vectors (Chapter
3)
GPC was a useful tool for separating the amyloplast lysates or cell
extracts and in identification of major starch biosynthetic enzymes as monomers
or in complexes in fractionated extracts with predicted molecular weights
(Hennen-Bierwagen et al 2008 Tetlow et al 2208 Liu et al 2009)
Fractionation of recombinant SP extracts by GPC partially purified the
191
recombinant SP and enabled us to identify different multimeric forms of
recombinant SP (Fig 39A) Greater amounts of recombinant SP was aggregated
(2000 kDa) and found to be active including tetrameric dimeric and
monomeric forms of SP (Fig 39BC) Dimeric and tetrameric forms of active
recombinant S-tagged SP separated by GPC were immobilized by S-Protein
Agarose beads and used as affinity ligands to isolate and detect amyloplast
proteins which interact with SP (Fig 310) The various pull down assays that
were carried out with recombinant SP and amyloplast lysates indicated that
certain starch biosynthetic enzymes specifically interacted with the dimeric and
tetrameric forms of SP in a phosphorylation-dependent manner (Figs 312
313) Many of the protein-protein interactions previously observed in cereal
endosperm amyloplasts have also been shown to be phosphorylation dependent
(Liu et al 2009 Grimaud et al 2008 Hennen-Bierwagen et al 2008 Tetlow et
al 2008 Tetlow et al 2004) SBEI directly interacted with both tetrameric and
dimeric forms of SP and the SBEIIb interacted only with the dimeric forms of SP
when plastid lysates were pre-treated with 1 mM ATP Weak interactions
between SSIIa and SP were observed unlike the SBE-SP interactions no
interactions between SP and SSIIa have been observed previously Unlike the
SP-SBE interactiions previous experiments involving immunoprecipitation of
SSIIa have not detected SP as an interacting partner The ATP-dependence of
some of the protein-protein interactions suggest a phosphorylation dependent
mechanism of complex assembly In other complexes studied some of the
components are directly phosphorylated (Liu et al 2009) Other than the SP
previous research had already confirmed that SSIIa SBEI and SBEIIb are
192
regulated by protein phosphorylation (Liu et al 2009 Tetlow et al 2008 Tetlow
et al 2004)
Glucan phosphorylases found in both prokaryotic and eukaryotic systems
exist as dimers or tetramers of identical subunits (Dauvillee et al 2006 Mu et
al 2001 Brisson et al 1989 Tanabe et al 1987) Both dimeric and tetrameric
configurations of SP have been observed in maize amyloplasts lysates (Mu et al
2201 Liu et al 2009) In addition to SP SBEIIa and SBEIIb have been found to
be associated as homodimers (Tetlow et al 2008) However based on the
elution profiles from GPC analysis it was not clear that the interactions found
between the homodimeric forms of SP were with monomers or homodimeric
forms of SBEIIb Although the precise roles of the various protein-protein
interactions in amyloplasts is not clear it is possible that some of the
interactions with SP and other enzymes regulate SP activity by controlling the
multimeric status of the protein Different multimeric states of SP may have
variable affinities for other proteins which may be controlled and regulated by
protein phosphorylation The relative competition of different multimeric forms
of SP and other proteins for each other is an area for future study For example
homodimeric forms of SBEIIb interacting with SP may prevent the interactions
between the tetrameric forms of SP
The protein-protein interactions is the fact that may enzymes of the
pathway are differentially expressed throughout endosperm development In
maize endosperm SSIIa SSIII and SBEIIa are expressed in early stages of
development (approximately 8-15 DAA) and SSI SSIIb and SBEIIb are
expressed in the middle stage (approximately 16-24 DAA) and GBBSSI SSIV
193
and SBE1 are expressed at the later stage (over 24 DAA) of the grain filling (Liu
et al 2009 Zhang et al 2004 Mu et al 2001 Mu-Forster et al 1996)
As discussed in previous studies SP has various potential functions in
starch biosynthesis SP showed a higher capacity to synthesize longer linear
glucans from small MOS than SSIIa (Satoh et al 2008) A possible function of
SP was suggested by Nakamura et al (2012) and Satoh et al (2008) based on
the lsquostarch trimming modelrsquo (Ball and Morell 2003) whereby small malto
dextrins produced by the activity of DBE provide a substrate for SP to produce
linear glucan chains which in turn serve as the substrates for SBE to form
branched glucans in the starch initiation process
Functional interactions between SP and SBE isoforms were observed in
rice endosperm Purified SP from rice endosperm synthesized glucans from G-1-
P in the presence of SBE without any exogenous glucan primer and glucan
production was higher when SBEI was present compared to SBEIIa or SBEIIb
(Nakamura et al 2012) Activities of SP and SBE were dependent on the mutual
availability SP and SBE and showed mutual capacities for chain elongation and
chain branching (Nakamura et al 2012) These observations further support the
function of SP proposed by Satoh et al (2008) In contrast according to the
proposed functions of SP suggested by Tickle et al (2009) SP may play a
degradative role by directly acting on the starch granule to produce G-1-P or
may degrade the MOS which are produced by DBE reaction to produce G-1-P
and supplying the substrate for AGPase for starch biosynthesis The presence of
catalytically active SP thoughout the grain filling period of maize endosperm
and the interaction of different multimeric forms of SP with SBE insoforms
194
support a synthetic role for SP in starch biosynthesis in maize endosperm as
suggested by Satoh et al (2008) and Nakamura et al (2012) in rice Low G-1-P
concentrations and high PiG-1-P ratios are considered as the controlling
mechanism of SP activity in glucan synthesis (Tiessen et al 2011 Schupp and
Ziegler 2004 Mu et al 2001 Matheson and Richardson 1978) Plastidial and
cytosolic SP activities in degradative direction were reduced by 80 and 20
respectively when Pi was added in vitro (Mu et al 2001) suggesting that Pi
regulates degradative activity of plastidial SP more than cytosolic SP Low levels
of G-1-P and a 50-fold excess of Pi in vitro were able to sustain the SP
biosynthetic reaction (Hwang et al 2010) suggesting that plastidial SP
preferentially carries out starch biosynthesis over degradation of starch
The leaves of Arabidopsis ss4 mutants (where transient starch is
synthesized) showed reductions in granule number and increased granule size
(14-2 fold) (Roldan et al 2007) and the double mutants of ss4 and sp further
increased the granule size by 4-fold (Planchot et al 2008) compared with the
wild-type plants suggesting the possibility that SSIV and SP may form
functional protein-protein interactions and are in some way involved in granule
initiation in chloroplasts One of the major hypotheses tested in the study was to
investigate the possible interactions between SSIV and SP In co-
immunoprecipitation experiments conducted by using peptide-specific anti-SSIV
antibodies in ATP-treated amyloplasts lysates SP weakly interacted with SSIV
(Chapter 4 section 4 section 48) Since there was no evidence for SSIV
phosphorylation (Chapter 4 section 45) the ATP-dependent interaction
observed may be due to phosphorylation of SP or other as yet unidentified
195
factors Since the reciprocal interactions using S-tagged recombinant SP did not
show any interactions with SSIV the results with the SSIV co-
immunoprecipitation experiment should be treated with caution It is possible
that SP and SSIV interact weakly andor transiently in vivo and under these
experimental conditions the interaction is not observed consistently In the S-
tagged SP studies the total protein (05 mgmL) of the amyloplast lysates were
comparatively lower than in the co-immunoprecipitation analysis (10 mgmL)
so that the amount of available SSIV may be limited and below detectable
levels in these interactions Also the recombinant forms of SP may not be
phosphorylated as efficiently as the native form leading to less stable
