, .

~ t , L

npage 6

~~page 14

--

-- - -----

r&~~~ page 42

page 50

(Ö)~(Q) page 68

,oC,

· Free time activities

·Compoundnouns·Adjectives+ prepositions

·Presentsimple(he/she/it)·Adverbsof frequency·Expressionsof frequency

·A day in the life 000·Profileofa sailor·Understanding the main idea

JRevision page58

·Adjectives:character·Askingfor and givingpermission·Adjectives:descriptions

·goingto (plans)·going to (predictions)·wou/d/iketo

·Polly'steenage helpline·An e-mail invitation

·Identifyingtext type·Understanding the main idea·Readingfor detailedinformation

·Householdjobs·Signsand rules

·have to·Makingsuggestions·mustand can·mustand don'thaveto

·StarAcademy·Dialogue·Readingfor detailedinformation

Revision page76

.

"

.. ..

ii

....-.. ..

· Countries and nationalities ·be (positive and negatiye) ·A chat room on the Internet·Alphabet ·be (questions) ·Classroomrulesposter·Numbers ·Understanding the main idea· Classroom instructions ·Reading for detailedinformation

..· Possessions · havegot (positiveand negative) · Meet the Beckhams!·Family ·havegot (questions) ·Anna'se-mail·Pluralnouns ·alan ·Transferringinformation·Adjectives ·Possessive 's to a diagram

.J·Possessive adjectives ·Reading for detailed· this, that, these and those information

Revision page22

·Placesina town · there is / there are (positive, ·A day in London!

·Prepositions of place negativeand questions) ·Birthday picnic!

·Days of the week ·same and any ·Idemifyingtext type·Monthsoftheyear ·Tellingthe time ·Reading for detailed·on,inandat ·Wh-questions information·Matching words with pictures ;i-·Vehicles ·Imperatives ·Unusualtransport·Directions ·Ordinalnumbers ·Adverts for penfriends

. ·Abilities ·can ·Readingfordetailed

J

information

Revision page40

·Verbs:daily routines ·Presentsimple(positive ·Space Camp Turkey·Schoolsubjects and negative) ·Anessay·Adjectives:school · Present simple (questions) ·Reading for detailedinformation

·Transferringinformationtoan IDcard·Classroominstructions

·Aradio programme· Listening for the main idea·Listeningfor specificwords

·Radio adverts

·Listeningfor specificinformation

·Transferringinformationto a plan

~i

· Listening for specific words·Followingdirectionsonamap

·Predicting:checkingpredictions·Transferringinformationtoa table

· Listening for the main idea·Listeningfor detailedinformation

·Listeningfor specificwords·Listeningfor detailedinformation

·Predicting:checkingpredictions·Transferringinformation.--

:; {:, iS:':':" :t

"~/' '.,

' '.' '.. 1>~...: >.. -'

, ".~,

:~;&~

'1

"~ m.J:im.. -~-'-" <, '.'

· GiVIng personal information ·A poster· andand but·Wordsearchand crossword

·Talkingabout yourself·Describingobjects

·Makinga radio advert·Planninga party

·Asking for and giVIngdirections·Makingdecisions

·Discussingideas·Discussing schoollife

·Asking for and giVInginformation:a sportspersonality

·Role-play:askingfor andgiVIng permission· Planning a perfect weekend

·Planninga schooltrip·GIVIng news and replying

·An e-mail

·Usingadjectives·Questionnaire:

The family questionnaire

·A party inVItation·AbbreVIations·Song:At TheWeekend

·Aletter·Spelling·Transportquiz

·An essay·Sequencers·Song:Alright

·A profile·Usingnotes·Questionnaire:

How sporty are you?

·An inVItation

·Usinga mind map

·Puzzle

·A dialogue·Makingsuggestions·Questionnaire:

Are you a helpful person?

~page 78

·Celebrations·make and do·Timeexpressions

· Presem cominuous (positive

and negative)·Presemcominuous

(questions)·Adverbs

·Valentine'sDay·AIetterto a penfriend·Predicting·Readingfordetailedinformation

page 86

-.1rtmmJ~T~~page 114

·Foodand drink·Acljectives:food

Revision page94

·Facilitiesin a town

· Academic subjects and jobs·Adjectives:places

·Nouns:crime·Verbs:crime·Adjectives:people

Revision page 112

·Adjectives:physicalappearance·Height, weight, distanceand age

· Countable and uncountable

nouns·alan,someandany·How much?/ Howmany?· Present simple and present

continuous

·be (pastsimple)· therewas/ therewere

· Past simple (regular verbs)·Possessivepronouns

· Past simple (regular verbs)· Past simple (irregular verbs)·Past simple (regular verbsand irregular verbs)·Pastsimple(negative,questions)

·Comparatives.as...as

· Superlatives

· Hamburgers aren't healthy·Maisie's restaurant·Readingfor specificwords·Readingfor detailedinformation

·Uvinghistoiy·Barcelona·Readingfor detailedinformation

·CatchMe [fyou Can·JamesHarman'scrime·[dentifyingtopics

· The real stars of action films

·World stamp competition·Readingfor detailedinformation

page 122

page 140

·Jobs·Adjectives:personality·Adverbsof probability

Revision page 130

·Keeping fit·Illnesses·Verbsand nouns

·Nouns and adjectives·[ncredibleevems·Extremeadjectives

Revision page 148

Grammar reference page ISO

·will(predictions)·will (promises)· too and enough

·Firstconditional·Zero conditional·Pastmodals

·Pastcontinuous·Pastcontinuousand pastsimple·Timeexpressions

·Space·Aletter

·Reading for detailedinformation

· Freezing water or warm mud?·An artieleabout elimbing·Readingfor detailedinformation

·Threeamazingstories·Mel'sdiaiy·Predicting·Readingfordetailedinformation

· Identifyingspeakers·Listeningfor detailedinformation

·Listeningfor specificwords·Listeningfor detailedinformation

·The Oxford Story·Listeningfor specificwords·Listeningfor detailedinformation

·Listeningfor the main idea·Listeningfor detailedinformation

·Listeningfor detailedinformation

· Transferring information toa table·Listeningfor detailedinformation

·Listeningfor the main idea·Listeningfor detailedinformation

·Predicting;checkingpredictions·Listeningfor detailedinformation

·Describingpeople· Givinga short speech

·Role-play:orderinga meal

·Askingand answeringabout people in the past·Makingcomparisons

·Tellinga story·Describinga seriesofevents

·Role-play:castinga film·Givingfactsand opinionsabout a pop star

·Role-play:a radio showabout the future·Makingpredictions

·Role-play:at the doctor's· Discussing sports

· Role-play: a radio interview·Role-play:makingandacceptingan invitation

~"7"~":

· Organizing ideas

·An advert

·Usingpositiveadjectives

·Avoidingrepetition

·Usingadjectives

·A formalletter

·Aninformalletter

·Writingan introductionand a conclusion

·Organizinginformation

1JtB.E. ~·Song:Celebration

· Crossword and wordsearch

·Historyquiz

·Thewitnesstest

·Song:SimplyThe Best

·Spacequiz

·Game

·Song:Reach

Backto school

--Hi. I'm Mel and I'm fromManchester. It's a city inBritain. I'm fifteen yearsold and I'm a student atelifton Hill SchooL.Mybest friend is Holly, butshe isn't at my schooL.

Hello. I'm Jack. I'msixteen years old. I'mfrom Manchester, too,and Mel's my girlfriend.I'm a student at eliftonHill School and I'm theDJat the school club. Myfavourite music is rapo

r(i

Hello. My name's Holly.I'm fifteen years old. Meland Jack are my friends, butwe're at different schools.Mel's my neighbour. She'sreally nice.

--- ----

.. Unit 1

PresentationBefore you read

1 Look at the photos. What do you think?Choose the correct alternatives.

1 Me! is from Britain/ America.2 Jaek is fourteen/sixteen years old.3 Holly/Mel is Jaek's girlfriend.

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise i. ~

3 Read the story again. Are the sentencestrue (v') or false (1)? Correct the falsesentences.

1 Mel is from London.

2 She's sixteen years old.3 She's at CHfton Hill SchooL.4 Jack isn't from Manchester.5 He's a DJ.6 His favourite music is jazz.7 Holly is at CHfton Hill SchooL.8 Jack and Holly are neighbours.

4 Complete the expressions.

Useful expressions

1 Mybest _ is Holly.

2 I'm sixteen _ old.

3 My_ music is rapo

4 Mel'smy_.5 She's_ nice.

5 Listen and repeat the expressions. ~

VocabularyCountries and nationalities

6 Complete the table with the words in the box.

British TleIrldsA Spanish Japanese ChineseBrazilian Italian Greek French American

Country

Turkey

Britain

Tapan

Greece

Spain

America

China

France

ItalyBrazil

Nationa1ity-1- -Ttldislt

7 Think of more countries and nationalities.

8 Complete the sentences about the people inthe pictures.

Eda is Ttlrk/slt.

She's from Ttlrk.ey.

2 WLis _'She's from _'

4 Demos is _'He's from_.

1 Satoshi is _'He's from_.

3 Brad is _'He's from_.

5 Giovanna is _'She's from _'

Unit 1 Back toschool..

Grammarbe (positive and negative)

1 Look again at the Clifton Hill story andcomplete the table.

Me!.

at different schools.

my neighbour.

2 Complete the sentences with the correct formof be.

Mel i$ nice.

i Mel_ fifteenyearsold.2 Melandherfriends_ fromManchester.3 Jack_ the school DJ.4 Jack and Mel _ students at Clifton Hill

SchooL.

5 Holly and Mel _ neighbours.

3 Complete the texts about three famouspeople. Use the correct form of be.

A i m 39 years old and i1_ from Los Angeles,in America. My friendJennifer Aniston 2_American, too. She3_34 years old. We 4_film stars.

B i 1_ American and i2_ from Bedrock.BarneyRubble 3_ myneighbour. He 4_ mybest friend, too. Wilma5_mywife.We6_cartoon characters.

C i 1_ American, but myhusband Guy Ritchie 2_British.My children areLourdesand Rocca.They 3_ great. i 4_45 years old and i 5_ apop star and a film star... Unit 1 Backto school

Fred Flintstone

\Madonna

4 Look at the sentences and complete the table.. I'm not fifteen years old. I'm fourteen.. Michael Jackson isn't from Britain. He's from

America.. The Rocky Mountains aren't in Switzerland.

They're in America.

1

am not i twelve years old.

5 Rewrite the sentences to make them true.

... -i-.....

The Eiffel Tower is in London.

The bffe/ Tower i$n't in London. /ts in Paris.

i Shish kebab is French.2 Harry Potter is Canadian.3 Pizzas are Spanish.4 Eminem is from Belgium.5 Buckingham Palace is in New York.6 David and Victoria Beckham are American.

7 Britney Spears is sixteen years old.S The Himalayas are in Germany.

6 Write three more false sentences. Then saythe sentences to a partner.

A Madonna i$ 8nti$11.

B Madonnai$n't 8ntl$11. Shes American.

m

We 1

YouThey i

are

-He

She2

lti is

We i 2

You - i Japanese.They ! are not

He 1 3

She i- i from Turkey.

ltis not

VocabularyAlphabet1 Listen and repeat the letters of the

alphabet ~

ABCDEFGHIJK

LMNOPQRSTUVWXYZ

2 Say the letters.1 TV 2 DVD5 BMW 6 USA

3 PC7 BBC

4 MSN8 HTML

3 Work in pairs. SpelI names and places fromthe CZifton Hill story.

A How t/o yOt/ spell 'Manchester'?B M-A-N-C-H-f-S-T-f-R

Numbers

4 Say the phone numbers.01224 67345Oh one t/ot/ble two (ot/I' six seven three (ot/I' (ive

1 0789 9811272 0432 6283963 0772 3905214 01989 0675425 01869 973451

5 Ask three of your classmates for theirtelephone numbers.

A Whats yOt/r telephone nt/mber?

B Its oh three t/ot/ble two (ot/I' (ive eiqht six ...

6 Complete the table with the words in the box.

fifteen eleven fifty nineteen twenty-oneninety seventeen thirty seventy thirteen

7 Listen and repeat the numbers in exercise 6. ~

Listening9 Look at the ID card and choose the correct

alternative.

The ID card is for a sports clubjschool club.

Milton School

(tu b ID (ard

Name: Cathy i

Nationality: 23

Age:

Address: 4_ Pari( Road, s

Telephone number: 6 J

10 Listen to the conversation and complete theID card. ~

SpeakingII Complete the information about Linda. Then

listen and check your answers. ~

HeBo. 1_ name's Linda Golding.That'sG-O-L-D-I-N-G.I'm 2_ Nottingham, inBritain. I'm fourteen and I'm a 3_ atMilton schooL.Mybest 4_ is Cathy Barker.My address 5_ 50 Elm Street,Nottinghamand my 6_ number is 374 2295.-

12 Introduce yourself to the class.

Hello.My names Cant/an Korl(maz. Thats

K-O-R-K-M-A-Z Im (rom...

~;~:;~~;TTTTTTTTT_~~ Makeyour own ID (ard. Put your photo on the ~

ID(ard. ~

Unit i Backtoschool..

10 ten 17 50

II 18 eighteen 60 sixty

IZ twelve 19 70

13 ZOtwenty 80 eighty

14 fourteen Zl 90

15 30 100 one hundred

16 sixteen 40 forty

8 Choose aBingo card. Then listen and checkyour numbers.

A20

\ B 30

6650 13 50

88 27 66 21 65 88

17 11 21 20 13 12--C 65 12

98 J D22

11 2113 66 22 98 50 3088 27 21 13 88 14

Reading1 Read the text quickly and complete the

sentence. ~

Cool-cat and Supergid are...a on the telephone.b in a chat room on the Internet.

c characters in a computer game.

3 Complete the table about Cool-cat andSupergirL.

2 Read the text again. Are the sentences true (I')or false (X)? Correct the false sentences.

Cool-cat is Turkish. XNo, 8lte i811't.Sltes Cal1acliem

1 Supergid is from Quebec.2 Cool-cat speaks French and English.3 Cool-cat and Supergid are fifteen.4 They're students.S Supergid is in an Internet cafe.6 Cool-cat is at schooL.

4 Discuss the questions.

1 Are chat rooms good? Why?jWhy not?2 Are Internet cafes popular in your country?

.- -i

<Cool-cat> Hello. How are you?

