21
Engineering the p7 Virporin for Nanopore Sequencing March 4, 2015 Max Genetti

P7 Viroporin Presentation

Embed Size (px)

Citation preview

Page 1: P7 Viroporin Presentation

Engineering the p7 Virporinfor Nanopore Sequencing

March 4, 2015

Max Genetti

Page 2: P7 Viroporin Presentation

Overview

• Nanopore Sequencing

• The p7 Pore

• Purification Techniques

• Lipid Membranes

Page 3: P7 Viroporin Presentation

Nanopore Sequencing

Page 4: P7 Viroporin Presentation

Nanopore Sequencing

Page 5: P7 Viroporin Presentation

Single Atom Sensitivity

calls

label C mC hmC fC caC

TGG 0.90 0.04 0.05 0.01 0.00

TCA 0.02 0.96 0.01 0.00 0.01

TCa 0.03 0.01 0.93 0.02 0.00

TTT 0.01 0.01 0.06 0.92 0.00

aaa 0.00 0.02 0.01 0.00 0.97

Page 6: P7 Viroporin Presentation

Need for New Pores

Pennisi 2012

α-Hemolysin MspA

~10 Nucleotides ~4 Nucleotides

Page 7: P7 Viroporin Presentation

Nonresolvable Sequences

Page 8: P7 Viroporin Presentation

Underrepresented kmers

•Bateriophage M13

•6407 nucleotides

Page 9: P7 Viroporin Presentation

The P7 Viroporin

Page 10: P7 Viroporin Presentation

Ca2+ Selectivity

Page 11: P7 Viroporin Presentation

Ca2+ Selectivity

Page 12: P7 Viroporin Presentation

Conformational Changes

Page 13: P7 Viroporin Presentation

Mutant

1 11 21 31 41 51 61

| | | | | | |

WTp7

JN1

GAKNVIVLNAASAAGNHGFFWGLLVVTLAWHVKGRLVPGATYLSLGVWPLLLVRLLRPHRALA

GAKNVSVLSAASAAGSHGFFWGLTVVTSAWHVKGTLVPGATYLSLGVWPLLLVRLLRPHRALA

Amino Acid SubstitutionsR35TL28SL24TN16SN9SI6S

Page 14: P7 Viroporin Presentation

Expression System

Page 15: P7 Viroporin Presentation

Cleavage

Page 16: P7 Viroporin Presentation

HPLC Purification

Page 17: P7 Viroporin Presentation

Mass Spectrometry

WTp7

Page 18: P7 Viroporin Presentation

Mass SpectrometryJN1

Page 19: P7 Viroporin Presentation

SDS-PAGE

Lane1245679

SampleMolecular Weight StandardFirst Purification WTp7WTp7 Fraction 6WTp7 Fraction 7JN1 Fraction 6JN1 Fraction 7Molecular Weight Standard

Page 20: P7 Viroporin Presentation

Test on Nanopore Station

Page 21: P7 Viroporin Presentation

Conlusion