interactions The phosphorylation status of the recombinant SP following ATP-
treatment of amyloplast lysates was not examined The interaction found in the
study between SP and SSIV may have significance in relation to our
understanding of the initiation of the starch granule In addition SP was the
only protein which interacted with SSIV indicating a high specificity towards SP
Activity andor the affinity of the SSIV required to initiate the priming of granule
initiation may be regulated by the interactions with SP
To elucidate both the synthetic and the degradative activities of the
recombinant tetrameric and dimeric forms of SP they were tested in glucan
substrates of maltoheptaose glycogen and amylopectin and at 25 mgmL
concentration both multimeric states are active in both synthetic and
phosphorylitic directions (Fig 313) The higher activities of both multimeric
forms of SP with high molecular weight amylopectin followed by glycogen and
maltoheptaose were observed in both synthetic and phosphorolytic direction
196
and was similar to previous findings in maize (Yu et al 2001) potato (Liddle et
al 1961) and spinach leaves (Shimomura et al 1982) Bacterial SP has a
tetrameric configuration and also shows a higher activity in starch than in
maltopentaose in both directions (Weinhaumlusel et al 1997) The Km values
indicate the affinity level of SP towards different glucan substrates in
phosphorolytic direction (Table 31) In tetrameric SP the higher Vmax showed
with amylopectin also showed a higher Km (lower affinity) compared to
maltoheptaose which had a lower Vmax but a lower Km (higher affinity) which
was similarly observed in both synthetic and degradative directions by Mu et al
(2001) and suggests higher affinity of enzyme to the substrate not essentially
increased the activity of SP (Table 31)
The variation in the activity of tetrameric SP from synthetic direction to
phosphorylitic direction was greater in maltoheptaose (147 fold) compared to
amylopectin (21 fold) and glycogen (11 fold) (Table 31) indicating the
preference of SP for low molecular MOS in degradative directions This has also
been observed by Mu et al (2001) However the higher activities of SP forms
with highly branched amylopectin conflicts with the proposed function of SP in
the suggested model proposed by Satoh et al (2008) and Nakamura et al
(2012) In the model during discontinuous synthesis of starch granules the
short glucan chains released from pre-amylopectin by the action of debranching
enzymes are converted to longer glucan chains by SP
In potato tuber (plastidial SP) and leaf (cytosolic SP) were defined as low
affinity (SP-L) and high affinity (SP-H) isoforms respectively according to the
197
affinities showed to both amylopectin and glycogen in synthetic direction (Mori
et al 1993) (Table 1) The proposed function of the L-78 insertion located in the
middle of the plastidial SP which was not observed in cytosolic SP (Yu et al
2001 Albrecht et al 1998 Nakano and Fukui 1986) is to obstruct the binding
affinity of plastidial SP to large highly branched starch compared to glycogen
(Young et al 2006 Albrecht et al 1998) Very little is known about the
regulatory mechanism of SP-specific L-78 insertion existing in the plastidial form
of SP and no evidence for L-78 cleavage or the function of the insertion is
available for maize In the sweet potato tuber enzyme serine residues located in
L-78 insertion are phosphorylated and are thought to then target the L-78
peptide for proteolytic cleavage (Young et al 2006)
The results presented in this thesis demonstrate that SP is catalytically
active in dimeric and tetrameric forms throughout the endosperm development
and is involved in protein-protein interactions with the major starch biosynthetic
enzymes Some of the interactions were enhanced by pre-treatment with ATP
and SP has previously been shown to be phosphorylated (Pollock 2009 Liu et
al 2009 Grimaud et al 2008 Tetlow et al 2004) suggesting phosphorylation
of SP may control in some as yet unknown manner protein-protein
interactions For future directions investigating the glucan priming and glucan
synthesizing capacities of different dimeric and tetrameric forms and their
regulation by G-1-P or Pi in vitro would be essential in further understanding the
function of SP Fig 51 illustrates the proposed functions dimeric and tetrameric
isoforms of SP in starch biosynthesis phosphorylation of SP and SBE enzymes
facilitate the formation of protein-protein interactions between these enzymes
198
and between SP and SSIV Interaction between SP and SBE may regulate and
activate SBE to in turn facilitate interactions with starch synthases in the
amyloplast Another potential function for SP is in starch granule initiation by
interacting with SSIV (Fig 411)
Figure 51 Schematic diagram illustrating the proposed functions of dimeric and tetrameric forms of plastidial SP Phosphorylation of SP and SBE facilitate
the formation of protein-protein interactions phosphorylated SBEI interacts with both dimeric and tetrameric forms of SP while phosphorylated SSIIa interacts with the tetrameric form of SP and phosphorylated SBEIIb interacts with dimeric
SP forms and may regulate and activate the branching enzymes to facilitate interactions with starch synthases in the amyloplast while SP remains in the
stroma A second function of SP may be in starch granule initiation by interacting with SSIV Phosphorylated proteins are denoted by the P symbol
199
This research provides further insight into our growing understanding of the
coordinated activities of different enzymes associated in starch synthesis
through protein-protein interactions and complex formation in developing maize
endosperm The protein-protein protein interactions and the complexes formed
in amyloplasts are suggested to be a vital requirement in synthesizing starches
with different morphological characteristics by modulating granule fine structure
Understanding the basis of these modulations is essential for rational
manipulation of starch in crops Application of starch in food and non-food
industries depends on different structural and functional properties of starch
which can be modified with the knowledge of its genetic manipulations This
research provides information to understand the basics of starch biosynthesis to
develop models in developing modify polymer structures of starch
200
References
Abel G J W Springer F Willmitzer L and Kossman J (1996) Cloning and functional analysis of a cDNA encoding a novel 139 kDa starch synthase from potato (Solanum tuberosum L) Plant J 10 981-991
Albrecht T Greve B I Pusch K I Kossmann J Buchner P Wobus
U and Steup M (1998) Homodimers and heterodimers of Pho1-type phosphorylase isoforms in Solanum tuberosum L as revealed by sequence-specific antibodies Eur J Biochem 251 343-352
Alexander R D and Morris P C (2006) A proteomic analysis of 14-3-3
binding proteins from developing barley grains Proteomics 6 1886-1896
Alonso-Casajuacutes N Dauvilleacutee D Viale A M Muntildeoz F J Baroja-Fernaacutendez E Moraacuten-Zorzano M T Eydallin G Ball S and Pozueta-Romero J (2006) Glycogen phosphorylase the product of the glgP gene
catalyzes glycogen breakdown by removing glucose units from the nonreducing ends in Escherichia coli Bacteriol 188(14) 5266-5272
Bae J Lee D H Kim D Cho S J Park J E Koh S Kim J Park B H Choi Y Shin H J Hong S I and Lee D (2005) Facile
synthesis of glucose-1-phosphate from starch by Thermus caldophilus GK24 α-glucan phosphorylase Process Biochemistry 40(12) 3707-3713
Bae J M Giroux M and Hannah L (1990) Cloning and characterization of the brittle-2 gene of maize Maydica 35 317-322
Ball S G and Morell M K (2003) From bacterial glycogen to starch
understanding the biogenesis of the plant starch granule Annu Rev Plant Biol 54 207-233
Ball S Guan H P James M Myers A Keeling P Mouille G Buleon A Colonna P and Preiss J (1996) From glycogen to
amylopectin A model for the biogenesis of the plant starch granule Cell 86 349-352
Ballicora M A Frueauf J B Fu Y Schuumlrmann P and Preiss J (2000) J BiolChem 275 1315ndash1320
Ballicora M A Laughlin M J Fu Y B Okita T W Barry G F and