<SupergirI> Hi. I'm OKi thanks. Where are you from?

<Cool-cal> I'm from Canada. Are you from Canadai too?

<SupergirI> No, I'm from Istanbul, in Turkey.

<Cool-cat> Wow!That's a great dtyl

<SupergirI> Thanks. Which dty are you from?

<Cool-cat> Quebec.

<SupergirI> Is it nice?

<Cool-cat> Yesiit's a great place. We speak French andEnglish here.

<SupergirI> i speak Turkish and a little English. Are you \.a studenH

<Cool-cal> YesiI'm sixteen and I'm a student at art college. Howold are you?

<SupergirI> I'm fourteen. I'm a student at high school inIstanbuL.

<Cool-cat> Are you at school now?

<SupergirI> Noi I'm at home. Where are you now?

<Cool-cat> I'm in an Internet cafe in Quebec. Sorryi i must go now.

<SupergirI> Bye.Speak to you soon.

<Cool-cat> See you later. Bye. .:.:.

~..,

lIIt8 Unit i Back to school

Country Nationality LanguagesL___ -1

- - -Cool-cat 2 fl1qlt$1t

and 3-...

Supergid4 5 6

and 7-

Grammarbe (questions)

1 Look again at the reading text on page 10and complete the table.

Am ---youwethey

from (anada?

---2

hesheit

nice?

2 Write the questions in the correct order andchoose the correct answers.

from Is Istanbul Supergirl?Is Siiperqir/ from istcmbiil?

~s, she }§:iNo, she isn't.1 French Cool-cat Is?

Yes, she is./No, she isn't.2 Quebec nice Is?

Yes, it is./No, it isn't.

3 students they Are?Yes, they are./No, theyaren't.

4 in Cool-cat an Internet cafe Is?

Yes, she is./No, she isn't.

5 they neighbours Are?Yes, they are./No, theyaren't.

6 Is at home Supergirl?Yes, she is./No, she isn't.

3 Complete the questions and write true answers.

Are you from Italy?No, Im not

1 _ you a studem?2 _ your school nice?3 _ your favourite music rap?4 _ you fifteen years old?5 _ your favourite footbalI team

Manchester United?

6 _ you British?

4 Look again at the reading text on page 10and complete the questions.

a How _ you?b Where _ you from?

c Which dty _ you from?d How old _ you?

5 Use the questions from exercise 4 tocomplete the dialogue.

Hanne HelIo. My name's Hanne.Steve Hi. I'm Steve. 1 ?

Hanne OK, thanks. How are you?Steve Fine.2 .Hanne?Hanne Denmark.

Steve Oh, realIy? 3 ?Hanne Copenhagen.Steve That's a nice place! 4_ ?Hanne I'm fifteen. And you?Steve I'm sixteen.

6 Work in pairs. Ask your partner questionsand complete the form.

A Hello. Whats yoiir name?

B Im /)avid 8rowI1. Thats /)-A -v-i-/) ...

\) ,

) ~, iP . f)

!.Ü~JljJ >.JJlll!jJEj't!J~.rr:J..Applicationform

Name

Age

Nationality

Address

Telephonenumber

Dnit 1 Backtoschool...

VocabularyClassroom instructions

1 Match the pictures with the instructions.

Stand up. Sitdown. Listento the teacher.Do your homework. üpen your book.

Speak English. Don't eat in class. Don't be Iate.

Listening

7

4

-2 Listen and follow the teachers instructions. ~

.. Unit i Back to school

Reading

~

~..

..

.

,,

LU

3 Read the classroom rules poster and answerthe questions.

1 Which are good classroom rules?2 Which are bad classroom rules?

ClassroomRules ~1 Do your homework in pencil.

2 Stand up at the beginning of the lesson.

3 Don't be Iate for class.

4 Eat and drink in class.

5 Speak English in class.

6 Listento the teacher and other students.

WritingA poster: and and but

4 Read the information in the Look! box. Then

join the ideas with and or but.

lI!mmWe use and and but to join two ideas.

Sit down. Openyour book.-Sit down and openyourbook.SpeakEnglish.Don't speakyour language.-SpeakEnglishbut don't speakyour language.

1 Listen to the teacher. Open your book.2 Stand up. Speak English.3 Open your book. Don't write in your book.4 Sit down. Listen to the teacher.S Don't drink in class. Don't eat in class.

6 Do your homework. Don't copy homeworkfrom your friends.

5 Write a classroom rules poster for your class.

elC\ssrOCNY\rLtles

i DoV\'+ lis+eV\ +0 ~our wC\IK\'Y\C\V\iV\c\c\ss.

~. Do~+

1 Find eight more countries.

2 Complete the crossword.

....

Across

1 seven - five =S three + eight =7 four x four =

8 forty-six - fifteen =10 eighty-three - seventy-nine =11 sixty - fifty =12 twelve + three =

Down

1 sixx two =2 twenty-five x four =3 fifty-nine - thirty-nine =4 seventeen + sixty-one =6 five x thirteen =9 ten - one =

UnIt 1 Back toschool..

T F P tS'"R B L M A J,..:

G R G V"- p"- "I N C E A'!R B A R Z"" ;v- i'\.1 H O P'<

y Z R A E ii' "I' 0- p A

L B R 1 E E M"" L N

A B K M T II C K E Y

T E A Y Z A B E T 1

1 C H 1 N A 1 A P S

D F L Y F R A N C E

C H E L S F C W 1 N...

My world

Hi! I'm Tom. I'm from Chicago. It's a really big city in America.Right now my mum and dad have got jobs in Britain. My mum is adoctor and my dad is a sports teacher. We've got a house in Manchesterand I'm at Clifton Hill SchooL. I'm in Mel's class. She's really nice!

i love football and I'm very good at it! i want to be a professionalfootballer one day.

I've got one brother. His name's John and he's eighteen years old. Hehasn't got a job because he's a university student. He's got a fiat and afantastic motorbike.

I'm only sixteen. i haven't got a motorbike, but I've got a moped. It's redand it's got a 50cc engine. It's great!

My family has got a pet, too. His name's Bill and he's a big dog.

.. Unit 2

PresentationBefore you read

1 Look at the photos. What do you think?Choose the correct altematives.

1 Tom is from ...a Britain. b America.

2 His mum is a ...a doctor. b teacher.

3 Tom is ...

a fifteen years old. b sixteen years old.

4 He's got a ...a motorbike. b moped.

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise i. Q

3 Read the story again and answer thequestions.

1 Which dty is Tom from?2 Where is his house now?3 What's the name ofTom's school?

4 What's his favourite sport?5 How many brothers has Tom got?6 What pet has Tom got?

4 Complete the expressions.

Useful expressions

1 !'m _ Clitton Hill schooL.

2 i _ football.

3 I'm very _ at it!

4 !'m only _'

5It's_!--

5 Listen and repeat the expressions. Q

Act it outl

6 Work in pairs. Follow the instructions.Student AYou are Tom. You're at schooL. Mel is in yourclass. Ask her some questions.Student BYou are Mel. Tom is a new boy in your class.Ask him some questions.

Tom Hi /'m TOm.

MeI Hi 1111Me/. How oldareyoii?

VocabularyPossessions

7 CompIete the words with a, e, i, o or u. Use adictionary.

/.

1 w_teh 2 Gam_b_y

~:,. ...

...>. .""

.~

3 stec_ 4 di_ry

~ >I..e

~ dLD1---~

5 W_lkm_n 6 eomp_I-r

~ ~.~.r.~

..,

! "-'o .

- . . .

7 b_eyeL 8 p_t-.9 m_p_d 10 skai-b_ _rd

8 Work in pairs. Spell the words from exercise i.

A How do yoii spell watch?B W-A-T-C-H

9 Which are your favounte possessions?

Unit2 Myworld..

Andrew has qot three videos.

1 Sally a wateh.2 Andrew a pen.3 Andrew and Sally computers.4 They skateboards.5 Sally a stereo.6 Andrew and Sally CDs.7 They Gameboys.

have 90t (questions)

3 Complete the table.

Haveyouwethey

a pet?

2 a computer?

1

hesheit

a bicycle?

-ili Unit 2 My world

./ ./

5 Work in pairs. Ask and answer morequestions ab out Tom's family.

A Has mm qot a comptlter?B ye$,he has.

6 Work in pairs. Which things have you andyour family got?

A Have yOtl qot a stereo.?

B No, / havet1't, btlt my brothers qot a stereo.

alan

7 Look at the examples. When do we use an?+ a motorbike + an atlas

+ abicycle + an umbrella

8 Write a or an.

1 _ apple2 _ computer3 _ ice cream

4 _ orange5 _ skateboard

6 _ diary

Grammar 4 Look at the information about Tom's familyand choose the correct answers.

have 90t (positive and negative) 1 Has Tom got acar?

1 Look again at the CZifton Hill story andYes,he has./No, he hasn't.

complete the tables. 2 Have Tom's parents got acar?Yes, they have./No, they haven't.

'veqot .l/You/We/They i ahousein Tom John

Tom'save got Manchester. parents

1

He/She/It i h- a fiat.as goti i

12 .X X ./

I/You/We/Theyi - .

t have not got i a motorbike.He/She/lt 3_ i a job.

has not got '=/ X ./ X.

2 Look at the pictures of Andrew and Sally andcomplete the sentences with the correct formof have got. ..._--_. -

./ X X

VocabularyFamily

1 Complete Sam's family tree with the wordsin the box.

cousin father grandmother sisterunde brother

I~.: i '

~ Jit~. . . ~: - ; -

Sam Michael4

Hannah6

Rosie5

2 Draw your family tree. Then tell a partnerabout your family.

Katie iS my sister. Sl1es seventeeti years oki'

Sl1es a stvdetlt

Plural nouns

3 Look at the table and answer the questions.Then read the Look! box.

1 How do we make plurals?2 How do we make plurals when the noun

ends in 's' and 'y'?

Look!

Somewordshavegot irregularplurals.Singular Pluralchi/d chi/drenman menwoman women

Pronunciation

4 Read the Look! box. Then listen and

repeat the words. ~

We pronounce -ies plural endings /izi.families countries nationalities diaries

Listening5 Read the information about a radio

programme and answer the questions.1 What's the topic of the programme?2 How many minutes has each player got to talk?

Tuesday 8 October

Talk for a minufewith presenterDavid Dixon

The topic today isfamous families.OUTthree playershave got just oneminute to talk about

a famous family.

7 Listen again. Are the sentences about theDouglas family true (v"') or false (X)? ~1 Michael is an actor.2 Catherine Zeta-Iones is American.3 They've got a house in London.4 They've got one child.5 Michael's dad is famous too.6 Michael has got three brothers.

Speaking8 Play Talk For A Minute. The topic is 'You'.

Talk about these things.

· your family· your house/flat. your favourite things

...J

UnIt2 Myworld...

Singular Plura!

brother brothers

bus buses

family families

6 Listen to part of the radio programme andtick the things the player mentions.

Hollywood D TV D house Dchildren D school D parents Dbrothers D sisters D

Reading1 Think offamous families. Who's your

favourite famous family? Why?

VeniieS'WinameS" family iS very famoiis,

2 Read the text quickly and complete theBeckham family tree. Q

i This week our famous family is theBeckhams! They're from Britain andthey' re very famous because David is afantastic footballer! His team is Real

5 Madrid. They're in the Spanish footballleague and they're a great team! DavidBeckham's father is Ted and his mother isSa nd ra. David hasn't got a brother but hehas got 000 sisters. Their names are Lynne

LOand Joanne. David's family is fromLeytonstone, in London. Victoria Beckhamis David's wife. Her hair is dark brown andshe's a great pop singer - remember theSpice Girls!

3 Read the text again and answer the questions.

1 How many sisters has David got?2 Has David got a brother?3 What colour is Victoria's hair?

4 Where are David's parents from?S Who is Romeo's brother?

6 Where is Beckingham Palace?.. Unit 2 Myworld

i =Sandra

15 David and Victoria Beckham have gotthree children. Their names areBrooklyn, Romeo and Cruz. TheBeckhams have got a house nearLondon. People call it 'Beckingham

20 Palace' because it's really big.

4 Discuss the questions.

1 Are the Beckhams famolis in your country?2 Are the Beckhams an interesting family?

Why?jWhy not?3 Who is your favourite famous family?

GrammarPossessive - 's

1 Read the sentences from the text. When dowe use 's?. David's father is Ted.. Victoria is David'swife.

2 Make sentences with the words. Use the

possessive 's.

Sandra / Ted / wifeSanrira iS ret/s w/fe.

1 Joanne / Lynne / sister2 David / Victoria/ husband3 Brooklyn / Romeo / brother4 Ted / Brooklyn / grandfather5 Sandra / Romeo / grandmother6 Lynne / Brooklyn / aunt7 Victoria / Romeo / mother8 David / Brooklyn/ father

3 Work in pairs. Ask and answer questionsabout The Beckhams.

A Whos Lynne?B Shes f)aviris sister.

Possessive adjectives

4 Completethe table with the wordsin the box.

your his my their her

Personal pronouns i Possessiveadjectives

1

5 Look again at the reading text on page 18.How many possessive adjectives are in the text?

6 Complete the text with possessive adjectivesfrom the table in exercise 4.

The Windsors are the British royal familY.

Elizabeth is the Qyeen of England. She's got apalace in London.I_name is BuckinghamPalace.The Qyeen has got a big familY.2_ husband isPrince Philip.Elizabethand Philiphavegot threesons. 3_ names are Charles,Andrewand

Edward.They'vealsogota daughter,and4_name is Anne.

Charlesis the Princeof Wales.He's got two children.5_ namesareWilliamandHarry.

this, that, these and those

7 Look at the pictures and complete thedialogues with this, that, these or those.

A What's thiS?

B It's a pizza.

A What's that?

B It's a computer.

i

t~~~ i

~~

1 AWhat's _?B It's a book.

2 A What are _?B They're dogs.

t1I~~-8-,

" i

~ ir -,

~ i

,]3 AWhatare_?

B They're CDs.

4 AWhat's _?B It's a flag.

8 Work in pairs. Ask and answer questionsabout things in the classroom.A Whats thiS?

B/ts a (Jel!.

Unit2 Myworld..

you your

he 2

she 3

it its

we our

they 4

Reading1 Read Anna's e-maiL. What new things has

she got?

~Send r.iiSave i in ~ A~ r fP insert fi le... 1).. Priority ... i ~Options...

Hi, Becky!How are you?Guess what! I've got a new CD. Ifs by Darius. He'smy favouritepop star. Ilove hissong C%ur Blind,

and the CD is great.I've also got a new mobile phone. Ifs fantastic! Ifssmail, purple and very expensive. Here's a picture ofit. My new number is 07751 680780. Text me soon!What about you? Have you got any new things?Write and teli me!Lotsof loveAnna

2 Read the e-mail again and answer thequestions.

1 Who is Anna's favourite pop star?2 What colour is her mobile phone?3 What's her telephone number?

VocabularyAdjectives

3 Look at the words in the box and write pairsof opposites.

big cheap new horrible old nicesmail expensive

biq - smail

4 Match the words in the box with thecorrect colours.

red blue yellow pink black white green

.. Unit 2 My world

Speaking5 Work in pairs. Deseribe and guess the things

in the pictures., -''\

~.\i

A Its new.

B Is it the phOtle?A No. Its red.

B is it the car?

A Yes.

WritingAn e-mail: using adjectives

6 Read the information in the Look!box. Thenwrite the words in the correct order.

Look!

We use adjectives before a noun.

/'vegot a new phone.Or, after the verb be.It'ssmail.

--

~ .c~~..~

." J.

.~~a I've computer new got/'ve tjot ci tJew COl11jJllter.

1 is Your fantastic moped2 phone is Anna's expensive3 a dog got black He's4 They've an car got old5 blue My is skateboard6 nice Your is watch

mobile

7 Write a reply to Anna's e-maiL.

. Deseribethree of your things.

. Use some of the adjectives from exercise 3.

~;~:~;~~~~~~~~~~~-~~ ~~ Makea posteraboutyourself.Usephotosof your ~

~~~~~~~:::~:~~~:~~~

1 Complete the questionnaire. How many of youranswers are the same for each question?

2 Calrulate your total score and read the key. Areyou and your family the same or different?

ThefamilyquestionnaireFavourite Me My My My My Score

elClei 11111111 brotl1er CllltJt

_ ::' ~ J~~J ~:lre: ~L~e~_1:d~~_. jFavouriteMe My My ScoreMy My

T

!1 typeof

music

21Vprogramme

3 footballteam

4 food

5 place

6 pet

7 car

8 famousperson

jAl!wejAdde4f.JaAe aJ,noA iseap!awesa41jOLdLe 10DaAe4Al!wejJnOApuendA OV-ll

'luaJajjlPaJeawos pue 'awesa41aJeseap!JnOAjOawos 'Al!wej DullsaJaiu!ue aJ,noAOl-H

jinoqe ~iei OlSDU!41jOldl e 10DaA,noAileaJDS!S!41'seap!luaJajj!p

jOlDl e 10DaAe4AI!WejJnOApue ndA oi-o

tUOJS Si"iiwei JnOA

UnIt 2 Myworld IIJII

WritingAn e-mail: using adjectives

6 Read the information in the Look! box. Thenwrite the words in the correct order.

Look!

We use adjectives before a noun.

I've got a new ph one.

Or,after the verb be./t'ssmail.

.~~,...-~.a I've computer new gotI've qot al1ew compt/ter.

1 is Your fantastic moped2 phone is Anna's expensive mobile3 a dog got black He's4 They've an car got old5 blue My is skateboard6 nice Your is watch

7 Write a reply to Anna's e-maiL.

· Deseribe three of your things.· Use same of the adjectives from exercise 3.

~ ;r~~~i;~!~~~~'.n~~~~~ -- ~~ ~~ Makea poster about yourself. Usephotos of your ~

~~~~~~~:::~:~:~:~~~

i

1 Complete the questionnaire. How many of youranswers are the same for each question?

2 Calculate your total score and read the key, Areyou and your family the same or differenH

ThefamilyquestionnaireFavourite Me My My My My $core

tlatl mt/m brotlter at/l1ti

I I'I

Lqre~11~ r~tI~ ~ ~~ ~_ J ~etlJ ~~ ~.,:

colour

L~:.. ...-

jAiiwej Adde4 AJali e aJ,noA iseapi awes

a41 jO 101e 105 aiie4 AIIWej JnoA pue nOA OV-LZ

'1UaJajjlP aJe awos pue 'awes a41 aJe seap!

JnoA jO awoS 'AIIWej 5u!1SaJa1U!ue aJ,noA AZ-U

j1noqe ~le1 01 s5Ul41 jO

101 e 105 all,noA j1eaJ5 S! S!41 'seap! 1UaJajj!p

jO 101 e 105 aiie4 Aiiwej JnoA pue nOA O i-o

~UOJSSi\I!Wei JnOA

Unit 2 Myworld iliii

Favourite Me My My My My $core- - -

1 typeof ii i

i i ii imusic i i

,2TV

programme

3 footballteam

4 food

5 place

6 pet

7 car

8 famousperson

Grammarbe

~- - --

Revision (Units 1 & 2)

1 Complete the text. Use the COITectform of be.

Hi! i in Joanna. i I_from London. I'vegotone brother and one sister. Mybrother Patrickis eighteen. He 2_ a student at university.But my sister Clare 3_ a student - she4_ a film star. She 5_ in the newJames Bond film!

My two best friends are Maria and Peter. They6_ British_ they7_ Swiss.They8_ fromBemin Switzerland.

2 Write the questions.

A Hello. 1

B Fine, thanks.

?

A2

B No, I'm not American. I'm Canadian.A3

B Toronto.

?

?

A4

B I'm sixteen., James?

have got

3 Look at the pictures. Complete the sentenceswith the COITectform of havegot.

~~.

~

Paulhas qot a moped.

1 Paul and Anna computers.2 They Gameboys.3 Paul a motorbike.4 He a stereo.S Paul and Anna6 Anna.. Revision (Units 1&2)

pets.abicycle.

4 Write questions. Then look again at units 1and 2 and write the answers.

William Windsor / a sister?Has W/nam Wifa'sorqot a sister?No,he hasnt.

1 Prince Charles / three brothers?

2 the Queen / a big house ?3 Michael Douglas / ason ?4 Madonna and Guy Ritchie / four children ?

S Victoria Beckham / brown hair ?6 David and VictoriaBeckham/ two sons ?

Possessive 's

5 Rewrlte the sentences.

John has got ten CDs.They're Jöhn:S CPs.

1 Steve has got a fiat.2 Michael has got two watches.3 Carol has got a sister.4 Ellen has got three brothers.S Harry has got a mobile phone.

Possessive adjectives

6 Choose the COITectalternatives.

[J

iBSend ~s.v. in ~ ';.. ~ ir...rtm 't- Priorlty. j§OptiO.....

Hi Jane1

How are you/your?2

Guess what? I/My brother has got a newcomputer game. 3He/His computer isn't new,but 4he/his's got lots offantastic games! Come

5to I/my house and play!

6Come and meet I/my mum, too. She's really

7great. She/Her 's got lots of CDs.

8She/Her favourite popstar is Eminem!

9We/Our neighbours are good fun, too.

10They/Their've got a swimming pool.

Can you come?

Eddie

VocabularyCountries and nationalities

1 Write the countries.

NationalityBritish

American

Brazilian

SpanishTurkish

Japanese

Chinese

French

Greek

italian

Country- -8ntelil1

Numbers

2 Add two IDore words to each group.

five, ten, fifteen, twel1ty,twel1ty-five.

1 one, three, five,

2 ninety-nine, ninety, eighty-one,

3 seven, fourteen, twenty-one,

4 sixty, fifty-four, forty-eight,

5 two, four, eight,6 fifteen, thirty, forty-five,7 sixty-four, seventy-two, eighty,

Classroom instructions

3 Write the instructions in the correct order.

your open book

Opel1 yoiir boo/;:/

1 Iate be don't2 the listen teacher to3 down sit

4 English class speak in5 your do homework6 up stand7 class don't in eat

Possessions

4 Which is the odd one out? Choose thecorrect word.

ear~aw motorbike moped1 pet Walkman CD mobile phone2 book ear diary atlas3 watch umbrella skateboard apple4 bicycle motorbike ear moped5 skateboard video stereo Walkman

Family

5 Write the correct words.

erhrdngtamo qrell1t1l11otlter

1 orrhbet 2 trafeh

3 arntarfhegd 4 nuta5 sreits 6 eneul7 hrotem 8 nusok

Adjectives

6 Look at the pictures and write sentences. Usethe adjectives in the box.

new big OJ(ponsive smail old cheap

Hes qot ell1expel1Sive 1sk.elteboelrd.

2

4

,""'

3

5

Revision(Units1&2) ..

People and places

At the school cIub.

Mel There's a new boy in myclass. His name's Tom.He's got a moped andhe's really nice.

Holly Has he got a girlfriend?Mel i don't know.

Holly Try to fi nd out!

Mel

Holly

Mel

Holly

Tom

Mel

Holly

Tom

Holly

Tom

Look! That's Tom.

He's very good-Iooking.There aren't any boyslike that in my class.Ssh. Here he is.

Fantastic! Introduce me!

Hi, Me!. Is there a goodcafe near here? Wouldyou like to come?

No, there isn't. Er, ...this is my friend, Holly.Hi, Tom. Nice to meetyou. It's a great club!It's OK, but the music isterrible. i hate rapoEr, ... the DJ is Jack. He'sMel's boyfriend!

Oh, ...I'm sorry.

.. UnIt 3

PresentationBefore you read

1 Look at the photos. What do you think?Answer the questions.

1 Who are the people?2 Where are they?3 Who's the DJ?

Comprehension

2 Read and listen to the CHftonHill story.Check your answers to exercise i. Q

3 Read the story again and correct thesentences.

1 Tom is in Holly's class.2 Mel has got a moped.3 Tom is at the cafe.

4 There's a good cafe near the club.5 Tom is the DJ.6 Jack is Holly's boyfriend.

4 Who says the expressions?

Useful expressions

1 i don't know.

2 He's very good-Iooking.

3 Here he is.

4 Introduce me!

5 Nice to meet you.

6 The music is terrible.

7 i hate rapo

5 Listen and repeat the expressions. Q

Act it out!

6 Act out the story. Work in groups of three.

VocabularyPlaces in a town

7 Match the pictures with the words in the box.

cinema theatre park zooCDshop library cafe

swimming poolmus~um

1

:i

4

6

8

Zo °\-1 <:>

8 Listen and write the places. Q

1_3_5_

2_4_6_

9 Discuss the questions.

1 Which of the places in exercise 7 are in yourtown?

2 Which is your favourite place? Why?

10 What other places are there in your town?

!heres a tjootlshoppil1tj cMtre l1ear my schooL.

Unit3 Peopleandplaces..

Grammarthere isi there are (positive, negatiyeand questions)

1 Read the Look! box. Then look again at theClifton Hill story and complete the tables.

1 a new boy in my class.

There are some nice shops near here.

There isn't a good CDshop in my town.

2 any boyslikethat in myclass.

3 a good cafe near here?

Are there any shops near here?

Yes,there is./No,4_.

Yes,there are./No, there aren't.

2 Complete the e-mail from Tom's cousin. Usethere's, there are, there isn't or there aren't.

msL8S'nd ~S.Y. ID ~.~ ~ In..rlFii ~Prl.rlty. IEIOptl.n....

Hi Tom

My dad's new job is inLos Angeles,Califomia. Tkerearesome fantastic peopleand places here.Hollywood is in LA, so1 a lot of

film stars here. 2 some very big andbeautiful houses near Hollywood, but3

any cheap restaurants!My new house is near the Pacific ücean.4 a really good beach opposite myhouse. 5 some nice cafes on the beachand 6 also an aquarium. They've gotsome small sharks, but 7 any bigsharks in the aquarium. The big sharks are inthe Pacific!

Write soon.Steve

ELI Unit 3 Peopleand places

3 Complete the conversation.

TomMelTom

/s tkerea library near our school?1

Yes, _'2. di_ a pizza restaurantnear elibrary?

3 4 cNo, _' But _ two caies.

5_ any good shops?Yes,6_. 7_ some great CDshops!

MelTomMel

same and any

4 Look at the sentences. Then complete therules about plural sentences. Use some or any.

. There are some nice parks in my town.

. There aren't any cinemas near here.

. Arethere any museums in your town?

1 Weuse_ in positivesentences.2 Weuse_ innegativesentences.3 Weuse_ inquestions.

5 Read the information in the Look! box. Then

complete the sentences. Use a, an, some or any.

Look!

Weuse alan with singular nouns.There's a zoo in London.

There isn't an Internet cafe in this street.

We use some/any with plural nouns.There are some museums in Manchester.

There aren't any CDshops near here.

1 Are there _ swimming pools in diis city?2 There are _ great parks in Manchester.3 Is diere _ cinema in this street?4 There aren't _ supermarkets near here.5 There's _ expensive restaurant near my

house.6 Are diere _ good cafes in your town?

6 Work in pairs. Follow the instructions.Student AYou are a Yisitor to student B's town. Ask

questions about die town.Student BThink about your town. Answer student !\squestions.

A Are tkere any 900dskops inyol/rtown?B ye$, tkere are. Tkeres a biq skoPpin9 centre near

my kol/se.

VocabularyPrepositions of place

1 Match the pictures with the prepositions in the box.

on in behind opposite betweennext to in front of under

8 ~

~

5!t" 6 7z -; Z:z. '2. "z

~.:..:..

. ~..:..:. ~>...~d''>.1) .-

3 4

2 Look at the picture of a shopping centre and make sentences.

Internet cafe / sports shop / bankThe/tlteft1etcafe is between the sports shopcmd the batik.