Preiss J (1995) Adenosine 5-diphosphate-glucose pyrophosphorylase from potato-tuber - significance of the N-terminus of the small-subunit for catalytic properties and heat-stability Plant Physiology 109 245-251
201
Banks W Greenwood C T and Muir D D (1974) Studies on starches of high amylose content part 17 A review of current concepts Starch 26 289-
300
Beckles D M Smith A M and Rees T A (2001) A cytosolic ADP-glucose pyrophosphorylase is a feature of graminaceous endosperms but not of other starch-storing organs Plant Physiol 125 818-827
Bhave M R Lawrence S Barton C and Hannah L C (1990)
Identification and molecular characterization of Shrunken-2 cDNA clones of maize Plant Cell 2 581-588
Blauth S L Kim K N Klucinec J Shannon J C Thompson D and Guiltinan M (2002) Identification of mutator insertional mutants of starch-
branching enzyme 1 (sbe1) in Zea mays L Plant Molecular Biology 48 287-297
Blauth S L Yao Y Klucinec J D Shannon J C Thompson D B and Guiltinan M (2001) Identification of mutator insertional mutants of
starch-branching enzyme 2a in corn Plant Physiology 125 1396-1405
Bowsher C G Scrase-Field E F A L Esposito S Emes M J and Tetlow I J (2007) Characterization of ADP-glucose transport across the cereal endosperm amyloplast envelop Journal of Experimental Botany 58
1321-1332
Brisson N Giroux H Zollinger M Camirand A and Simard C (1989) Maturation and subcellular compartmentation of potato starch phosphorylase The Plant Cell 1 559-566
Browner M F and Fletterick R J (1992) Phosphorylase a biological
transducer Trends Biol Sci 17 66-71 Buchbinder J L Rath V K and Fletterick R J (2001) Structural
relationships among regulated and unregulated phosphorylases Annu Rev Biophys Biomol Struct 30 191-209
Buchanan B B Gruissen W and Jones R L (2000) Biochemistry and molecular biology of plants American society of Plant Physiologist
Buchner P Borisjuk L and Wobus U (1996) Glucan phosphorylases in
Vicia faba L cloning structural analysis and expression patterns of cytosolic and plastidic forms in relation to starch Planta 199 64-73
Burrell M M (2003) Starch the need for improved quality or quantity- an overview Journal of Experimental Botany 54 451-456
202
Busi M Palapoli N Valdez H A Fornasari M S Wayllace N Z Gomez-Casati D F Parisi G and Ugalde R A (2008) Functional and
structural characterization of the catalytic domain of the starch synthase III from Arabidopsis thaliana Proteins 70 31-40
Burton R A Jenner H Carrangis L Fahy B Fincher G B Hylton C Laurie D A Parker M Waite D Wegen S V Verhoeven T and
Denyer K (2002) Starch granule initiation and growth are altered in barley mutants that lack isoamylase activity Plant J 31 97-112
Bustos R Fahy B Hylton C M Seale R Nebane N M Edwards A Martin C and Smith A M (2004) Starch granule initiation is controlled by a
heteromultimeric isoamylase in potato tubers Proceedings of the National Academy of Sciences of the United States of America 101 2215-2220
Carabaza A Ciudad C J Baqueacute S and Guinovart J J (1992) Glucose has to be phosphorylated to activate glycogen synthase but not to inactivate
glycogen phosphorylase in hepatocytes FEBS 296(2) 211-214
Cao H Imparl-Radosevich J Guan H Keeling P L James M G and Myers A M (1999) Identification of the soluble starch synthase activities
of maize endosperm Plant Physiology 120 205-215 Cao H James M G and Myers A M (2000) Purification and
characterization of soluble starch synthases from maize endosperm Archives of Biochemistry and Biophysics 373 135-146
Chen H M Chang S C Wu C C Cuo T S Wu J S and Juang R H (2002) Regulation of the catalytic behaviour of L-form starch phosphorylase
from sweet potato roots by proteolysis Physiolol Plant 114 506-515
Colleoni C Dauvilleacutee D Mouille G Morell M K Samuel M
Slomiany M C Lieacutenard L Wattebled F drsquoHulst C and Ball S (1999) Biochemical characterization of the Chlamydomonas reinhardtii a-14 glucanotransferase supports a direct function in amylopectin biosynthesis Plant
Physiology 120 1005-1014
Commuri P D and Keeling P L (2001) Chain-length specificities of maize starch synthase I enzyme studies of glucan affinity and catalytic properties
Plant Journal 25 475-486 Comparot S Lingiah G and Martin T (2003) Function and specificity of
14-3-3 proteins in the regulation of carbohydrate and nitrogen metabolism J Exp Bot 54 595-604
Copeland L and Preiss J (1981) Purification of spinach Leaf ADP-glucose pyrophosphorylase Plant Physiol 68(5) 996-1001
203
Critchley J H Zeeman S C Takaha T Smith A M and Smith S M (2001) A critical role for disproportionating enzyme in starch breakdown is
revealed by a knock-out mutation in Arabidopsis Plant Journal 26 89-100
Dauvilleacutee D Chochois V and Steup M (2006) Plastidial phosphorylase is required for normal starch synthesis in Chlamydomonas reinhardtii The Plant Journal 48 274-285
Dauvilleacutee D Dumez S Wattebled F Roldaacuten I Planchot V
Berbezy P Colonna P Vyas D Chatterjee M Ball S Meacuterida A and DrsquoHulst C (2005) Soluble starch synthase I a major determinant for the synthesis of amylopectin in Arabidopsis thaliana leaves Plant Journal 43 398-
412
Denyer K Waite D Edwards A Martin C and Smith A M (1999) Interaction with amylopectin influences the ability of granule-bound starch synthase I to elongate malto-oligosaccharides Biochemical Journal 342 647-
653
Denyer K Dunlap F Thorbjornsen T Keeling P and Smith A M (1996) The major form of ADP-glucose pyrophosphorylase in maize endosperm
is extra-plastidial Plant Physiology 112 779-785 Denyer K Hylton C M Jenner C F and Smith A M (1995)
Identification of multiple isoforms of soluble and granule-bound starch synthase in developing wheat endosperm Planta 196 256-265
DrsquoHulst C and Meŕida A (2012) Once upon a prime inception of the understanding of starch initiation in plants In Starch origins structure and
metabolism (ed Tetlow IJ) SEB Essential Review Series Society for Experimental Biology 5 55-76
DrsquoHulst C and Meŕida A (2010) The priming of storage glucan synthesis
from bacteria to plants current knowledge and new developments New
Phytologist 10(1111) 1469-8137
Dian W Jiang H and Wu P (2005) Evolution and expression analysis of starch synthase III and IV in rice Journal of Experimental Botany 56 623-632
Dinges J R Colleoni C James M G and Myers A M (2003) Mutational analysis of the pullulanase-type debranching enzyme of maize
indicates multiple functions in starch metabolism Plant Cell 15 666-680 Duwenig E Steup M and Kossmann J (1997a) Induction of genes
encoding plastidic phosphorylase from spinach (Spinacia oleracea L) and potato (Solanum tuberosum L) by exogenously supplied carbohydrates in excised leaf
discs Planta 203 111-120
204
Duwenig E Steup M Willmitzer L and Kossmann J (1997b) Antisense inhibition of cytosolic phosphorylase in potato plants (Solanum
tuberosum L) affects tuber sprouting and flower formation with only little effect on carbohydrate metabolism The Plant Journal 12 323-333
Echt C S and Schwartz D (1981) Evidence of the inclusion of controlling elements within the structural gene at the waxy locus in maize Genetics 99
275-284
Edwards A Fulton D C Hylton C M Jobling S A Gidley M Roumlssner U Martin C and Smith A M (2002) A combined reduction in activity of starch synthases II and III of potato has novel effects on the starch of
tubers The Plant Journal 17 251-261
Fettke J Albrecht T Hejazi M Mahlow S Nakamura Y and Steup M (2010) Glucose 1-phosphate is efficiently taken up by potato (Solanum tuberosum) tuber parenchyma cells and converted to reserve starch granules
New Phytologist 185(3) 663-75
Fischer E H Heilmeyer L M G and Haschke R H (1971)
Phosphorylase and the control of glycogen degradation Curr Top Cell 4 211-251
Fontaine T DrsquoHulst C Maddelein M L Routier F Pepin T M Decq
A Wieruszeski J M Delrue B Van den Koornhuyse N and Bossu J P (1993) Toward an understanding of the biogenesis of the starch granule
Evidence that Chlamydomonas soluble starch synthase II controls the synthesis of intermediate size glucans of amylopectin Journal of Biological Chemistry
268 16223-16230 French D (1984) Organization of starch granules In Whistler R L BeMiller
J N Paschall E F eds Starch chemistry and technology Orlando FL Academic Press 183-237
Fu Y Ballicora M A Leykam J F and Preiss J (1998) Mechanism of reductive activation of potato tuber ADP-glucose pyrophosphorylase J Biol
Chem 273 25045-25052
Fujita N Satoh R Hayashi A Kodama M Itoh R Aihara S and Nakamura Y (2011) Starch biosynthesis in rice endosperm requires the presence of either starch synthase I or IIIa J Exp Bot 62(14) 4819-4831
Fujita N Yoshida M Kondo T Saito K Utsumi Y Tokunaga T
Nishi A Satoh H Park J H Jane J L Miyao A Hirochika H and Nakamura Y (2007) Characterization of SSIIIa-deficient mutants of rice the function of SSIIIa and pleiotropic effects by SSIIIa deficiency in the rice
endosperm Plant Physiol 144 2009-2023
205
Fujita N Yoshida M Asakura N Ohdan T Miyao A Hirochika H and Nakamura Y (2006) Function and characterization of starch synthase i
using mutants in rice Plant Physiology 140 1070-1084
Fujita N Hasegawa H and Taira T (2001) The isolation and characterization of a waxy mutant of diploid wheat (Triticum monococcum L) Plant Sci 160 595-602
Furukawa K Tagaya M Tanizawa K and Fukui T (1993) Role of the
conserved Lys-X-Gly-Gly sequence at the ADP-glucose-binding site in Escherichia coli glycogen synthase Journal of Biological Chemistry 268 23837-23842
Furukawa K Tagaya M Inouye M Preiss J and Fukui T (1990)
Identification of lysine 15 at the active site in Escherichia coli glycogen synthase Conservation of Lys-X-Gly-Gly sequence in the bacterial and mammalian enzymes Journal of Biological Chemistry 265 2086-2090
Gao M Fisher D K Kim K N Shannon J C Guiltinan M J (1996)
Evolutionary conservation and expression patterns of maize starch branching enzyme I and IIb genes suggests isoform specialization Plant Molecular Biology
30 1223ndash1232
Gao M Wanat J Stinard P S James M G and Myers A M (1998)
Characterization of dull1 a maize gene coding for a novel starch synthase Plant Cell 10 399-412
Gao M Fisher D K Kim K N Shannon J C and Guiltinan M J (1997) Independent genetic control of maize starch-branching enzymes IIa and
IIb Plant Physiology 114 69-78 Gao Z Keeling P Shibles R and Guan H (2004) Involvement of
lysine-193 of the conserved lsquoK-T-G-Grsquo Motif in the catalysis of maize starch synthase IIa Archives of Biochemistry and Biophysics 427 1-7
Geigenberger P (2011) Regulation of starch biosynthesis in response to a fluctuating environment Plant Physiology 155(4) 1566-1577
Gerard C Colonna P Buleon A and Planchot V (2001) Amylolysis of
maize mutant starches Jourl of the sci and food Agric 1281-1287 Gomez-Casati D F and Iglesias A A (2002) ADP-glucose
pyrophosphorylase from wheat endosperm Purification and characterization of an enzyme with novel regulatory properties Planta 214 428-434
Greene T W and Hannah L C (1998) Maize endosperm ADP-glucose pyrophosphorylase SHRUNKEN2 and BRITTLE2 subunit interactions Plant Cell
10 1295-1306
206
Grimaud F Rogniaux H James M G Myers A M and Planchot V (2008) Proteome and phosphoproteome analysis of starch granule-associated
proteins from normal maize and mutants affected in starch biosynthesis Journal of Experimental Botany 59 3395-3406
Guan H P and Preiss J (1993) Differentiation of the properties of the branching isozymes from maize (Zea mays) Plant Physiology 102 1269-1273
Harn C Knight M Ramakrishnan A Guan H Keeling P L and
Wasserman B P (1998) Isolation and characterization of the zSSIIa and zSSIIb starch synthase cDNA clones from maize endosperm Plant Mol Biol 37 639-649
Hussain H Mant A Seale R Zeeman S Hinchliffe E Edwards A
Hylton C Bornemann S Smith A M Martin C and Bustos R (2003) Three forms of isoamylase contribute catalytic properties for the debranching of potato glucans Plant Cell 15 133-149
Hwang S K Nishi A Satoh H and Okita T W (2010) Rice
endosperm-specific plastidial a-glucan phosphorylase is important for synthesis of short-chain malto-oligosacchrides Arch Biochem Biophys 495 82-95
Hendriks J H M Kolbe A Gibon Y Stitt M and Geigenberger P (2003) ADP-glucose pyrophosphorylase is activated by post-translational redox-
modification in response to light and to sugars in leaves of Arabidopsis and other plant species Plant Physiology 133 1-12
Hennen-Bierwagen T A Liu F Marsh R S Kim S Gan Q Tetlow I J Emes M J James M G and Myers A M (2008) Starch
biosynthetic enzymes from developing Zea mays endosperm associate in multisubunit complexes Plant Physiology 146 1892-1908
Hizukuri S (1986) Polymodal distribution of the chain lengths of amylopectin and its significance Carbohydrate Research 147 342-347
Hylton C and Smith A M (1992) The Rb mutation of peas causes
structural and regulatory changes in ADP-glucose pyrophosphorylase from developing embryos Plant Physiology 99 1626-1634
James M G Robertson D S and Myers A M (1995) Characterization of the maize gene sugary1 a determinant of starch composition in kernels Plant
Cell 7 417-429 Jane J L Xu A Radosavljevic M and Seib P A (1992) Location of
amylose in normal starch granules I Susceptibility of amylose and amylopectin to cross-linking reagents Cereal Chem 69 405-409
207
Jody M M and Katja M A (2004) Coiled coil domains stability specificity and biological implications ChemBioChem 5 170-176
Johnson L N (1992) Glycogen phosphorylase control by phosphorylation
and allosteric effectors The FASEB Journal 6(6) 2274-2282
Johnson P E Patron N J Bottrill A R Dinges J R Fahy B F Parker M L Waite D N and Denyer K (2003) A low-starch barley
mutant Risoslash 16 lacking the cytosolic small subunit of ADP-glucose pyrophosphorylase reveals the importance of the cytosolic isoform and the identity of the plastidial small subunit Plant Physiology 131 684-696
Kim K N Fisher D Gao M and Guiltinan M (1998) Genomic
organization and promoter activity of the maize starch branching enzyme I gene Gene 216 233-243
Klucinec JD and Thompson DB (2002) Structure of amylopectins from ae-containing maize starches Cereal Chemistry 79 19-23
Knight M E Harn C Lilley C E R Guan H Singletary G W Mu-Forster C Wasserman B P and Keeling P A (1998) Molecular cloning
of starch synthase I from maize (W64) endosperm and expression in Escherichia coli The Plant Journal 14(5) 613-622
Kolbe A Tiessen A Schluepmann H Paul M Ulrich S and Geigenberger P (2005) Trehalose 6-phosphate regulates starch synthesis via
posttranslational redox activation of ADP-glucose pyrophosphorylase PNAS 102(30) 11118-11123
Kossman J Abel G J W Springer F Lloyd J R and Willmitzer L (1999) Cloning and functional analysis or a cDNA encoding a starch synthase
from potato (Solanum tuberosum L) that is predominantly expressed in leaf tissue Planta 208 503-511
Kubo A Colleoni C Dinges J R Lin Q Lappe R R Rivenbark J G Meyer A J Ball S G James M G Hennen-Bierwagen T A and
Myers A M (2010) Functions of heteromeric and homomeric isoamylasetype starch-debranching enzymes in developing maize endosperm Plant Physiology
153 956-969 Lee E Y and Braun J J (1973) Sweet corn phosphorylase purification and
properties Arch Biochem Biophys 156(1) 276-286
Lee S K Hwang M Han J S Eom H G Kang Y Han S B Choi M H Cho S H Bhoo G An T R Hahn T W and Okita J S J (2007)
Identification of the ADP-glucose pyrophosphorylase isoforms essential for starch synthesis in the leaf and seed endosperm of rice (Oryza sativa L) Plant Mol Biol 65 531-546
208
Leloir L F (1964) Nucleoside diphosphate sugars and saccharide synthesis Biochem J 91 1-7
Leloir L F de Fekete M A Cardini C E (1961) Starch and oligosaccharide synthesis from uridine diphosphate glucose J Biol Chem 236 636-641
Leterrier M Holappa L D Broglie K E and Beckles D M (2008) Cloning characterisation and comparative analysis of a starch synthase IV gene
in wheat functional and evolutionary implications BMC Plant Biology 8 (98)
Li Z Mouille G Kosar-Hashemi B Rahman S Clarke B Gale K R Appels R and Morell M K (2000) The structure and expression of the wheat starch synthase III gene Motifs in the expressed gene define the lineage
of the starch synthase III gene family Plant Physiol 123 613-624
Li Z Chu X Mouille G Yan L Kosar-Hashemi B Hey S Napier J Shewry P Clarke B Appels R Morell M K and Rahman S (1999) The localization and expression of the class II starch synthases of wheat Plant
Physiol 120 1147-1156