1 CD shop / sports shop2 supermarket / bank3 sandwich bar / dothes shop4 clothes shop / ice crearn shop / shoe shop5 Internet cafe / bank

Listening3 Listen to four radio adverts for places in the

shopping centre. Number the places in theorder you hear them. Q

dnema

computer shopbowling alleypizza restaurant

4 Listen again and label the picture of theshopping centre in exercise 2. Q

-------

Speaking5 Complete the radio advert with the words

in the box. Then listen and check youranswers. Q

cheap come find teenagers

__mu _= Areyoucool? Thenour fantastic newelathes shop =- -= is just foryou!1_ to Cool Clothes andfind=- -= greatelathesat really2_ prices.elathesfor =;;3 _! elathesforcoolpeople!4_ us next ;i- -iiiito the icecreamshop.Cool Clothes is great! illi- -6 Work in pairs. Choose another place in the

shopping centre. Make a radio advert for it.

~~~~~~~~~~~~~~~~~~ Project idea! ~~ Makea poster advert for a place in the shopping ~

centre. ~:

Unit 3 People and places IIJJI

Reading1 Look at the photos of famous places in

London. Which of these places would youlike to visit?

71@f!!Il!4JMomingVisit the London Eyeand see fantasticviewsacross London.Go on a thirty-minute ride and take

some photos. When is it open? Ifs open from nineo'clock in the moming to ten o'clock in the evening.So, just come along and ride!

LunchHave lunch in a'foresf in theRainforest Cafe!Listen to the birds

and animals, buypresents and eatwonderful food.

Aftemoon

Go shopping and buy some CDs! There are somegreat shops on Portobello Road and KensingtonHigh Street. These are good places to seeinteresting people, too.

3 Read the text again. Are the sentences true (.I')or false (X)? Corred the false sentences.

1 The London Eye is open at eight o'clockin the moming.

2 There's a shop at the Rainforest Cafe.3 There are a lot of interesting people on

Portobello Road.4 There are some snakes at the London

Aquarium.S There's a zoo in Regent's Park.6 There are a lot of models of famous people

at Madame Tussaud' s.

.. Vnit 3 Peopleand places

2 Read the text quickly. Where is it from? Q

a a book b a magazine c a brochure

MorningMeet a 3-metre shark _at the London Aquarium! They've got over 350different types of fish. There's also a great zoo inLondon. See elephants, very talI giraffes and snakesat London Zoo!

Lunch

Relax and have a picnic in Regenfs Park. Ifs nextto London Zoo. Play football with your friends, orgo roller-skating.

AfternoonSee fantastic

models of yourfavourite famous

people! There arethousands ofmodels at MadameTussaud's WaxMuseum. The

museum is openfrom ten o'clock to half past five. So come andphotograph a friend next to a model of BritneySpears or David Beckham!

4 Match the pictures with words from the text.

1

5 What do you think? Which tour is yourfavourite? Tell the class your ideas.

Tovr8 iS my (avovnte. / /oveanimals, and London200

iS (antastic.

GrammarTellingthe time

1 Complete the times on the clock.

\~ 't;)u it)'

.2 Q.

~QJ

te/)tot~~.

, f-~ :' II~u"te'p'"'l.o~~ttel]~.s

.:,.QJ t::~ ~

~ ::!::§' ro

~ .J::-..:;

Wh - questions

4 Match the questions with the correct answers.

i What's your favourite place?2 What time is the party?3 When's your birthday?4 Where's your school?S Who's your favourite singer?6 Whose bag is this?

a It's at half past seven.b Britney Spears.c It's Jenny's bag.d The dnema.e It's in December.f It's next to the supermarket.

5 Choose the correct altematives.

i When/What' s your favourite animal?2 What time/Where's your favourite TV

programme?3 Where/When's your favourite dty?4 WhoseiWho' s your favourite com edian ?S WhoseiWho birthday is in August?6 WhatfWhen's your English test?

Pronunciation

6 How do you pronounce wh in questionwords? Listen and complete the tablewith the words in the box. a

what when who where whose

/w/

whClt

/h/

7 Work in pairs. Ask your partner questionsand complete the table.

WhClt8 your ncime?

Student's name?

Birthday?

Favourite singer?

Favourite colour?

Favourite TV programme?

Favourite footbaIl player?

Favourite place?

8 Teii the class ab out your partner.

Ak 8 birthtlClYi$ in December.

Unit3 Peopleandplaces..

2 Write the times.

0 (/)/t8 ten jJCI$tseven. i

eJ 0. .

2 3

€> G4 S

3 Listen and choose the correct time for eachsituation. a

i /

, \ tla \

-..--

..- , ..- ,O / i \ O

2a \ / b \ /

, ..- , ..--

-..- r:,/

i \ O / i \ O3a \ i / b \ i /

-'/

..- ,-- -

"- ..-

O / i \ O4a \ , / b \, ..- ,

/ '-O -..- ,-O

GrammarTellingthe time

1 Complete the times on the clock.

\-" t;-u ~.2 Q.

~~QJo ~

t_"t~ Y,

~

:J' 12

,

.. :'J

f

uarter pa st

\.O~ 7 6 5 t el1(\\.,1' ~ ' ty "

,.ie: o

r"'ClSt\.". "' ,

.:;.QJ vi

~ cl~ ~

§' '"~ .r:"

2 Write the times.

o ())/t8 ten paDt Deven. 1

ee2 3

€) G4 5

3 Listen and choose the correct time for eachsituation. e

Wh - questions III

4 Match the questions with the correct answers.

1 What's your favourite place?2 What time is the party?3 When's your birthday?4 Where's your school?5 Who's your favourite singer?6 Whose bag is this?

a It's at half past seven.b Britney Spears.c It's Jenny's bag.d The dnema.e It's in December.

f It's next to the supermarket.

5 Choose the correct alternatives.

1 WhenjWhat's your favourite animal?2 What timejWhere's your favourite TV

programme?3 WherejWhen's your favouritedty?4 WhosejWho's your favourite comedian?5 WhosejWho birthday is in August?6 WhatjWhen's your English test?

Pronunciation

6 How do you pronounce wh in questionwords? Listen and complete the tablewith the words in the box. e

what when who where whose

/w/

wltat

!hi

7 Work in pairs. Ask your partner questionsand complete the table.

Wltat8 yoiir name,?

Studenfs name?

Birthday?

Favourite singer?

Favourite colour?

Favourite TV programme?

Favourite football player?

Favourite place?

8 Tell the class about your partner.

Ak 8 birtitday 1$ in December.

Vnit 3 Peopleand places -ili

La \

i /

, \ t-"-

,\ O / i \ O

2a \ , / b \ i /, " , "

0 -" r:,/ i \ O / i \ O

3a \ i / b \ i /

-/" ,- -

, "

O / i \ O4a \ i / b \

,

\'-0 -" -O

Reading1 Read the information in the Look! box. Then

read the invitation and answer the questions.

1 Whose birthday is it?2 Where's the picnic?3 What time is the picnic?

Look!

We use ordinaJ numbers to taJk about dates.

1stfirst 2nd second 3rd third

4th fourth 5th fifth 6th sixth

7th seventh 8th eighth gth ninth

10th tenth 11theleventh 12th twelfth

8IRTHDAY PICNICl

/

It's my birthday! Pleasecomeand have a picnic

with me. Lots of fantasticfood and great fun

with friends!

Place: Priory ParkDate: Sat. 3rd Oct.

Time: 11.30 a.m. to 3.00 p.m.See you there!

Linda xxx

VocabularyDays of the week

2 Complete the words with a, e, i, o, or u. Usea dictionary.

Monday

1 T_ _sd_y2 W_dn_sd_y3 Th_rsd_y

4 Fr_d_y5 S_I-rd_y6 S_nd_y

lIItII Unit 3 PeopJe and pJaces

Months of the year

3 Write the months in the correct order.

December June August March ~~October july April September February

November May

1 ](:lf1l1ary2

3

4

5678

9101112

on, in and at

4 Look at the sentences and complete therules. Use on, in and at.

. Seeyou on Saturday.

. Let'smeet at three o'clock

. Mybirthday is in July.

1 Weuse_ withtimes.2 Weuse _ withdaysof the week.3 Weuse_ withmonthsof the year.

5 Write on, in or at.

1 _ Friday2 _ December3 _May

4 _ quarter to nine5 _ Sunday6 _ seveno'clock

Speaking6 Work in pairs. Plan a party. Answer the

questions.

1 Where's the party?· in the park?· at home?· at the dnema?

2 When's the party?3 Is it a family party or a party with mends?

7

WritingA party invitation: abbreviations

8 Look agaIn at the Invitation on page 30.What do the abbrevIations mean?

a.m. 111tfte momll1tj

1 Sat.20ct.

3 p.m.

9 Read the advert for a TV show. Are the

sentences true (tl) or false (X)?

1 The TV show is in the moming.2 It/s on Thursdayi Friday and Saturday.3 It/s in America.- --

Ricky Martinfantastic TU shaw~

,J

9:00 p.m.Thu.to Sat.Only in the USA

10 Write a party Invitation. Use your Ideas fromexercise 6.

· Inciude the placei date and time.· Use abbreviations.

11 Read your Invitation to the class.

1 Complete the song with the words In the box.

friend happy baby Tuesday love Thursday

.".,.- ,.1t.o;M~"'---'"'5-'%~,,;q>.f;>

..ii ~

i'

11 C:~,_,._

~b~On Monday, rm in 1 with you.On 2 , rm sad and blue.On Wednesday, you aren't my 3Yes, it's tme, it's tme.

On 4 , our love is history.But on Friday, rm 5 and free.And on Saturday, and Sunday too,You're with me, with me.

At the weekend, at the weekendv:' 1 ' 6iou re my ove, you re myAt the weekend.

2 Listen to the song and check your answers. e3 Answer the questions.

1 What are the good days of the week?2 What are the bad days of the week?3 When is the singer with her boyfriend?

4 What' s your favourite day of the week? Why?

UnIt 3 Peopleand places iliii

Transport

At school. The end of the day.

Tom Hi, Mel. I've got some moneyfrom my brother. Where's a goodCD shop round here?

Mel There's a shop near the schooL.Turn left at the gate. Go straighton. It's the second street on theright.

Tom Thanks. I've got my moped.Would you like aride?

Mel No, thanks, but be careful, Tom.Don't forget you're in Britain. Rideon the left!

Tom Don't worry, Mel. It's no problem.

Later.At Mel's house.

Mel

jacl<Mel

... and this is Tom in his football kit.

Why have you got photos of Tom?They're photos of America. Look atthis photo. It's Tom on his mopedin Chicago.

Really? Has he got a jeep and ahelicopter, too?Don't be silly, Jack!

';iio--........

jacl<Mel

jacl<Mel

But ...

Have you got a problem?Er, ... no.Good,becauseyou're my boyfriend,not Tom!

Yes, i know. I'm sorry, Mel.jacl<

.. Unit 4

PresentationBefore you read

1 Look at the photos. What do you think?Answer the questions.Photo A1 Where are Mel and Tom?2 Why is Mel worried?Photo B3 Where are Mel and Jaek?4 What are the photos on the table?Photo C5 Is Jaek happy now?

Comprehension

2 Read and listen to the CZiftonHill story.Check your answers to exercise i. ~

3 Read the story again. Are the senteneestrue (tl) or false (X)?

1 Tom hasn't got any money.2 There's a CD shop near the schooL.3 Mel has got some photos of Tom.4 Tom has got a helicopter.5 Jaek is Mel's boyfriend.

4 Who says the expressions?

Useful expressions

1 Would you like aride?2 Be carefui.

3 It's no problem.

4 Really?

5 Haveyougota problem?6 I'm sorry.

5 Listen and repeat the expressions. ~

6 What do you think? Why isn't Jaek happy?

Act it out!

7 Act out the story. Work in groups of three.

VocabularyVehicles

8 Mateh the pictures with the words in the box.

underground tram helicopter yacht vanship lorry jeep aeroplane jetski

"""

.z

~~ --

;-6~. ç-~_ 'C- ::::~".x/"_- ~~~' /;~-

<-2c~y- .~ ----.-:.=~ , ,\- -- "'--""'"

4

-

~ -=-r~

6 ~r _ il~~8

10 r!d-

~~~~~~4

~-r--

9 Complete the table with the words fromexercise 8.

Land

tram

Air Water

10 Think of more vehicles and add them to thetable in exercise 9.

11 Discuss the questions.

1 Which of these vehicles are in your city?2 Which of them are very modem?3 Which of them are expensive?

Unit4 Transport..

GrammarImperatives

1 Read the information in the Look!box. Thenlook again at the CZiftonHill story andcomplete the sentences.

Look!

Weuse the infinitivefor positiveimperatives.Do your homework!

We use don't + infinitive for negative imperatives.Don't be Iate!

. 1_ carefuL,Tom.

. 2_ forgetyou'rein Britain.

. 3_ on theleft!4. _ worry.

2 Match the pictures with the imperatives.

Don't park here! Give me that newspaper!Don't sit on my chair! Eat your food!

Bequiet! Stop at the red light!Don't swim here! Don't be horrible!

1 2

3 4

6

7

mil Unit 4 Transport

3 Complete the sentences with the words in thebox. Use positive and negative imperatives.

O\:H;@be eat wear ~ ride speak

Don'tlise a mobile phone in the cInema.He/pyour parents at home.

1 jeans at schooL.2 English in class.3 foo d in the swimming po oL.4 quiet in the schoollibrary.S your motorbike in the park.

Ordinal numbers

4 Complete the table with the words in the box.

fourth twelfth ~ seventh tenth secondthird fifth eleventh eighth sixth ninth

5 Complete the calendar pages with theordinal numbers in the box.

seventeenth twenty-first thirty-first twenty-thirdnineteenth fifteenth thirtieth sixteenth

fourteenth eighteenth twentieth thirteenth

October21

22 twenty-seconti

23

February13

14

15

16...

17

18

19

20

Oecembe'"

30

31

6 Work in pairs. Think of five important dates.Explain why theyare important.

Bth.lil/y - The eiqhth of Jp/y is my mother's birthtiay.

lst first 7th

2nd ath

3rd 9th

4th lOth

5th LLth

6th l2th

VocabularyDirections

1 Match the pictures with the directions. Take the first street on the right. Turn left.Cross the road. Go straight on. It's on the right.:

1

Ll 1_rr~

~I~.

i

3 . i --i

i:

4

i~

-- i

Listening2 Three people ask for directions to places on the map. Listen and tick the places they mention. Q

post office D cinema D library Dpark D bank D swimming pool D

3 Listen again and label the places on the map. Q

is8

8

~

You Ql'""e here0

Speaking4 Work in pairs. Ask for and give directions to

these places on the map.

1 the petrol station2 the square3 the school4 the bus station

A fxct/se me. Wheres the petrolstation?B Ta!\ethe first street on the riqht ...

5 Work in pairs. Make a list of places near yourschooL. Ask for and give directions to them.

A Wheres the st/permar!\et?

B Cross the road. Tt/m Ie(t. Ta!\ethe first street 0f1

the riqht. Its 0f1the Ie(t.

Unit4 Transport..