Liddle A M Manners D J and Wright A (1961) Studies on carbohydrate-metabolizing enzymes 6 The action of potato phosphorylase (P-enzyme) on starch-type polysaccharides Biochem J 80(2) 304-309 Lin T P Casper T Somaville C and Preiss J A (1988) Isolation and characterization of a starchless mutant of Arabidopsis thaliana (L) lacking
AGPglucose pyrophosphorylase activity Plant Physiol 86 1131-1135
Liu F Makhmoudova A Lee E A Wait R Emes M J and Tetlow I J (2009) The amylose extender mutant of maize conditions novel protein-
protein interactions between starch biosynthetic enzymes in amyloplasts Journal of Experimental Botany 60 4423-4440
Madsen N B (1991) Glycogen phosphorylase and glycogen synthetase Study of Enzymes 2 139-158
Manners D J (1989) Recent developments in our understanding of
amylopectin structure Carbohydrate Polymers 11(2) 87-112 Mason J M and Arndt K M (2004) Coiled coil domains Stability
specificity and biological implications ChemBioChem 5 170-176 Matheson N K and Richardson R H K (1978) Kinetic properties of two
starch phosphorylases from pea seeds Phytochemistry17 195-200 Monerri C Garcia-Luis A and Guartlkda J L (1986) Sugar and starch
changes in pea cotyledons during germination Physiol Plant 67 49-54
209
Morell M K Kosar-Hashemi B Cmiel M Samuel M S Chandler P Rahman S Buleon A Batey I L and Li Z Y (2003) Barley sex6
mutants lack starch synthase IIa activity and contain a starch with novel properties Plant Journal 34 172-184
Morell M K (2000) The structure and expression of the wheat starch synthase III gene Motifs in the expressed gene define the lineage of the starch
synthase III gene family Plant Physiol 123 613-624
Morell M K Blennow A Kosar-Hashemi B and Samuel M S (1997) Differential expression and properties of starch branching enzyme isoforms in developing wheat endosperm Plant Physiology 113 201-208
Morell M K Bloom M and Preiss J (1988) Affinity labeling of the
allosteric activator Site(s) of spinach leaf ADP-glucose pyrophosphorylase The Journal of Biol Chemistry 263(2) 633-637
Morell M K Bloom M Knowles V and Preiss J (1987) Subunit structure of spinach leaf ADP-glucose pyrophosphorylase Plant Physiol 85 182-
187
Mori H Tanizawa K and Fukui T (1993) A chimeric alpha-glucan phosphorylase of plant type L and H isozymes Functional role of 78-residue insertion in type L isozyme J Biol Chem 268 5574-5581
Mu-Forster C Huang R Powers J R Harriman R W Knight M
Singletary G W Keeling P L and Wasserman B P (1996) Physical association of starch biosynthetic enzymes with starch granules of maize endosperm granule-associated forms of starch synthase I and starch branching
enzyme II Plant Physiol 111 821-829
Mu C Harn C Ko Y T Singletary G W Keeling P L and Wasserman B P (1994) Association of a 76-kDa polypeptide with soluble starch synthase I activity in maize (cv73) endosperm Plant J 6 151-159
Mu H M Yu Y Wasserman B P and Carman G M (2001) Purification
and characterization of the maize amyloplast stromal 112 kDa starch phosphorylase Archives of Biochemistry and Biophysics 388 155-164
Muslin A J Tanner J W Allen P M and Shaw A S (1996) Interaction of 14-3-3 with signalling proteins is mediated by the recognition of
phosphoserines Cell 84 889-897 Myers A M Morell M K James M G and Ball S G (2000) Recent
progress toward understanding biosynthesis of the amylopectin crystal Plant Physiology 122 989-997
210
Nakamura T Yamamori M Hirano H and Hidaka S (1993)
Identification of three Wx proteins in wheat (Triticum aestivum L) Biochemical
Genetics 31 75-86
Nakamura Y Ono M Utsumi C and Steup M (2012) Functional interaction between plastidial starch phosphorylase and starch branching enzymes from rice during the synthesis of branched maltodextrins Plant Cell
Physiol 53(5) 869-878
Nakamura Y Utsumi Y Sawada T Aihara S Utsumi C and Yoshida M (2010) Reaction characterization of starch branching enzymes
from rice endosperm Plant Cell Physiol 51 776-794 Nakamura Y Francisco B P Hosaka H Y Satoh A Sawada T
Kubo A and Fujita N (2005) Essential amino acids of starch synthase IIa differentiate amylopectin structure and starch quality between japonica and
indica rice varieties Plant Molecular Biology 58 213-227 Nakamura Y Takahashi J Sakurai A Inaba Y Suzuki E Nihei S
Fujiware S Tsuzuki M Miyashita H Ikemoto H Kawachi M Sekiguchi H and Kurano N (2005) Some cyanobacteria synthesize semi-
amylopectin type α-polyglucans instead of glycogen Plant Cell Physiology 46 539-545
Nakamura Y (2002) Towards a better understanding of the metabolic system for amylopectin biosynthesis in plants rice endosperm as a model tissue Plant
Cell Physiol 43 718-725 Nakano K and Fukui T (1986) The complete amino acid sequence of
potato alfa-glucan phosphorylase The Jour of Biological Chmistry 261 (18) 8230-8236
Neuhaus H and Stitt M (1990) Control analysis of phtotosynthate partitioning Impact of reduced activity of ADP-glucose pyrophosphorylase or
plastid phosphoglucomutase on the fluxes to starch and sucrose in Arabidopsis thaliana L Planta 182 445-454
Newgard C B Hwang P K and Fletterick R J (1989) The family of glycogen phosphorylases structure and function Crit Rev Biochem Mol Biol
24 69-99
Nichols D J Keeling P L Spalding M and Guan H (2000) Involvement of conserved aspartate and glutamate residues in the catalysis and substrate binding of maize starch synthase Biochemistry 39 7820-7825
Nishi A Nakamura Y Tanaka N and Satoh H (2001) Biochemical and
genetic analysis of the effects of amylose-extender mutation in rice endosperm Plant Physiol 127 459-472
211
Okita T W Nakata P A Anderson J M Sowokinos J Morell M and Preiss J (1990) The subunit structure of potato tuber ADP-glucose
pyrophosphorylase Plant Physiol 93 785-790
Patron N J Smith A M Fahy B F Hylton C M Naldrett M J Rossnagel B G and Denyer K (2002) The altered pattern of amylose accumulation in the endosperm of low-amylose barley cultivars is attributable to
a single mutant allele of granule-bound starch synthase I with a deletion in the 5rsquo-non-coding region Plant Physiol 130 190-198
Peng M Hucl P and Chibbar R N (2001) Isolation characterization and expression analysis of starch synthase I from wheat (Triticum aestivum L)
Plant Science 161 1055-1062
Planchot V Angel M Isaac R Christophe D Fabrice L W and
David D (2008) Plants defective for soluble starch synthase IV (SSIV)
activity methods for obtaining the same and uses thereof http
wwwfreepatentsonlinecomEP1882742html
Pollack U C (2009) The role of protein phosphorylation on the regulation of
starch syhthesis in maize endosperm MSc Thesis University of Guelph
Preiss J and Sivak M (1996) Starch synthesis in sinks and sources In photoassimilate distribution in plants and crops sink-source relationships (ed
A A Schaffter) 63-96
Preiss J C Hutny J Morell M Bloom M Okita T and Anderson J
(1989) Regulation of starch syntheis Biochemical and genetic studies
Biocatalysis in Agricultural Biotechnology ACS Symposium Series 389 (6) 84-
92 Preiss J (1988) Biosynthesis of starch and its regulation The Biochemistry of Plants 14 181-254
Preiss J (1984) Bacterial glycogen synthesis and its regulation Annual
Review Mocrobial 38 419-458 Preiss J (1982) Regulation of the biosynthesis and degradation of starch
Annu Rev Plant Physiol 33 455-479
Pyke K (2009) Plastid biology Cambridge University Press ISBN 978-0-521 130-177
212
Rahman S Regina A Li Z Mukai Y Yamamoto M Kosar-Hashemi B Abrahams S and Morell M K (2001) Comparison of starch-branching
enzyme genes reveals evolutionary relationships among isoforms Characterization of a gene for starch-branching enzyme IIa from wheat D
genome donor Aegilops tauschii Plant Physiology 125 1314-1324 Rahman S Kosar-Hashemi B Samuel M S Hill A Abbott D C
Skerritt J H Preiss J Appels R and Morell M K (1995) The major
proteins of wheat endosperm starch granules Australian Journal Plant
Physiology 22 793-803
Rathore R S Garg H Garg S and Kumar A (2009) Starch phosphorylase Role in starch metabolism and biotechnological applications
Critical Reviews in Biotechnology 29(3) 214-224
Regina A Bird D Topping D Bowden S Freeman J Barsby T Kosar-Hashemi B Li Z Rahman S and Morell M (2006) High amylose wheat generated by RNA-interference improves indices of large bowel health in
rats Proc Natl Acad SciUSA 103 3546-3551
Regina A Kosar-Hashemi B Li Z Pedler A Mukai Y Yamamoto M Gale K Sharp P J Morell M K and Rahman S (2005) Starch branching enzyme IIb in wheat is expressed at low levels in the endosperm
compared to other cereals and encoded at a non-synthetic locus Planta 222 899-909
Roach P J (2002) Glycogen and its metabolism Current Molecular Medicine
2 101-120 Roldan I Wattebled F Lucas M M Delvalle D Planchot V
Jimenez S Perez R Ball S DrsquoHulst C and Merida A (2007) The phenotype of soluble starch synthase IV defective mutants of Arabidopsis
thaliana suggests a novel function of elongation enzymes in the control of starch granule formation The Plant Journal 49 492-504
Sano Y (1984) Differential regulation of waxy gene expression in rice endosperm Theor Appl Genet 64 467-473
Satoh H Shibahara K Tokunaga T Nishi A Tasaki M Hwang S Okita T W Kaneko N Fujita N Yoshida M Hosaka Y Sato A
Utsumi Y Ohdan T and Nakamura Y (2008) Mutation of the plastidial α-glucan phosphorylase gene in rice affects the synthesis and structure of starch
in the endosperm The Plant Cell 1833-1849
213
Satoh H Nishi A Yamashita K Takemoto Y Tanaka Y Hosaka Y Sakurai A Fujita N and Nakamura Y (2003) Starch-branching enzyme
I-deficient mutation specifically affects the structure and properties of starch in rice endosperm Plant Physiol 133 1111-1121
Schupp N and Ziegler P (2004) The relation of starch phosphorylases to starch metabolism in wheat Plant and Cell Physiology 45 1471-1484
Sehnke P C Chung H J Wu K and Ferl R J (2001) Regulation of
starch accumulation by granule-associated plant 14-3-3 proteins Proceedings of
the National Academy of Sciences of the United States of America 98 765-770
Sharp P J Morell M K and Rahman S (2005) Starch branching enzyme IIb in wheat is expressed at low levels in the endosperm compared to other
cereals and encoded at a non-syntenic locus Planta 222 899-909
Shannon J C Pien F M Cao H P and Lui K C (1998) Brittle-1 an adenylate translocator facilitates transfer of extraplastidial synthesized ADP-glucose into amyloplasts of maize endosperms Plant Physiology 117 1235-
1252
Shimomura S Nagai M and Fukui T (1982) Comparative glucan specificities of two types of spinach leaf phosphorylase J Biochem 91 703-
717
Sonnewald U Basner A Greve B and Steup M (1995) A second L-type isozyme of potato glucan phosphorylase cloning antisense inhibition and
expression analysis Plant Mol Biol 27 567-576 Sprang S R Acharya K R Goldsmith E R Stuart D I Varvill K
Fletterick R J Madsen n B and Johnson L N (1988) Structural changes in glycogen phosphorylase induced by phosphorylation Nature 336
215-221
Steup M (1988) Starch degradation In The Biochemistry of Plants Carbohydrates ed Preiss J 14 255-296
Steup M and Schachtele C (1981) Mode of glucan degradation by purified phosphorylase forms from spinach leaves Planta 153 351-61
Szydlowski N Ragel P Hennen-Bierwagen T A Planchot V Myers A M Meacuterida A DHulst C and Wattebled F (2011) Integrated
functions among multiple starch synthases determine both amylopectin chain length and branch linkage location in Arabidopsis leaf starch J Exp Bot 62(13)
4547-59
214
Takaha T Critchley J Okada S and Smith S M (1998) Normal starch content and composition in tubers of antisense potato plants lacking D-enzyme
(4-α-glucanotransferase) Planta 205 445-451
Takeda T Guan H P and Preiss J (1993) Branching of amylose by the branching isoenzymes of maize endosperm Carbohydr Res 240 253-263
Tanabe S Kobayashi M and Matsuda K (1987) Yeast glycogen phosphorylase characterization of the dimeric form and its activation Agric
Biol Chem 51 (9) 2465-2471 Tetlow I J (2011) Starch biosynthesis in developing seeds Seed Science
Research 21 5-32
Tetlow I J Beisel K G Cameron S Makhmoudova A Liu F Bresolin N S Wait R Morell M K and Emes M J (2008) Analysis of protein complexes in wheat amyloplasts reveals functional interactions among
starch biosynthetic enzymes Plant Physiology 146 1878-1891
Tetlow I J (2006) Understanding storage starch biosynthesis in plants a means to quality improvement Can J Bot 84 1167-1185
Tetlow I J Wait R Lu Z X Akkasaeng R Bowsher C G Esposito S Kosar-Hashemi B Morell M K and Emes M J (2004) Protein
phosphorylation in amyloplasts regulates starch branching enzyme activity and protein-protein interactions Plant Cell 16 694-708
Tetlow I J Davies E J Vardy K A Bowsher C G Burrell M M and Emes M J (2003) Subcellular localization of ADP-glucose
pyrophosphorylase in developing wheat endosperm and analysis of the properties of a plastidial isoform Journal of Experimental Botany 54 715-725
Tickle P Burrell M M Coates S A Emes M J Tetlow I J and Bowshera C G (2009) Characterizationofplastidialstarchphosphorylase in
Triticum aestivum L endosperm Journal of Plant Physiology 166 1465-1478
Tiessen A Nerlich A Faix B Huumlmmer C Fox S Denyer K Weber H Weschke W and Geigenberger P (2011) Sub-cellular analysis of starch metabolism in developing barley seeds using a non-aqueous fractionation
method J Exp Bot 63(5) 2071-2087
Tiessen A Prescha K Branscheid A Palacios N McKibbin R Halford N G and Geigenberger P (2003) Evidence that SNF1-related kinase and hexokinase are involved in separate sugar-signalling pathways
modulating post-translational redox activation of ADP-glucose pyrophosphorylase in potato tubers Plant Journal 35 490-500
215
Tiessen A Hendriks J H M Stitt M Branscheid A Gibon Y Farreacute E M and Geigenberger P (2002) Starch synthesis in potato tubers
is regulated by post-translational redox-modification of ADP-glucose pyrophosphorylase a novel regulatory mechanism linking starch synthesis to
the sucrose supply Plant Cell 14 2191-2213 Tomlinson K and Denyer K (2003) Starch synthesis in cereal grains Adv
Bot Res 40 1-61
Thorbjoslashrnsen T Villand P Denyer K Olsen O A and Smith A M (1996) Distinct isoforms of ADP glucose pyrophosphorylase occur inside and outside the amyloplasts in barley endosperm Plant J 10 243-250
Tsai C Y (1974) The function of waxy locus in starch synthesis in maize
endosperm Biochem Genet 11 83-96 Tsai C Y and Nelson O E (1969) Mutations at the shrunken-4 locus in
maize that produce three altered phosphorylases Genetics 61 813-821
Umemoto T and Aoki N (2005) Single-nucleotide polymorphisms in rice starch synthase IIa that alter starch gelatinization and starch association of the
enzyme Funct Plant Biol 32 763-768 Umemoto T Yano M Satoh H Shomura A and Nakamura Y
(2002) Mapping of a gene responsible for the difference in amylopectin structure between japonicatype and indica-type rice varieties Theor Appl
Genet 104 1-8 Valdez H A Busi M V Wayllace N Z Parisi G Ugalde R A and
Gomez-Casati D F (2008) Role of the N-terminal starch-binding domains in the kinetic properties of starch synthase III from Arabidopsis thaliana
Biochemistry 47 3026-3032 Vrinten P L and Nakamura T (2000) Wheat granule-bound starch
synthase I and II are encoded by separate genes that are expressed in different tissues Plant Physiology 122 255-264
Vrinten P Nakamura T and Yamamori M (1999) Molecular characterization of waxy mutations in wheat Mol Gen Genet 261(3) 463-71
Wattebled F Dong Y Dumez S Delvalle D Planchot V Berbezy
P Vyas D Colonna P Chatterjee S Ball S and DrsquoHulst C (2005) Mutants of Arabidopsis lacking a chloroplastic isoamylase accumulate phytoglycogen and an abnormal form of amylopectin Plant Physiology 138
184-195
216
Weinhaumlusel A Griessler R Krebs A Zipper P Haltrich D Kulbe K D and Nidetzky B (1997) α-14-D-glucan phosphorylase of gram-positive
Corynebacterium callunae isolation biochemical properties and molecular shape of the enzyme from solution X-ray scattering Biochem J 326 773-783
Wingler A Fritzius T Wiemken A Boiler T and Aeschbacher R A (2000) Trehalose induces the ADP-Glucose pyrophosphorylase gene ApL3 and
starch synthesis in Arabidopsis Plant Physiology 124 105-114
Yamanouchi H and Nakamura Y (1992) Organ specificity of isoforms of starch branching enzyme (Q-enzyme) in rice Plant Cell Physiol 33 985-991
Yamamori M Fujita S Hayakawa K Matsuki J and Yasui T (2000)