Reading1 Look at the photos of different forms of

transport. Which countries are they from?2 Read the artide quickly and check your

answers to exercise i. ~

These animals are afantastic form of transport.They're big, but they're veryquiet. Elephants can walkfor hours. You can't drivecars in the jungle, but withan elephant you can travelfar into the safari park. Youcan see leopards and tigersand lots of other animals.Come on an elephant safariin India. Ifs great fun!

Venice is a beautiful city, and a ridein a gondola is fantastic fun. These .

long, black boats are popular !with tourists in Venice, but a · ,

gondola ride is very expensive.See Venice in a gondola, but becarefu!. Don't stand up, and don'tfall into a canal!

3 Read the artide again. Are the sentencestrue (.f) or false (X)? COITed the falsesentences.

1 Elephants are noisy.2 Elephants can walk for a long time.3 Rickshaw drivers are strong.4 All rickshaws have got a motor.5 Gondola rides aren't cheap.6 You can stand up in a gondola.

5 Which form of transport would you like totry? Why?

/(j lik.e to nde em elepltemt cmd see tlte jiin11e.

4 Find the opposites of the adjectives inthe artide.

1 small (paragraph 1)2 weak (paragraph 2)3 slow (paragraph 2)4 short (paragraph 3)

~TTTTTTTTTTTTTTT~, Projectidea! ~~ ~hoose,anunus~al form of transport. Write some~~ instructions for it. ~

liot air balloon 4Don'tjiilffp in a Itot airballoon.Be carefiill ~

.. Unit 4 Transport

Grammarcan

1 Look at the sentences and complete thegrammar rules. Use can or can'i.. Elephants can walk for hours.. Youcan't drive cars in the jungle.. Can rickshaw drivers go far?

1 Weuse_ for positivesentences2 Weuse _ for negativesentences.3 Weuse_ forquestions.

2 Make true sentences. Use can or can'i.

elephants / climb treesflephcltfts cal1't cl/mb trees.

1 penguins / fly2 people / surf the Internet3 astronauts / visit the sun4 elephants / liye for two hundred years5 crocodiles / swim6 people / liye under the sea

3 Complete the sentences with can or can'i.Make the sentences true for you.

1 i _ drive acar.

2 i _ speak some English.3 i _ ridea jetski.4 i _ sendan e-maiL.5 i _ playa muskal instrnment.61_swim.

4 Read the questions and choose the correctanswers.

1 Can Tom ride a moped?Yes, he can. / No, he can't.

2 Can he ride a motorbike?

Yes,he can. /No, he can't.

5 Complete the dialogue with can or can'i.

I've got a guitar lesson at seven o'clock.Really? 1_ you play the guitar?No, 12_. It's my first lesson.Great. i love the guitar. 3_ you playany other instrnments?

Holly Yes, i 4_. i 5_ play the pianoand i 6_ sing, too. What aboutyou?

Tom i 7_ play any instrnments. I'm notvery muskal.

Holly Don't worry! You're a great footballer!

HollyTom

HollyTom

Pronundation

6 Read the information in the Look! box.

Then listen to the dialogue inexercise 5. a

In questions, we pronounce can /k:m/.

Canyou play the guitar?

In positive short answers,we pronouncecan/k::en/.Yes,i can.

Innegativeshort answers,we pronounce can't/ka:nt/.Nai i can't.

7 Work in pairs. Practise the dialogue inexercise 5.

8 Work in pairs. Ask your partner questionsand complete the table.

A (al1 yov nde ab/cycle?

B Ye8, i cal1.

.i xride a bicycle

play the piano

make an omelette

speak Germanuse the Internet

play basketball

9 Tell the class about your partner.

Ak cal1 nde ab/cycle, bvt he cal1't play the p/al1o.He cal1...

Dnit4 Transportilm

1 Read the Penfriend adverts and answer the

questions.1 What can Roberto do?

2 What nationaHty is Erica?3 Where's Martin from?

4 Which musical instroments can Vicky play?

Reading

Piiifmw. o.. -~ -~ .'

, 'f ",f;)

~.~'-~. .; ",- }. Hello. f; ~ ~'., i .\- \,;a lif .1

My name's Erica. I'm . ~~. _.~ <"...

sixteen years old and \... ~I'mfromBem,in ,- ,.

Switzerland. i love music.

My favourite singer is Madonna.I've got all her CDs and i can sing

all her songs!Send me an e.mail!

)

Hello.I'm Roberto. I'm

from Mexico. I'm seventeen

years old and i !ike sport. I'm a verygood atWete. i can mn very fast and

I'm in the school athletics team.Send me aletter!

"- .-

Write to me.

.-Hi. I'm Martin. I'm

fifteen and I'm from

Sydney,Australia. It's a

/great city and it's

near the beach! (I'vegota ·motorbike. It'sfantastic! i can ride it.

Are you interestedin motorbikes?

Hi. I'm Vicky andI'm from Dallas, inAmerica. I'm

fifteen years old. ilove books and i can

write great stories. ilike music, too. i can

play the piano and the /guitar. Write to me -i want to meet you.

VocabularyAbilities

Speaking

3 Match the words to make phrases.1 ride acar

2 sing the guitar3 drive pop songs4 play stories5 write a motorbike

4 Work in pairs. Choose a penfriend. Whywould you like to write to this person?

/(} like to write to 0cky becaiise shes very It1l1sica!

0cky can play the pkmo anti i can play the piano, too.

.. Unit 4 Transport

WritingAletter: spelling

5 ReadCarla's advert in PenfriendMagazine andunderline six more spelling mistakes. TheneOITectthe mistakes.

Hi. My name's Cada and I'm fromQuito, in Ecuadar. It's a nice city, butit isn't near the beech. It's not a

problam - i can go to the swimingpool with my familly every weakend.There's a nice park in Quito and ican go running or play football withmy freinds. Please rite to me!- -

.........-.-...beach

1_3_5_

2_4_6_

6 Look again at the adverts on page 38. Thenwrite aletter to your favourite penfriend.

. Write about yourself and your country.

. Write about your interests and your abilities.

. Check the spelling in your letter.

7 Read another student' s letter and check the

spelling.

1 Answer the questions.

1

2 A greentraffic light means .7.

a go.b stop.

3 The world speedrecordfor a motorcycle is ...

a about 1000 km an hour.

b about SOOkm an hour.

4 Thereisatrain tunnel between...

a Ireland and England.

b England and France.

S Which vehicle doesn't have a motor?

.,,-").- -J .

-,'",-",,,'1,, ~.,~~,~ \

~~.\~,\I ,\:~P!lll \~.~

I..\' ,", J:'j -, :'., Ii i

I. J ~~- ,:; "~~F:~~~';'~ ... .' 'if - u, D . ,il',.,.,' '-i.' m ,-'J. . ,~~~~~i

a a rickshaw.

b a moped.

6 Where can you ride on an elephant?

a Australia.

b India.

7 Which dty hasn't got an underground?- - -----

a london.b Venice.

8 Peoplein Britain ...

a drive on the left.

b drive on the right.

2 Think of two more quiz questions.

Where cal1 yOtl 8ee a q0l1dola,7

3 Ask the class your quiz questions.

Unit4 Transport..

- .

Revision (Units 3 & 4)

Grammarthere isi there are

1 Read the advert for a zoo and eomplete thedialogue.

Seeour Hons,elephantsandgiraffes.Takea boatacrossthe crocodilelake

or visit the snakehouse.

We'vegot acafeandarestaurant,too.Havelunchandrelax.

lt~s a great dayout!

Meg Tlteresa really good zoo near my town.They've got some lIons and giraffes.Wow! 1 any elephants?

2 d 3Yes, . An somecrocodiles in a lake!4 . '>

an aquarium!No, 5 . But they've got a reallygood snake house.i hate snakes. What about foo d?6 a cafe?

Yes,7 a small cafe, and8 a really good restaurant.

Sam

Meg

Sam

Meg

Sam

Meg

some and any

2 Complete the posteard. Use some or any.1

Dectr teiC.Ki \l' t'YI i", Pctris. i -J!s .fctvJcts+ic.l ,;'ere

\

i1 :

ctre some 3rect+s;'o?sct",d_ L______

300d c..fres ;'ere, bt.rf-~ei'ree><?e",sivel I", .fctc.+, +;'ere ctreV:+2_ c.;'ect?c..fres i", Pctris/,;'ere ctre 3_ bectii+rf/.lloid4?ctlctc.es ct",d _ rectlli

ivJeres+i",~ t'YI/.Ise/.lt'YIs.,;'ere ctreV:+

5_ 'hectc.;'es",ectr;'ere, bt.rf-+;'ere ctre 6_ veri ",ic.e?ctrKs.,;'ere ctre7_ 3rect+~i"'3s+0do i", ~e eve",j"'3s.,;'ere ctre

8_ 300d diSc.oS",ectr t'YIi;.o+ei.i love Pctrjs/Wrife soo",.Love, "",ct.. Revision (Units 3&4)

Telling the time

3 Write the times for the clocks.

1 2

3 4

Imperatives

4 Read the rules for Wonderworld Zoo. Some ofthem are ineorrect. Rewritethe incorrect rules.

Wonder~d- 1ZoO \, ~i\ Playmusie.

~~\~ ., Don'tplay mI/SiC.

1 Smokeiothesoake house.

i Giiiefoodto theaoima\s.

3 6ecarefulof theelephaots.4 Ooo'tswimio thelake.

5 leaiierubbishio thejOo.

6 10uchthesoakes.

,

!e,

'..

.

.

..

.- c"o "o" ..

A. ,:...~.L .

.~~~":.~ ... """". .--=::::.,;,

...

--- -- -- - -can

OJ,

5 Complete the dialogue.

Steve {cmyou swim?Barry Yes,i 1_. I'm in the school

swimming team. 2_ you swim?Steve No, i 3_, but i 4_ play

basketbali. 5_ you play basketball?Wewant some new players for the team.

Barry Yes,16_. I'd love to play!Steve Great. 7_ you come to a match

on Saturday?8 b

9Barry No, i _, ut i _ come

next week.Steve Fantastic!Seeyou there!

VocabularyPrepositions of place

1 Read the sentences and write the places on the map.

1 The swimming pooI is in front of the park.2 The libraiy is next to the Internet cafe.3 The museum is between the post office and the elub.

4 The theatre is behind the dnema.

S The ice cream shop is in the park.6 The zoo is opposite the post office.

Directions Vehides

2 Look again at the map and complete thedirections. Start at You are here.

3 Complete the words with a, e, i, o, or u.

A Is there a CD shop near here?

B Go straight on. I_the second street onthe right. It's on the 2_.

1 Ltsk_Stcm9 .J--P

2 Y_cht 3 l_rry6 v_n 7 sh_p

10 _nd_rgc _nd

4 _ _cpl_n_8 h_l_cpi-r

A Excuse me. Where's the elothes shop?

B Turn right. Take the 3_ street on the left.It's on the 4_.

Days and months

A Excuse me. Where's the petrol station?B 5_ the street. Then go straight on and

6_ the second street. The petrol stationis on the 7_.

4 Add two more words to each group.

1 February, March, April,2 May, July, September,3 Saturday, Sunda~ Monda~4 October, August, June,S Wednesday, Monday, Saturday

Revision(Units3&4) ....

My day

The next day.

Tom Hey! Is that a RobbieWilliams CD?

Mel Yeah! He's my favouritesinger.

Tom Really? Ilike him, too,and Ilike Blue. Britishmusic is great! Wha1'sa good British radiostation?

Mel Radio 1. Every morningI get up at seven o'clock,have brealdast andlisten to Radio1. l1's myfavourite radio station.

Mel

What about American music? Whichpop stars do you like?Hmm. I like Justin Timberlake.

Oh yeah? I've got his new CD athome. Come raund tonight withJack and Holly and listen to it!Er, ... no. i can't really. I don'tusually go out on school daysbecause I do my homework.Never mind. Maybe at the weekend.

Tom

MelTom

Tom

.. Unit 5

-.,....j \

.."

--,

1/.

B

R

, 'F .:'Tr

".

.:3

.';";

PresentationBefore you read

1 Look at the photos. What do you think?Choose the correct a1tematives.

1 Me! has got a ...a CD.b video.

2 Tom and Mel talk about ...a British music.b British and American music.

3 Tom has got a ...a new CD.

b new moped.

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise i. ~

3 Read the story again and answer the questions.

1 Who is Mel's favourite singer?2 Where are Blue from?3 Which is Me!'s favourite radio station?

4 Which American pop star do Mel and Tomlike?

S Who's got Justin Timberlake's new CD?

4 Complete the expressions.

Useful expressions

illike him,_.2 Britishmusicis_!

3 What_ Americanmusic?

4 (ome _ tonight.

5 Never_.

5 Listen and repeat the expressions. ~

6 Discuss the questions.

1 What music do you like?2 Who's your favourite singer?3 What's your favourite radio station?

Act it out!

7 Act out the story. Work in pairs.

VocabularyVerbs: daily routines

8 Complete the phrases with the verbs in the box.

fi.a.i.ie. play listen watchdo get up go eat

have breakfast

1 _afilm2 _ homework3 _ basketball4 _ to theradioS _ to school6 _akebab7 _ at 8 o'clock

9 Complete the sentences with the correctverbs from exercise 8.

co

ci

c:::i

i (

1 British teenagers _ at about seven o' clockon school days.

2 They_ to schoolby bus.3 They_ lunchat about halfpasttwelve.4 They_ homeworkeveryevening.S British teenagers _ to pop music.6 They_ musicprogrammeson1V.7 At the weekend, boys _ football with

their friends.

8 On Saturday evening, teenagers _hamburgers or pizza with their friends.

UnitS Myday..

Grammar

Present simple (positive and negative)

1 Look again at the Clifton Hill story andcomplete the table.

iYouWe

They

i Blue.

2 at seven o'clock.

2 Complete Tom' s letter with the verbs fromexercise 8 on page 43. Use the present simple.

De.a.r Sc.ott,

~ow a.re. 'i o LA..? i) m ha.pp'j he.re. ir"'Brita.ir"', b LA..t m'j cta.i 1'1 ro LA..tir"'e. iScti.f.fe.re.r"'t .from ba.c.k.. home. ir"'

c.h ic.a.~o.Or"' Sc.hool cta.'js i 1 a.tSe.ve.r"' o)c.loc.k.. a.r"'ct i 2 tothe. ra.ctio. The.re.)S a. lot o.f ~ooctBritiSh a.r"'ct Ame.ric.a.r"' mlA..sic. Or"'

Ra.ctio i. ?'Il.'1.frie.r"'ctS a.r"'ct i 3to sc.hool Or"' the. blA..s a.t ha.l.f

pa.St e.i~ht.At ha.l.f pa.St twe.lve. i 4llA..r"'c.hwith m'j .frie.r"'ctS Me.1 a.r"'ct..1a.c.k... We. 5 ha.mblA..r~e.rSor Sa.r"'ctwic.he.s .from the. sc.hoolc.a.r"'te. e.r"'.A.fte.r sc.hool, i ~o to the. le.iSlA..re.c.e.r"'tre. a.r"'ct i 6 .footba.1 I.