Genetic elimination of a starch granule protein SGP-1 of wheat generates an altered starch with apparent high amylose Theor Appl Genet 101 21-29
Yan H Jiang H and Wu G (2008) The orthologs in rice and maize
encoding starch synthesis enzymes duplication chromosome location and
expression httpwwwncbinlmnihgovnuccore183584857
Yanase M Takaha T and Kuriki T (2006) α-Glucan phosphorylase and its use in carbohydrate engineering J Sci Food Agric 86 1631-1635
Yandeau-Nelson M D Laurens L Shi Z Xia H Smith A M and Guiltinan M J (2011) Starch-branching enzyme IIa is required for proper
diurnal cycling of starch in leaves of maize Plant Physiol 156(2) 479-490
Yang Y and Steup M (1990) Polysaccharide fraction from higher plants which strongly interacts with the cytosolic phosphorylase isozyme Plant Physiol 94(3) 960-969
Young G H Han-Min E Lin C Tseng K Wu J and Juang R (2006)
Site-specific phosphorylation of L-form starch phosphorylase by the protein kinase activity from sweet potato roots Planta 223 468-478
Yu Y Mu H H Mu-Forster C Wasserman B P and George M C (2001) Identification of the maize amyloplast stromal 112-kD protein as a
plastidic starch phosphorylase Plant Physiol 125 351-359
Yu Y Mu H H Mu-Forster C and Wasserman B P (1998) Polypeptides of the maize amyloplast stroma - Stromal localization of starch-
biosynthetic enzymes and identification of an 81-kilodalton amyloplast stromal heat-shock cognate Plant Physiology 116 1451-1460
217
Yun S H and Matheson N K (1993) Structure of the amylopectins of waxy normal amylose-extender and wxae genotypes and of the
phytoglycogen of maize Carbohydr Res 243 307-321
Zeeman S C Thorneycroft D Schupp N Chapple A Weck M Dunstan H Haldimann P Bechtold N Smith A M and Smith S M
(2004) Plastidial α-glucan phosphorylase is not required for starch degradation in Arabidopsis leaves but has a role in the tolerance of abiotic stress Plant
Physiology 135 849-858 Zeeman S C Umemoto T Lue W L Au-Yeung P Martin C Smith
A M and Chen J (1998) A mutant of Arabidopsis lacking a chloroplastic isoamylase accumulates both starch and phytoglycogen Plant Cell 10 1699-
1711 Zhang J Zhang H Wang L Guo X Wang X and Yao H (2010) Isolation and identification of antioxidative peptides from rice endosperm protein
enzymatic hydrolysate by consecutive chromatography and MALDI-TOFTOF MSMS Food Chemistry 119(1) 226-234
Zhang X Szydlowski N Delvalleacute D DHulst C James M G and
Myers A M (2008) Overlapping functions of the starch synthases SSII and SSIII in amylopectin biosynthesis in Arabidopsis BMC Plant Biology 8 96
Zhang X Myers A M and James M G (2005) Mutations affecting starch synthase III in Arabidopsis alter leaf starch structure and increase the rate of
starch synthesis Plant Physiology 138 663-674 Zhang X Colleoni C Ratushna V Sirghie-Colleoni M James M G
and Myers A M (2004) Molecular characterization demonstrates that the Zea mays gene sugary2 codes for the starch synthase isoform SSIIa Plant Mol Biol
54 865-879
218
Appendixes Appendix 01
Synthetic activity of plastidial SP in amyloplast lysates (22 DAA) was
slightly reduced with the absence of SSIIa Protein-protein interactions between
both dimeric and tetrameric forms of SP with SSIIa may have affected for the
activity of SP There was no different in the synthetic activity of SP when SSIV
was removed
Synthetic activity of plastidial SP in amyloplast lysates (22 DAA) in the absence
of SSIIa (A) and SSIV (C) was tested in non-denaturing affinity native zymogram containing 01 glycogen in the gel Immunoblot of the zymogram
gels (A and C) were probed by peptide specific anti-SP (B and D) antibodies SSIIa and SSIV in amyloplast lysates were removed by immunoprecipitating the proteins using anti-SSIIa and anti-SSIV antibodies bound to Protein-A sepharose
beads The supernatants obtained after immunoprecipitation of stromal SSIIa and SSIV were used (90 microgmL per well) in zymogram analysis
(A) (B)
(C) (D)
219
Appendix 02
Immunoprecipitation of stromal SP from maize amyloplasts (22 DAA) in the
absence of SSIIa was tested using peptide specific anti-SP antibodies following immunoprecipitation with anti-SSIIa antibodies 1 ml amyloplast lysates (1 mgmL) were incubated with peptide-specific anti-SSIIa (15 mgmL final
concentration) at room temperature for 1 hr and then immunoprecipitated with Protein-A-Sepharose beads The supernatants were obtained after the beads
bound to SSIIa were centrifuged at 13000 rpm for 5min at 40C Supernatant was used (1 mgmL) immunoprecipitate SP by anti-SP antibodies (15 mgmL final concentration) Washed Protein-A-Sepharose-antibody-antigen complexes
were boiled in 200 μL 1XSDS-loading buffer and 30 μL was loaded onto 10 SDS gels Immunoblotted membranes were developed with SSIIa (A) and SP (B)
anti-maize antisera
The results showed that SP was not immunoprecipitated by anti-SP
antibodies bound to Protein A-sepharose beads after removing the SSIIa present
in the amyloplast lysates suggesting that the SSIIa is not preventing the
binding of SP to anti-SP antibodies bound to Protein A-sepharose beads
(A) (B)
220
Appendix 03
Primers used in PCR to isolate the complete coding sequence of plastidial SP of maize endosperm SP-F1 and SP-R1 primers were designed with the part of
transit peptide sequence and 15 bp overhangs from pET29a vector are underlined in SP-F2 and SP-R2 primers
Primer
Name
Primer sequence Annealing
temperature SP-F1
SP-R1
5rsquo GCGGAGGTGGGGTTCTCCT 3rsquo
5rsquo GCGAAAGAACCTGATATCCAC 3rsquo
640C
620C
SP-F2
SP-R2
5rsquoGGTTCCATGGCTGATTCAGCGCGCAGCG 3rsquo
5rsquoGAATTCGGATCCGATCTAGGGAAGGATGGC 3rsquo
460C
480C
Appendix 04
Primers used in sequence analysis of the isolated plastidial SP sequenced cloned
into pET29a vector In addition to SP-F2 AND SP-R2 primers (see appendix 03) T7 promoter and T7 terminator universal primers and F1 F2 F3 primeres were
used The mRNA complete coding sequence of plastidial SP of maize endosperm from NCBI was used to design the primers
Primer Name
Primer sequence Annealing temperature
Location in original
sequence T7-
promoter
T7-
terminator
F1
F2
F3
5prime TAA TAC GAC TCA CTA TAG GG 3prime
5rsquo GCTAGTTATTGCTCAGCGG 3rsquo 5rsquo GGAACCAGATGCTGCCCTG 3rsquo
5rsquo GTTGCAGTGCAGATGAATGAC 3rsquo
5rsquo GGTGTAGCTGAAATTCACAGTG 3rsquo
480C
760C
620C
680C
680C
-
- 393-411 bp
1006-1026 bp
1636-1657 bp
221
Appendix 05
Following is the alignment comparison of the predicted amino acid
sequence of plastidial maize SP obtained from NCBI with the amino acid
sequence of the recombinant SP produced in the study Amino acid sequence of
recombinant SP was derived from the mRNA sequence of PCR product of the full
length sequence (2805 bp) of SP (except transit peptide) Arrow shows thw
change in amino acid sequence of recombinant SP from the predicted sequence
(httpwwwchembnetorgsoftwareLALIGN_formhtml)
(A) wwwtmp251331seq predicted SP (NCBI) 849 bp - 849 aa
(B) wwwtmp251332seq Recombinant SP 724 bp - 724 aa
using matrix file BL50 (15-5) gap-openext -14-4 E(limit) 005
996 identity in 706 aa overlap (73-7781-706) score 4614 E(10000) 0
80 90 100 110 120 130
Predicted TLNYPAWGYGLRYEYGLFKQIITKDGQEEIAENWLEMGYPWEVVRNDVSYPVKFYGKVVE
Recombinant TLNYPAWGYGLRYEYGLFKQIITKDGQEEIAENWLEMGYPWEVVRNDVSYPVKFYGKVVE
10 20 30 40 50 60
140 150 160 170 180 190
Predicted GTDGRKHWIGGENIKAVAHDVPIPGYKTRTTNNLRLWSTTVPAQDFDLAAFNSGDHTKAY
Recombinant GTDGRKHWIGGENIKAVAHDVPIPGYKTRTTNNLRLWSTTVPAQDFDLAAFNSGDHTKAY
70 80 90 100 110 120
200 210 220 230 240 250
Predicted EAHLNAKKICHILYPGDESLEGKVLRLKQQYTLCSASLQDIIARFESRAGESLNWEDFPS
Recombinant EAHLNAKKICHILYPGDESLEGKVLRLKQQYTLCSASLQDIIARFESRAGESLNWEDFPS
130 140 150 160 170 180
260 270 280 290 300 310
Predicted KVAVQMNDTHPTLCIPELMRILMDVKGLSWSEAWSITERTVAYTNHTVLPEALEKWSLDI
Recombinant KVAVQMNDTHPTLCIPELMRILMDVKGLSWSEAWSITERTVAYTNHTVLPEALEKWSLDI
190 200 210 220 230 240
320 330 340 350 360 370
Predicted MQKLLPRHVEIIETIDEELINNIVSKYGTTDTELLKKKLKEMRILDNVDLPASISQLFVK
Recombinant MQKLLPRHVEIIETIDEELINNIVSKYGTTDTELLKKKLKEMRILDNVDLPASISQLFVK
250 260 270 280 290 300
222
380 390 400 410 420 430
Predicted PKDKKESPAKSKQKLLVKSLETIVDVEEKTELEEEAEVLSEIEEEKLESEEVEAEEESSE
Recombinant PKDKKESPAKSKQKLLVKSLETIVDVEEKTELEEEAEVLSEIEEEKLESEEVEAEEESSE
310 320 330 340 350 360
440 450 460 470 480 490
Predicted DELDPFVKSDPKLPRVVRMANLCVVGGHSVNGVAEIHSEIVKQDVFNSFYEMWPTKFQNK
Recombinant DELDPFVKSDPKLPRVVRMANLCVVGGHSVNGVAEIHSEIVKQDVFNSFYEMWPTKFQNK
370 380 390 400 410 420
500 510 520 530 540 550
Predicted TNGVTPRRWIRFCNPALSALISKWIGSDDWVLNTDKLAELKKFADNEDLHSEWRAAKKAN
Recombinant TNGVTPXRWIRFCNPALSALISKWIGSDDWVLNTDKLAELKKFADNEDLHSEWRAAKKAN
430 440 450 460 470 480
560 570 580 590 600 610
Predicted KMKVVSLIREKTGYIVSPDAMFDVQVKRIHEYKRQLLNILGIVYRYKKMKEMSTEERAKS
Recombinant KMKVVSLIREKTGYIVSPDAMFDVQVKRIHEYKRQLLNILGIVYRYKKMKEMSTEERAKS
490 500 510 520 530 540
620 630 640 650 660 670
Predicted FVPRVCIFGGKAFATYIQAKRIVKFITDVAATVNHDSDIGDLLKVVFVPDYNVSVAEALI
Recombinant FVPRVCIFGGKAFATYIQAKRIVKFITDVAATVNHDSDIGDLLKVVFVPDYNVSVAEALI
550 560 570 580 590 600
680 690 700 710 720 730
Predicted PASELSQHISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGEENFFLFGAEAHE
Recombinant PASELSQHISTAGMEASGTSNMKFAMNGCILIGTLDGANVEIREEVGEENFFLFGAEAHE
610 620 630 640 650 660
740 750 760 770
Predicted IAGLRKERAEGKFVPDPRFEEVKEFVRSGVFGTYSYDELMGSLEGN
Recombinant IAGLRKERAEGKFVPDPRFEEVKEFVRSGVFGTYSYDELXGSLXGN 670 680 690 700
223
Appendix 06
Predicted phosphorylation sites of maize SSIV was analyzed by NetPhos 20
server
Phosphorylation sites predicted
Ser 37 Thr 7 Tyr 9
Serine predictions
Name Pos Context Score Pred
_________________________v_________________
Sequence 21 PAHTSTPLF 0010
Sequence 38 DAAASSSTP 0520 S
Sequence 39 AAASSSTPF 0193
Sequence 40 AASSSTPFT 0213
Sequence 55 RLPMSCSAA 0580 S
Sequence 57 PMSCSAAAG 0003
Sequence 71 LLIRSAAPS 0007
Sequence 75 SAAPSTIVG 0979 S
Sequence 86 RLAMSRRTS 0840 S
Sequence 90 SRRTSRRNL 0998 S
Sequence 104 PHQKSAPSA 0010
Sequence 107 KSAPSANHR 0013
Sequence 115 RNRASIQRD 0883 S
Sequence 122 RDRASASID 0940 S
Sequence 124 RASASIDEE 0947 S
Sequence 133 QKQMSEDEN 0995 S
Sequence 194 EMKLSETGK 0027
Sequence 200 TGKQSVLSS 0622 S
Sequence 203 QSVLSSEVK 0974 S
Sequence 204 SVLSSEVKS 0687 S
Sequence 208 SEVKSDEES 0997 S
Sequence 212 SDEESLEFD 0987 S
Sequence 245 ETEESLFKL 0603 S
Sequence 259 LLNASLREL 0964 S
Sequence 267 LECTSTSAQ 0420
Sequence 269 CTSTSAQSD 0096
Sequence 272 TSAQSDVLK 0116
Sequence 298 DLLDSTANQ 0421
Sequence 307 VEHASLTLD 0007
Sequence 326 KLKASLGTT 0228
Sequence 333 TTNVSEFCL 0132
Sequence 349 QRVKSVEER 0997 S
Sequence 363 HEMHSQIEL 0947 S
Sequence 371 LYEHSIVEF 0115
Sequence 380 HGTLSKLIN 0028
Sequence 386 LINESEKKS 0953 S
Sequence 390 SEKKSMEHY 0988 S
Sequence 400 EGMPSEFWS 0540 S
Sequence 404 SEFWSRISL 0038
Sequence 407 WSRISLLID 0040
Sequence 414 IDGWSLEKK 0047
Sequence 420 EKKISINDA 0966 S
Sequence 425 INDASMLRE 0275
Sequence 444 EAYLSSRGM 0981 S
Sequence 445 AYLSSRGME 0033
Sequence 456 ELIDSFLKM 0024
Sequence 466 LPGTSSGLH 0043
Sequence 467 PGTSSGLHI 0007
Sequence 492 ADVISGLGK 0005
Sequence 532 VVVKSYFEG 0915 S
Sequence 581 FKRFSYFSR 0944 S
Sequence 584 FSYFSRVAL 0778 S
Sequence 594 LLYQSGKKV 0610 S
Sequence 626 LGFNSARIC 0004
Sequence 667 MRDNSHGRI 0987 S
Sequence 681 AVVYSNIVT 0025
Sequence 688 VTTVSPTYA 0545 S
Sequence 697 QEVRSEGGR 0658 S
Sequence 711 LKVHSKKFV 0981 S
Sequence 729 TWNPSTDRF 0293
Sequence 739 KVQYSANDL 0758 S
Sequence 747 LYGKSANKA 0009
Sequence 761 LKLASTQAS 0017
Sequence 765 STQASQPLV 0009
Sequence 803 VLLGSSPVQ 0009
Sequence 804 LLGSSPVQH 0231
Sequence 844 IFAASDMFI 0179
Sequence 851 FIVPSMFEP 0541 S
Sequence 868 MRYGSVPVV 0245
Sequence 881 GLNDSVFDL 0978 S
Sequence 939 KIDFSWDTS 0886 S
Sequence 943 SWDTSVSQY 0862 S
Sequence 945 DTSVSQYEE 0904 S
_________________________^_________________
224
Threonine predictions
Name Pos Context Score Pred
_________________________v_________________
Sequence 9 RPRPTARAR 0972 T
Sequence 20 DPAHTSTPL 0593 T
Sequence 22 AHTSTPLFP 0060
Sequence 27 PLFPTAAHA 0027
Sequence 41 ASSSTPFTL 0159
Sequence 44 STPFTLQPH 0041
Sequence 65 GAEATALLI 0022
Sequence 76 AAPSTIVGR 0375
Sequence 89 MSRRTSRRN 0960 T
Sequence 96 RNLRTGVHP 0035
Sequence 154 MIQNTQKNI 0269
Sequence 181 KEKETLQQK 0067
Sequence 196 KLSETGKQS 0274
Sequence 240 LIEITETEE 0376
Sequence 242 EITETEESL 0204
Sequence 266 ELECTSTSA 0177
Sequence 268 ECTSTSAQS 0127
Sequence 299 LLDSTANQV 0017
Sequence 309 HASLTLDGY 0440
Sequence 329 ASLGTTNVS 0061
Sequence 330 SLGTTNVSE 0134
Sequence 378 EFHGTLSKL 0481
Sequence 465 ALPGTSSGL 0103
Sequence 545 NKIWTGTVE 0134
Sequence 547 IWTGTVEGL 0564 T
Sequence 608 HDWQTAFVA 0583 T
Sequence 632 RICFTCHNF 0035
Sequence 685 SNIVTTVSP 0101
Sequence 686 NIVTTVSPT 0803 T
Sequence 690 TVSPTYAQE 0013
Sequence 706 GLQDTLKVH 0697 T
Sequence 723 NGIDTDTWN 0228
Sequence 725 IDTDTWNPS 0239
Sequence 730 WNPSTDRFL 0182
Sequence 762 KLASTQASQ 0027
Sequence 773 VGCITRLVP 0032
Sequence 792 IYKITELGG 0021
Sequence 859 PCGLTQMVA 0406
Sequence 875 VVRRTGGLN 0109
Sequence 889 LDDETIPME 0037
Sequence 899 RNGFTFLKA 0025
Sequence 942 FSWDTSVSQ 0423
Sequence 954 IYQKTATRA 0148
Sequence 956 QKTATRARA 0066
_________________________^_________________
Tyrosine predictions
Name Pos Context Score Pred
_________________________v_________________
Sequence 313 TLDGYRDFQ 0547 Y
Sequence 338 EFCLYLVDI 0017
Sequence 368 QIELYEHSI 0100
Sequence 394 SMEHYAEGM 0964 Y
Sequence 442 LREAYLSSR 0287
Sequence 512 ILPKYDCMQ 0513 Y
Sequence 533 VVKSYFEGN 0026
Sequence 554 GLPVYFIEP 0046
Sequence 570 WRAQYYGEH 0012
Sequence 571 RAQYYGEHD 0409
Sequence 582 KRFSYFSRV 0045
Sequence 592 LELLYQSGK 0494
Sequence 615 VAPLYWDVY 0886 Y
Sequence 619 YWDVYANLG 0973 Y
Sequence 638 HNFEYQGIA 0701 Y
Sequence 649 QDLAYCGLD 0208
Sequence 680 GAVVYSNIV 0136
Sequence 691 VSPTYAQEV 0467
Sequence 738 LKVQYSAND 0261
Sequence 744 ANDLYGKSA 0941 Y
Sequence 789 RHAIYKITE 0229
Sequence 832 LLLKYDDAL 0081
Sequence 866 VAMRYGSVP 0123
Sequence 918 RAFNYYHRK 0028
Sequence 919 AFNYYHRKP 0320
Sequence 947 SVSQYEEIY 0904 Y
Sequence 951 YEEIYQKTA 0983 Y
_________________________^_________________
225
Appendix 07
Co-immunoprecipitation of stromal proteins from wild-type maize amyloplasts
using peptide specific anti-SBEIIb antibodies to investigate the protein-protein interactions between SBEIIb SSIV and SP 1 ml amyloplast lysates (1 mgmL) prepared from wild-type maize endosperm at 22 DAA were incubated with
peptide-specific anti-SSIV antibodies (15 mgmL final concentration) at room temperature for 1 hr and then immunoprecipitated with Protein-A-Sepharose
beads The washed Protein-A-Sepharose-antibody-antigen complexes were boiled in 200 μL 1XSDS-loading buffer and 30 μL loaded onto 10 SDS gels Immunoblotted membranes were developed with anti-maize SBEIIb SSIV and
SP antisera
SBEIIb Co-IP
Probed with anti-SBEIIb
kDa
150
100
75
50
kDa
150
100
75
50
kDa
150
100
75
50
SBEIIb Co-IP
Probed with anti-SP
SBEIIb Co-IP
Probed with anti-SSIV
L Protein marker
1 SBEIIb Co-IP in protein A-Sepharose beads
2 SBEIIb Co-IP Pre Immune in protein A-Sepharose beads
3 SBEIIb Co-IP-supernatant
4 SBEIIb Co-IP- Pre Immune supernatant
5 Protein A-Sepharose beads + amyloplast lysates
6 Amyloplast lysates
L 1 2 3 4 5 6 L 1 2 3 4 5 6 L 1 2 3 4 5 6
226
Appendix 08
All the data were analysed using Statistix 09 statistical program
ONE-WAY ANOVA of the synthetic activity of SP of amyloplast lysates in
different glucans
One-Way AOV for V001 V002 V003 V004 V005 V006 V007 V008 V009
Source DF SS MS F P
Between 8 395428 494286 8274 0028
Within 18 10753 5974
Total 26 406182
Grand Mean 76055 CV 1016
Homogeneity of Variances F P
Levenes Test 128 03152
OBriens Test 057 07911
Brown and Forsythe Test 030 09570
Welchs Test for Mean Differences
Source DF F P
Between 80 9327 00008
Within 74
Component of variance for between groups 162771
Effective cell size 30
Variable Mean
V001 10053 (Glycogen-Untreated)
V002 11445 (Glycogen-ATP-treated)
V003 3743 (Glycogen-APase-treated)
V004 6908 (Maltoheptaose-Untreated)
V005 6001 (Maltoheptaose-ATP-treated)
V006 2735 (Maltoheptaose-APase-treated)
V007 9943 (Amylopectin-Untreated)
V008 14334 (Amylopectin-ATP-treated)
V009 3288 (Amylopectin-APase-treated)
Observations per Mean 3
Standard Error of a Mean 44624
Std Error (Diff of 2 Means) 63108
LSD All-Pairwise Comparisons Test
Variable Mean Homogeneous Groups
V008 14334 A
V002 11445 B
V001 10053 C
V007 99427 C
V004 69077 D
V005 60013 D
V003 37430 E
V009 32877 E
V006 27353 E
Alpha 005 Standard Error for Comparison 63108