It)s ~re.a.t'. Ir"' the. e.ve.r"'ir"'~, i7 m'j home.work... The.r"' m'j

pa.re.r"'ts a.r"'ct i 8 _ TV or iliste.r"' to c.Ds.

Sa.'j (~i) to e.ve.r'jor"'e. ba.c.k.. home..

'iOlA..r .frie.r"'ct,

Tom

3 Look at the sentences and complete the table.

. i don't get up at six o'dock. i get up at seveno'dock.

. They don't listen to Radio i. They listen toRadio 4.

iYouWe

They

like jazz music.

do noteat hamburgers.

-ili Unit 5 Myday

4 Complete the sentences with the negativeform of the verbs.

Holly Mel and Tom eton'tAsten to (listen to)Radio 2.

i Holly i _ (go) to Clifton Hill schooL.2 Tom and Mel We _ (get up) at

six o'dock.

3 Jack Mel and Holly _ (play) football.4 Tom i _ (have) lunch at home.5 Meli _ (eat) chocolate.6 Mel and HollyWe_ (watch) TV

before schooL.

5 Complete the text with the verbs in the box.Use the carred form of the present simple.

do get up play go not go (x2) eat havenot talk watch drink

~hester Academyii

These students _ to chester Academy,aboarding school in Britain. In the moming, a beli ringsand they 2_ at six o'clock. They 3_breakfastin the diningroom with fivehundred other4students.They _ toast and comflakesandthey 5_ orange juice. Then they go to class.They 6_ to school by bus or train because theylive at the schooL.

At Chester Academy, lessons finish at three o'clock,7 8but the students _ home.They _their homework in the schoollibrary. Then they9_ football with their friends or 10_ a

video. They 11_ totheir parents on thetelephone every day,only on Sunday.

6 Find six differences between your dailyroutine and the routine at Chester Academy.

Thesttletents at (hester Acaetemy qet tlf?at

six o'c/od"btlt / qet tlf?at seven o'clod..

VocabularySchool subjects

1 Match the pictures with the words in the box.

2

1

9

6 A!,\

'. " be"'", 10'~

~

SO403020LA

sales

2 Discuss the questions.

1 Which school subjects are you good at?2 Which subjects are you bad at?3 What's your favourite subject? Why?

Listening--~--~iii.. _, .~

~;\'o'~-"

,.

'" :.1" , ,'il\. ,,'

ii.o,:~ ;~~Y

,

" ~'" ,,1'1(. ,,~

~'. _ __

~.

,';,1 " .-. .\ ,

' - ~ v' . : .~~,"'- ~.

. ~ ,.,. J r,!~'

~" I_'r '." ,. i \l..'~. W, Li j ;.,~,. ~ ..,J . i~

3 Look at the photo of Akiko. Which countrydo you think she's from?

4 What do you think? Are the sentences true(.I) or faIse (X)?In Akiko's country ...

1 students go to school on Saturday.2 students learn to cook food and make

clothes.3 teachers bow to their students.4 students serve lunch to their friends.5 teachers wash the dishes after lunch.

English maths history P.E. geographybiology chemistry art drama

business studies

4

riJ5

8

0\ ~\<" a

~e-.\~~.~

V5 Listen to Akiko and check your answers to

exercises 3 and 4. a

6 Listen again and complete the informationabout Akiko's schooL. a

Speaking7 Read the questions and discuss your idea s

with the class.

1 Is it good for students to go to school sixdays a week?

2 Would you like to study 'homemaking' atschool?

3 Is it a good idea for students to clean theirclassraoms?

4 Is homework important?5 Would you like to go to school in Japan?

Why?jWhy not?

A There are 10tB of Bchool Btl/::/ectB BO its qoocl to

qo to Bchool Bi)( tlayB a wee,{.

B ye$, bvt free time iB important, too, At thewed,enc/, i...

Unit5 Myday..

.J lA.('\ior ih Sc.hoo\

c.o 1A.t'\+r'i1-

Sc.hoo\ hOlA.rS Mot'\.-Fri.: g.3D-3.00

Sa.+.:2 3- - -

SlA.bjec.+Sma.+hs J eora.ph'j,4 5_ a.N!_Jhomema.k.it'\

14omework.6_ hOlA.rSever'jweek.

Reading1 Look at the photos of Space Camp Turkey.

What do you think students learn at spacecamp?

2 Read the artiele from New Science magazineand check your answer to exercise i. ~

3 Read the artiele again and choose the correctalternatives.

1 In Europe, ...a there's one space camp.b there are two space camps.

2 The students at SpaceCampTurkeyarefrom ...a Turkey.b many different countties.

3 Murat thinks the activities at space campare ...

a boring.b very good.

4 The students at SpaceCampTurkeyleammaths and science ...a in a dassroom.

b during the activities.5 A lot of students think astronaut food is ...

a strange.b nice.

6 Murat's favourite activity at space camp is ...a the rocket simulator ride.b the lessons.

4 Discuss the questions.

1 Would you like to go to SpaceCampTurkey?Why?jWhy not?

2 Would you like to go into space?Why?jWhy not?

Space Camp Turkey,near izmIr is one of onlytwo space camps in Europe. Young peoplecome to the camp from all over the world.They choose a course and learn about life

5 in space. Murat Oran is fifteen years old andhe's from Bursa, in Turkey. He's on aS-daycourse at Space Camp Turkey. We ask himabout the camp.

NS What activitiesdo you do?

10 Murat Wego on rocketsimulatorrides.They'refantastIC because you feellike a real astronaut. Wealso make and repair satellites. That's reallyinteresting. And llike the experience of zerogravity, too. You feellike a birdI

15 NS Do you have lessons?

Murat No, we don't. i mean, we learn somemaths and science in all the activities, but it's notthe same as schooL.We don't sit at desks and

learn in a classroom. Activities at space camp are20 never boring.

NS What do you eat?

Murat We eat special astronaut food. Ifsstrange because it comes in tubes and ittastes different from our food. The drinks

25 are in special cans. i think the food is OK,but a lot of students don't like it!

NS Do you like Space Camp?

Murat Yes, i do. lfs fantastle. I'd like to

come again. i like all the activities,30 especially the rocket simulator ride, and i

like learning about the technology. Atspace camp, we meet young people fromallover the world and make new friends.

Visit the camp's website at35 www.spacecampturkeycom

for more information.

-ili Unit S My day

GrammarPresent simple (questions)

1 Look again at the artide on page 46 andcomplete the tables.

1youwe

they

have lessons?

like Space Camp?

Yes, I/you/we/they 2_'

No, I/you/we/they 3_.

2 Look at the table and add information about

schools in your country.

CSchools around the world)

~ .-'~

.~~"~,

~1.,.

. -$o-,J ,._~ _

3 Work in pairs. Ask and answer questionsabout the information in the table.

A Do (jermal1sttldents start schoolat 90'clod;?B No, they dOI1't.

4 Look again at the artide on page 46 andcomplete the questions.

. Whatactivities1_ you do?

. What2_ youeat?

5 Make questions about the students at SpaceCamp. Use the present simple.

What time / get up?

What time dO the sttldel1ts tjet tip?

1 Where / sleep?2 What / leam about?3 Who / meet?4 Which languages / speak?S What time / go to bed?

6 Match the questions from exercise S withthe COITectanswers.

a Technology.b English and Turkish.c In a bedroom with other students.d At eleven o'clock.

e Young people from all over the world.

7 Complete the interview from the Clifton HillSchool magazine. Use the questions in the box.

Wheredo you live? Whatmusicdo you like?What's your favourite subject at school?

Do you buy lots of CDs?Do you like Clifton Hillschool?

elifton Hill MagazineThis week's interview is with Jack MitchelL. He'sa student at Clifton Hill schooL.

CH Hi, Jack.1 ?

jack Yes, i do. i think it's a really good schooland I've got lots of friends here.

CH 2 ?

jack Ilive very near the school, in Mill Road.

CH 3 ?

jack Ilike maths, drama and P.E., but myfavourite subject is music.

CH 4 ?

jack Ilike lots of different music, but especiallyrapo i play rap at the school club.

CH 5 ?

jack Yes, i do. i think DJs need to listen to newmusic. i spend lots of money on CDs.

CH Thanks very much, Jack. We think you're agreat DJ!

~~~~~~~~~~~~~~~~~~ Project idea! <4

~ ~r~~~~v~w~o.:.y~~C~~~~z~~ _ ~

Unit 5 Myday -ili

Germany Japan America yourcountry

start school X X ./at 9 o'clock

wear a X ./ Xuniform

cleanthe X ./ Xclassroom

bowto the X ./ Xteacher

do a lot of ./ ./ Xhomework

VocabularyAdjectives: school

2 Complete the sentences with the adjectivesfrom exercise 1.

i look out of the window when the lesson is

boril1tf.

1 Some students shout and laugh at schooL.They're very _'

2 My brother thinks maths is _' Hisanswers are always correct.

3 My teacher is very _' She gives us lots ofhomework and we always do it.

4 Students don't talk in exams. The room is

very _'S i like geography. Books about other

countries are very _'6 i don't always understand chemistry. i think

it's very _'7 The teachers at my school are _' They

talk to us and laugh with us.

3 Write five sentences about your schooL. Usesome of the adjectives from exercise i.

i Me my 8chool becatl8e the teacher8 are frientl/y.

i tlOI1'tlike chemi8try becatl8e it8 tltffictllt

mil Unit S Myday

Reading4 Read the essay and choose a title.

a A bad school

b My primary schoolc My ideal school

tA!)sdiool is ver!) smdll. lhe.re dC'e on~ aboot onehundre.d stude.nts and lots of the.m dC'e IIL!J

friends. lhe. teac.he.rs dC'egeat) too. lhe.!)irealWd!)sfriend~) and we lauih t0ie.the.r.

We donit start school edC'~ in the. mornini. Westart at ten o 'clock and we donit wedC'a school

uniform.

At IIL!Jschool) we donit \edC'nmaths or science.be.cause. the.!)'re difficult and borini 5U~eds.1irst) we pld!)football or vol\e!)ballfor fort!)-five

minutes. lhe.re 's a swimmini pool in the. school)so we sometimes io swimmil1,8Jtoo. 1he.n wehave a drama \esson. it iS a ver!) nois!) \esson)but i love it!

After that) it 's time for lundi. We eat fruit) ice.cream and diocolate cak. lhe.re 's an Internet

room in m!)school) so in the. afternoon) Wc:pld!)computeriames and visit interestini websites onthe. Internet.

1inal~) we finish sdiool at two o 'clock. We don'tdo any homework!

5 Read the essay again and find five of theadjectives from exercise i. What do theydeseribe?

friel1t1/y - the teacher8

6 Discuss the questions.

1 What are the good and bad things about thisschool?

2 Would you like to go to this school?

Speaking7 Discuss the questions.

1 How many students are there in yourschool?

2 What time do you start and finish school?3 Do you walk to school?4 Do you wear a school uniform?S What do you eat for lun ch at school?6 Do you do homework in the evening?7 What are the good and bad things about

your school?

WritingAn essay: sequencers

8 Look at the sequencers in the box. Findexamples of them in the essay on page 48.

after that then finally first

9 Read the Look! box. Then choose the correetalternatives to complete the text.

Look!

We use sequencers to talk about the order ofevents.

First = the first action

After thatlthen = the next actionFina/ly= the last action

On safurday i gef up af 9 o'Clock.

1 Finally/ Firsl, i have a shower and2 lIten/ finally i have breakfasf.3 Firsl/ Afler Iltal, i go fo foofballpracfice and 4 Ilten/ firsl i have lunchwifh my friends from fhe feam. In fhe

affernoon, I meef my girlfriend and we

go shopping. I wafch Tl! wifh my familyin fhe evening.5 rlten/ Finally, I go fobed af abouf 11 o'clock.

10 Write an essay with the title My ideal school.Use the sequencers from exercise 8 andindude this information.

· start and finish times· number of students· teachers· uniform· subjects. foodjdrink for lunch

1 Complete the song with lines a-d. Thenlisten and check your answers.

a Stayout Iate, it's OK,b We wake up, we go out,

c That we are young, we are free,d See our friends, see the sights.

We are young, we are free,Keep our teeth nice and dean.1

We're alright.2

Have a laugh, scream and shout,See our friends, see the sights.We're alright.

Are we like you? i can't be sure.i see you, you see me.It's our world, we agree ...

3

Keep our teeth nice and dean,Meet our friends, see the sights.We're alright.

We get cash, shop all day4

See our friends, talk all night.We're alright.

2 Match the words and phrases with thedefinitions.

1 see the sights2 have a laugh3 scream4 cash

a have fun

b moneyc see famous placesd make a loud no ise

3 What do you do with your friends?

UnitS Myday..

Mel

Jacl<Mel

Jacl<

Freetime

Tom's gotjustin Timberlake's new CD. Doyou want it for the school club?No, thanksI

Oh, why not? What's the matter?Why do you talk about Tom all the time?

That evening. At Holly's house.

Holly So,... teli me about Tom. Do you like him?Mel Yeah.He's reallynice.Holly i think he's great. Does he like you?Mel Yes, he does. We're goad friends.Holly But,... does he want to be your boyfriend?Mel Of course not! jack's my boyfriend.

HollyMel

HollyMel

Holly

Mm...

But jack doesn't like Tom.

Really?Why?Well, Tom's good at football. Hegoes swimming and playsvolleyball, too. He's got a moped ...and ... jack thinks I'm keen on him.

Hmm. You've got a problem! Weneed apian.

Afew minutes later.

Hi, jack. It's Holly. Can you come to myhouse on Saturday?Sure! What's the matter?

i need help with my maths homework.

OK!See you on Saturday.

.. Unit 6

PresentationBefore you read

1 Look at the photos. What do you think?Answer the questions.Photo A

1 Why is Jack angry?Photo B2 Who do Mel and Holly talk about?Photo C3 Why is Me! sad?Photo D4 Who does Holly telephone? Why?

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. Q

3 Read the story again. Are the sentencestrue (..") or false (X)?1 Jack wants Tom's new CD.2 Holly likes Tom.3 Me! isn't friends with Tom.4 Tom wants to be Mel's boyfriend.5 Tom's good at sporto6 Jack's good at maths.

4 Complete the expressions.

Useful expressions

1 What'sthe _?2 He's_ nice.3 We're_ friends.4 Of_ not!5 Seeyou_ Saturday. J

5 Listen and repeat the expressions. Q

6 What do you think? What's HoUy's plan?

Act it out!

7 Act out the story. Work in groups of three.

VocabularyFree time activities

8 Match the pictures with the words in the box.

gymnastics fishing swimming chess karatevolleybali sailing cycling table tennis

9 Read the information in the Look! box. Thencomplete the table with the words fromexercise 8.

Look!i

i

J

We use play with bali games and board games.

We use go with sports ending in -ing.We use do with other sports.

--- -- -

play

volleyball

dogo

swimmil1q

10 Think of more free time activities and addthem to the table in exeidse 9.

11 Work in pairs. Which activities do you do?

i play volleyball, bvt i dOl1t qo cyclinq.

Unit 6 Freetime mil

GrammarPresent simple (he/she/it)

1 Look again at the Clifton Hill story andcomplete the sentences.

. He1_ swimmingand2_volleyball, too.

ek 3 4. Ja _ _Tom.2 Read the sentences in exercise 1 and

complete the nile.

To make the he!she!it form of the presentsimplewe add i_to positive verbs.Weuse2_before the infinitiye in negative sentences.

3 Look at the spelling rules in the Look! box.Then write the verbs in the hejshejit form.

Look!

Spellingrules (he/she/itform)

like-likes try-trieswatch-watches do-does

1 go -3 liye -5 wash -

2cry -_4 use -_6 study -_

4 Complete the sentences to make them truefor you. Use the verbs in the box in thepresent simple.

.i.+ke ride watch play(x2) study use

My sister cloesn't/il;.emaths.

1 My dad chess.2 My best friend3 My sister4 My brother5 My mum6 My teacher

sportoTV after schooL.

English at the weekend.a horse.

a computer.

Pronunciation

5 Listen and repeat the verbs. Then writethem in the correct place in the table. Q

tries washes goes cries eats carries

likes Isi does IZ!

tries

watches /iz!

.. UnIt 6 Free time

6 Complete the questions about Tom with thewords in the box. Then match them with thecorrect answers.

go Where Does Which

f)oes Tom go to Clifton Hill School?Yes,he does.

1 _ Tom like Justin Timberlake?2 Does he _ to Holly's school?3 _ does Tom liye?4 _ sports does Tom like?

a No, he doesn't.

b Football, swimming and volleyball.c Yes,he does.d In Manchester.

7 Make questions with the words and completethe dialogue.

Teacher Tell us about America, Tom!Who j favourite American sports star?Wft08 yoiir (avollrtte American sfJortsstar.?

Tom I like Tim Duncan.

Teacher he j play j American football?1

Tom No, he doesn't. He's a basketballplayer.

Teacher Which team j play for?2

Tom He plays for the San Antonio Spurs.Teacher How old j he?

3

Tom He's about twenty-five.Teacher What j he j do in his free time?

4

Tom He likes films and he plays videogames. He's a fantastic swimmer, too.

8 Work in pairs. Ask and answer questionsabout your favourite sports star.

VocabularyCompound nouns

1 Match the words to make compound nouns.Use a dictionary.

sports sl10es

1 sports

~rod

2 football racket

3 fishing shoes4 swimming boardS chess court

6 baseball pitch7 volleyball glove8 tennis costume

Listening4 Read the rules of a radio quiz game and look

at the players' questions. Which question isnot possible?

GUESSTHE S?C>riTS?EriSc>nAl..,ITYl

5 Listen to the radio quiz game. Which sportdoes the sports personality play? Q

6 Listen again and choose the correctaltematiyes. ~

1 The sports personality is a manjwoman.2 Hejshe playsjdoesn't play a team sporto3 Hejshe plays insidejoutside.4 Hejshe usesjdoesn't use a tennis racket.S Hejshe plays on a courtjpitch.6 He'sjshe's from ItalyjBrazil.

7 What do you think? Who is the sportspersonaHty?

2 Complete the table with the compoundnouns from exercise i.

Places ClothesEquipment

tennis rad.et

3 Match the definitions with the compoundnouns.

1 You play tennis with this. tennis racf,;et2 You use this in basebali.3 You wear these on your feet.4 It's usually black and white.S You play football here.6 You wear this in the swimming pooI.7 You play volleyball here.8 You catch fish with this.

a Does she use a tennis racket?

Does she play a team game?

8 Listen to the last part of the quiz game.Check your answer to exercise 7. ~

Speaking9 Work in pairs. Play Guess the sports personality.

A Is yoiir sports persOt1ality aman?

B No, it isn't:

A OK Its a woman. f)oes sl1e lise a tennis racJ:;et?

B No, sl1e doesn't:

Vnit6 Freetime..

Reading1 Look at the photos of a leisure centre and

discuss the questions.

1 Which sports do you think people do there?2 What is the man' s job?

This week' s article is by Mark Davies,a lifeguard and swimming teacher atRiverstone Leisure Centre.

1 In the morning, I'm a lifeguard in the fun

poo!. There are always four lifeguards in thispoo!. One lifeguard watches the swimmersfrom a high chair. The others walk aroundthe poo!. The fun pool has got a fantasticwave machine. It's like swimming in the sea!

i usually enjoy my mornings, but the poolsometimes gets very noisy!

2 In the afternoon, i work in the training

poo!. In this pool, people swim to keep fitWe also teach swimming in the trainingpoo!. i teach adult beginners twice a week.That's on Tuesday and Wednesday.

3 Read the artiele again and answer thequestions.

1 When does Mark work in the fun pool?2 How many lifeguards are there in the fun

pool?3 What doesn't he enjoy about the fun pool?4 What does Mark do in the afternoon?5 How often does Mark teach swimming?6 What facilities does he use at lunchtime?7 What does he do before work?

.. Unit 6 Free time

2 Read the artiele and check your answers toexercise i. ~

3 At lunchtime, i often use theother faci/ities in the leisure

centre. There's a very goodgym and a fantasticclimbing wa/l!i climb the wa/l aboutthree times a week. i also

go swimming every daybefore i start work.

i /ike myjob at the leisurecentre. It's never boring!

4 Read the definitions and find the words inthe artiele.

1 Moving water in the sea. (paragraph i)2 To like. (paragraph i)3 Not a child. (paragraph 2)4 These people learn something new.

(paragraph 2)5 Places where you can do something.

(paragraph 3)

5 Would you like to be a lifeguard?Why? fWhy not?

GrammarAdverbs of frequency

1 Read the sentenees from the artiele on

page 54. Then eomplete the bar ehart withthe eorrect adverbs of frequency.

. i usually enjoy my momings.

. There are always four lifeguards in this pool.

. The pool sometimes gets very noisy.

. It's never boring!

. i often use the other facilities in the leisurecentre.

usually always never sametimes aften

100%

80%

50% 3

30% 4

10%

5

2 Look again at the sentenees in exercise i.Then choose the eorrect alternatives.

1 We use adverbs of frequency before/after themain verb.

2 We use adverbs of frequency before/after theverbbe.

3 Complete the sentenees with adverbs fromexercise i. Make the sentenees true for you.

i sometimes go to bed at midnight.

1 i _ play football at the weekend.2 My mum _ drinks coffee in the evening.3 English lessons are _ interesting.4 i _ have lunch at schooL.

5 Myteacheris _ Iatefor class.6 i _ listento rap music.7 i _ getup earlyon Saturday.8 My family _ goes on holiday in August.

Expressions of frequency

4 Look at the expressions in the tables. Thenlook again at the artiele on page 54 and findthree examples of the expressions.

oncetwicethree times

adaya weeka year

every

morningafternooneveningdaymonth

5 Rewrite the sentenees to make them true.

In my country, ...

students go to school once a week.In my cOtlntry, they qo to school five times a week.

1 people have breakfast three times aday.2 teachers give homework once a month.3 students have English lessons every month.4 people go to work twice a week.5 people eat hamburgers every day.

6 Work in pairs. Ask and answer the questions.

A tlow of ten do yOtl do sport?

B i do karate tw/ce a week and iplay football

everyday

SDorlsSurvey1 NowoftendoYOUdosporl?

2 Whal'syour'avourilespori?

3 NowoftendoYOUPlayyour'avourllespori?

4 WhodoyOUUSuaiiyPlayWilh?

5 WheredoyOUusuallyPlayyour'avourilespori?

UnIt6 Freetime..

Reading1 Read the profile of Seb Clover and complete the fact file.

. --_.

Seb Clover is mad ab

.

o.

ut sa iling.

!

..

He's alsovery good at it. Seb ls only fifteen yearsold, but he's already got a world record.

He's the first young person to sail across theAtlantic Ocean on his own. That's a journeyof 24 days and 2,700 miles.

VocabularyAdjectives + prepositions

2 Write the correct preposition foreach adjective.

on ffi about at(x2)

He's interested if/ trains.

1 She'skeen_Britney Spears.

2 He'smad_chess.

3 She'sgood_gymnastics.

4 He'sbad_football... Vnit 6 Free time

Seb's family lives in Cowes. It's a town onthe Isle of Wight, in Britain. Cowes is famousfor its boats and sailing. Seb's father is alsoan excellent sailor. He's a teacher at a localsailing schooL. Seb goes to Ryde School, onthe Isie of Wight. He makes his sailing tripsin the school holidays, of course!

~I\CTFILEi\hiiii~

'JVurli.! j{:;r;!)H.!

YOUf/qs% At/af/tic crosC;If/tjH!JIii~

Jdl!;!)1

i

i~...~;;a.-.~

3 Write five sentences about yourself. Use theadjectives and prepositions from exercise 2.

/m tjootlat matits./m maCi about raii mt/sle.

Listening4 Listen to Maria. What sports does she play? ~

5 Listen again. Are the sentences true (.I')or false (X)? ~

Maria plays tennis every day. X

1 Maria plays tennis at schooL.2 She likes watching tennis on TV.3 She's got two favomite tennis players.4 Maria thinks the Williams sisters are fast and

athletic.S Martina Hingis is from Switzerland.

WritingA profile: using notes

6 Look at the notes about famous sportspeople. Change the notes into sentences.

ROI\.O-L&O i Re..O-L tY\o..&n:'&

ROt1alt/oplaya for Real Mat/nd.

DO-VL&Be..c.kh.O-Mi Li\. o- ve..0 bL~ h.OlAse..

L TLM DlAl\.c.O-I\.I~oo& o--t bo-ske.. -tbO-LL

3 tY\O-r-tLI\.O- HLI\.~LS lf'roM 3LOvo..kLO-

'f- 3e..b c..LOve..ri o- WOrLdre..c.on~,

s" 3e..re..1\.0- 0-1\.& Ve..l\.lAS WLLLLO-MSi SLS-te..rS

7 Look at the fact file and answer the

questions about Yasemin Dalkiliç.

1 Which spon is Yasemin good at?2 How many world records has she got?

~\\C T FIlE

~(i')"JriL'

.. ',;'0'" ~i. ', ( i. i

~/ "~a\~-- ;i~,,

.

~r-

..

~~' \-, , -"

, .tlo',.:.

~ .J;'\.,

.,'*, i~.. J

i" .

.,/

\?:~~: /./~ .':,-~,/.

.-"

i'lwii~ Yasemin Dalkiliç2

!hi!~ !.ii~Irtii 2 May 19793

JI'!.Ir! Diving4

'N!.Iri!.! i{:,>i;IJri.l:i three

world recordsfor diving51-

HIJiri~Ankara,Turkey

;~\~\\~

6

IJiii'j;Jl:iiiy METU(MiddleEastTechnicalUniversity),Ankara

8 Write a profile of Yasemin Dalkiliç.

· Change the information in the fact file imosentences.

· Add so me of your own ideas to the fact file.· Use some of the adjectives and prepositions

from exercise 2.

~~~~~~~~~~~~~~~~~~ Project idea! ~~ Chaaseanather famaus sparts persanality. Make ~

~~~~~~:~~~~~~~~~~-~

1 Answer the questions. Then read the key.

2 How sporty are you? Tell the class.

Howsportyareyou?-- -1 Howoftendoyougofor a walk?

a Everyday.b Twicea week.c Oncea week.

2 There'sanimportantfootballmatchinyourcity.Whatdoyoudo?a i buya ticketandgoto thestadium.b i watchthematchonTV.c i don'twatchthematch.

3 Whatdoyoudo in thesummerholidays?a i swimat thebeachandplaya lotof sport.b i playsomesportwithmyfriends,but i alsorest.Jc i preferto doa hobbyor reada book.

4 Whendoyouplaysport?a rm in a sportsteam.i playeveryday.b i oftenplayfootballor basketballwith my

friendsafterschooL.c i onlyplaysportin my P.Elessons.

5 Areyoua footballfan?a rm madaboutmyteam.i buypostersand

footballshirts.b Notreally,but llike towatchmyfavourite

teamonTV.c rm notinterestedin football.

i

6 Howmanysportspeopledoyouknow?alknow thenamesofa lotof sportspeople.b i knowthenamesof theplayersin thenational

footballteam.c i don'tknowthenamesof manysportspeople.

-- -'isfiu!4~Ja4~0

JOIaw!~PU!1~n8jAiiodsAJal\aJenOA

.aiii JnoAU!sfiu!4~Ja4~0aJeaJa4~~n8jhiiods a~!nbaJenOA

jnoAJOIpoofi osieS!iiods ~nq'~eaJfis,~e41.'IJOM1004:>s~epoofi aJenOA

Sl - Çi !,

p~ - ~~

Ol-9

~u!odL= :>JaMSUVi

s~u!odL = q JaMSUVis~u!odf = e JaMSUVIAa)!

J

UnIt6 Freetime...

Li

Revision (Units 5 & 6)

GrammarPresent simple

1 Complete the text with the verbs in the box.

ride practise go have live playwatch get up walk

MY DAY

M,/ t"\a..r"Y'\e.)sTir"Y'\.i 1_ wi+h r"Y'\,/.fa..r"Y'\il,/ it'\ Liverpool, a.. c.i+'f it'\ Bri+a..it'\.

I)r"Y'\ Six.+e.e.t'\ a..i"'1 i 2_ +0 Me.rse.,/Sc.hool. M,/ be.s+ .frie.i"'1s a..re. Mike.a..i"'l t; r"Y'\i 1,/ .

3Ot'\ SCohool da..,/s i _ a..+ Se.vet'\4o)c.loc.k. M,/ .fa..+he.r a..i"'l i _

bre.o..k..fa..S+ +S3e.+he.r. A+ e.i~h+ o)c.loc.kt;r"Y'\il,/a..i"'l i _ olAr bic.,/c.le.s +0SCohool. Mike.)s holASe. is t'\e.a..r +he.

6SCohool, So he. _'A.f+e.r olAr le.ssot'\S Mike. a..i"'l i o.f+e.t'\

7_ .foo+ba..II. t;r"Y'\il,/iS r"Y'\a..da..b01A++e.t'\t'\iS. She.)s it'\ +he. SCohool +e.t'\t'\iS c.liAb

a..i"'l she. 8_ +e.t'\t'\iSe.ver't da..,/.

It'\ +he. e.vet'\i~ r"Y'\,/pa..re.t'\+s a..i"'1 i91ASiAa..1I,/_ TV +o~e.+he.r.

2 Rewrite the sentences to make them true.

Tim lives in Manchester.

17m tioesn't live in Manchester. He nves in Livetpool

1 Tim gets up at half past seven.2 Tim and Emily walk to schooL.3 Mike rides his moped to schooL.4 Tim and Mike play basketball after schooL.5 Emily likes table tennis.6 Tim and his parents listen to music in

the evening.

BII Revision (Units 5&6)

3 Write questions.

WeekendsurveyWhattime/you/usually/getup/at theweekend?What time tio yOtltlstlally qet tip at theweekenti?

1what/ youandyourfamily/ haveforbreakfast?2 yourfather/ goto work/ onSaturday?3 you/ sometimes/ doyourhomework/ at the

weekend?4 youandyourfriends/ usually/ playa sport/ at

theweekend?5 what/ you/ do/ onSaturdayaftemoon?6 whattime/ you/goto bed/ onSundayevening?

4 Work in pairs. Ask and answer the questionsin the survey.

5 Complete the interview from the Clifton Hillschool magazine.

elifton HillThis week' s interview is with Mel Jones, astudent at Clifton Hill schooL.We ask herabout her best friend.

CH Hi, Mel. Telius about your best friend.What's her name?

1Md Well, her name's Holly,and she

near me.(Iive)

CH Is she a student at Clifton Hill School?

2Md No, she (not go) to our schooL.She's a

student at Shaw College. It's a private schooL.

CH 3 (she / like) her school?

Md Oh, yes. Her teachers are very nice. They 4(help) her a lot.

CH What subjects 5 (the students / study)?

Md They 6 (study) English, maths, geographyand science, like us. But theyalsa learn other

languages. At clifton Hill SchooL,we 78(Iearn) French. But Holly (not learn)9French. The teachers at Shaw College

(teach) the students Spanish and Japanese. Holly ismad about languages!

VocabularySchool subjects

1 Match the quotes with the words in the box.

P.E. geography maths chemistry historyart biology English drama !:iii,inp.::,,tiirlip.::

TheJapaneseeconomyis very strongo

bUSIl1e88 studies

1 The capital of Bulgaria is Sofia.

2 This chemical is dangerous. Be careful!

3

Zeynep is Juliet in our play Romeoand Juliet.

The Roman dty of Pompei is over twothousand years old.

4 Elephantseat fruit and grass.

5

6 We use imperatives to give instructions.

7

Which students are in the school footballteam?

Vincent Van Gogh is a famous artist.

8 Answer this: 32 + 17 = ?

9

Adjectives: school

2 Look at the adjectives in the box. Write pairsof opposites.

e+g noisy boring interesting easy~ quiet difficult

bl9 - smail

Free time activities

3 Complete the sentences with the words in thebox. Use the correct form of play, go, or do.

volleyba/I swimming cycling chess karategymnastics sailing table tennis

Johnplays volleyballafterschooL. ~a

~~

1 Sam and his brother _everyday.

2 In the summer, Sarah _in the sea.

tR-3 They _ at schooL.

4 Mydad _ at theweekend.

5 Jenny _ at the leisurecentre. [tiD

~iit

6 I sometimes _ with mybest friend.

7 My brother _ in his freetime.

Compound nouns

4 Write the compound nouns.

i ·.fl$111119rM 1 v_ C_

2 f_ p_

~4 b -g-

{ J~ J','i ',,'

~~

5 s_ C_

6 s_ s_ 7 t_ r_

Revision(Units5&6)..

Friendship

In theschoolcanteen.

Mel It's Saturday tomorrow. I'm going togo shopping. What about you? Haveyou got any homework?

jacl< Yes,but I'm not goingto do it. Holly'sgot a problem with her homework.I'm going to help her with it. She'sgoing to study for a maths exam.

Mel Really?That's nice. You're veryhelpful! That's why Ilike you.

jacl< Oh,... er, ... thanks.

B

On Saturday.

Holly Hi, everybody!Mel IsJack here?

Holly Shh. He's in thelivingroom.

Tom Comeon!

...

Holly

Hi, Jack. Surprise! We've got a DVD!

We're going to watch films and eatpopcom all day. It's going to begreat.Fantastic! But when are you goingto do your homework, Holly?What homework? Oh, yes. Thereisn't really any homework. Sorry!It's a surprise DVDparty for you.Wow! Thanks, guys.

Mel

Tom

jacl<

Tom

jacl<

LGiLIUnIt 7

PresentationBefore you read

1 Look at the photos. What do you think?Answer the questions.Photo A1 Where are Jack and Mel?Photo B

2 Why are Tom and Mel at HolIy's house?Photo C3 What are they going to do?

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise i. a

3 Read the story again. Are the sentencestrue (.I) or false (X)?

1 Jack wants to go shopping.2 Mel thinks Jack is helpful. ,

3 Mel and Tom have got a DVD.4 They're going to watch a film.5 HolIy has got same homework.6 Jack is happy.

4 Who says the expressions?

Usetul expressions

1 That's nice.

2 Hi, everybody!3 (ome on!

4 Surprise!

5 Thanks, guys."""-

5 Listen and repeat the expressions. a

Act it out!

6 Act out the story. Work in groups of four.

VocabularyAdjectives: character

7 Look at the pictures and complete the tablewith the adjectives.

Positive

ltartl-wor/.:il1tj

-

~~(~ . =' .ii.

,{ ~",,'

;-: Li C-~ .;;;§ ,~~ ~- . .

hard-working

AJWhelpful

~ ~flt;;Yf',=~- -o \.~i~ce= ~ 00 G:oo--~~~,~ ~ ~ c:>0 ~

mean

cheerful

polite

Negative

jealous

selfish

~'Q

~,...""'"'"'" ':.Jçi .. ,

, . . ~

,',r,. ~

honest

bad-tempered

8 Complete the sentences with adjectives fromexercise 7.

1 _ people always say 'Please' and 'Thankyou'.

2 That's not true! Be_.

3 He's realIy _' He never thinks aboutother people.

4 My brother is very _' He always smiles.SOan't be _' Buy your mother a present

for Mother's Day.6 Tina is very _' She gets up at eleven

o'dock.

7 My dad is sametimes -' and he shoutsat people.

8 My sister works in a cafe from Monday toSunday. She's very _'

Vnit7 Friendship..

Grammar90in9 to (plans)

1 Look again at the Clifton Hill story andeomplete the table.

-- -- do it.YouWe 2~aren'tThey

. watch films.going to

istudy for amaths exam.

1---HeShe 3~isn'tlt

2 Choose the eOITed alternative.

We use going to to talk about habits/future plans.

3 Look at Mark's plans for the weekend andwrite sentenees. Use going to and not going to.

PiO-t\-S f'or -the.. we..e..ke..t\.&

, -t-e..le..ph..ot\.e.. ALAt\.-t- T O-t\-e..

, ~o SWCMMCt\.~

, h..e..lp mlAM Ct\. -the.. kc-t-c.h..e..t\.

, blA~ SOMe.. t\.e..w je..O-t\- s

, -t-c&~ -the.. ~O-rO-~e.., wO--t-c.h..o- f'oo-t-bO-ll MO--t-c.h..ot\. TV

telephone a friend

Mar,{" /s,,'t 90i"9 to teleplto"e a (rie"tI. Hes 90i"9

to telepltone lt/s aii"t.

i go to the cinema3 buy some new CDs5 tidy his bedraom

2 help his dad4 play football

90in9 to (questions)

4 Complete the tables.

1 i you/we/they, goingto

watch thematch?

2 he/she/it come?

Yes, i am./No, 3

Yes, he is./No, 4

Yes,they 5 ./No,theyaren't... UnIt 7 Friendship

5 Complete the dialogues. Use the eOITed formof going to

A Are yoii 90i"9 to invite Sally to your party?

B Yes, i 1 . i 2 invite all myfriends.

6 Complete the TV interview with the eOITedform of going to.

Thisweek:JohnShaw

~,i.Presenter i Welcome John. 1

(you/make) another film?

John i Yes,i 2 . But first of alL,13 (have) a rest becauseI'm very tired.14 (have) anice weekend

Presenter i What 5 (you/do) at theweekend?

John i Well, on Saturday i 6 (notget up) early. In the afternoon, myfriend Annie and i 7 (go)shopping.

Presenter i Great! 8 (you i go) onholiday this summer?

John i Yes, i 9 . But i 10

(not teli)you where I'm going to go!

7 Work in pairs. Follow the instructions.

Student A

You are a reporter for PaparazziMagazine. Youare going to interview a famous pop star. Askabout his/her plans for the future.

Student B

You are a famous pop star. Answer student 1\squestions.

A 34

buy youyour parentssome CDs?

B No, they 5 . They 6 buyme a computer game.

Listening1 What do you usually do at the weekend?

Where do you like to go?

/ Me meetintj my friends at the wee/(end. We of ten tjOto an ice cream shop in the town centre.

2 Listen to the conversation and tick the thingsJulia mentions. Is Julia's mother happy abouther plans? ~~ - i.. ~ _........-

<:1 1<

have a pienie Dmeet a friend Dgo shopping Dgo bowling Dhave lunch Dgo to the cinema Dplay computer games D

3 Listen again. Are the sentences true (wf) orfalse (X)? ~

1 Julia wants to meet Maria on Sunday.2 They're going to go to a pizza restaurant.3 Julia wants to see a film.4 Julia's aunt is going to visit.5 Julia's exam is to mo rrow.6 She's going to ask her father.

VocabularyAsking for and giving permission

4 Match the questions and answers.

1 Can i phone a friend?2 May i sit down?3 Can i use the computer?4 May i have your phone number?5 Can i go out on Saturday night?

a Yes, you can. But don't come home Iate!b Yes, of course. It's 01212 2444.c No, you can't. This seat is reserved.d Sure. No problem. Use my mobile.e Sorry, no. i want to use the Internet.

5 Complete the dialogues with the phrases inthe box.

Ma;<-I Can i Sorry Because (x2) problemMay of course can't

A May / go to the cinema with Charlie?1

B Yes, _'

A 2_ I go to the beach on Saturday?3

B -' no.A

BWhy not?4_ your exam is on Monday.

A May I play football after school?5

B Sure.No _.

J A 6_ play my new computer game now?7

B No, you _'A Why not?B 8_ you've got lots of maths homework.

Speaking6 Work in pairs. Follow the instructions.

Student A

Ask your parents' permission to do something.Think about these things.· What do you want to do?· When do you want to do it?· Who do you want to do it with?Student BYou are student Xs mother or father. Listen to

his/her plans.· Do you want to give permission?

Why?/Why not?

7 Now change roles and do the activity inexercise 6 again.

Unit7 Friendship..

Reading1 Look quickly at the letters. Where are they

from?

a a newspaper anieleb an advenc a problem page in amagazine

2 Read the first letter. What's Lucy's problem?Choose the correct alternative. ea She hasn't got any friends.b She's jealous of Kate's new friend.c She's selfish.

3 What do you think? What can Lucy do?

4 Read Polly's letter and check your ideas fromexercise3. e

5 Read the letters again and choose the correctalternatives.

1 Lucy has got a lot of friendsj one friend.2 Kate and Lucy are friends because they like

musicj sporto3 Lucy doesn't likejisn't good at tennis.4 Polly thinks Lucy is jealousjselfish.S Polly tells Lucy to make new friendsjfind a

new hobby.

6 Work in pairs. Which sentences are true foryou?

1 I've got three or fOUfgood friends.2 I've got one special friend.3 i talk to my friends about my problems.4 i talk to my family about my problems.

TeenageHelpline

Dear Polly

My friend Kate andi do everythingtogether. i really likeher. We've got thesame hobbies and we both like rapmusic. Kate is a really nice person andshe's my best friend. In fad, I thinkshe's my only friend. But now Kate hasgot a new friend, Sarah. She likesSarah because they play tennistogether after schooL.i'd like to playtennis with the m, but I can't playbecause I'm not very good at sport.I'm worried because I think Kate is

going to forget about me. I don't wantto be selfish, but what can I do?

Please help me.Lucy

BII Unit 7 Friendship

Dear Lucy

Don't worry.You justfeel abitjealous. You're right: Kate is going tospend a lot of time with her newfriend because they play tennistogether. But she isn't going toforget her old friends. This isn't aproblem. Ifs a chance for you tochange your life and make some newfriends. Youcan be friends withSarah, too!As you grow up, you' re going to makea lot of different friends withdifferent hobbies and interests.

Good luck!Polly

Grammargoing to (predictions)

1 Look again at poiiy's letter on page 64 andeomplete the sentenees.

. Kate 1 spend a lot of time with hernew friend.

. She 2

. You 3forget her old friends.make a lot of different mends.

2 Read the information in the Look! box. Then

look at the pictures and write predictions.Use going to and the verbs in the box.

Wecan alsa use going to to make predictiansabaut the future.

eat it ~ rain score a goal crashgo swimming ~ win the race

The man iS 90in9 to fa/I. The ear isn't 90in9 to stop.

7

would like to ii

3 Match the questions with the eOITectanswers.

1 Would you like to watch a horror film?2 Would you like to drink something?3 What would you like to do this afternoon?4 What job would you like to do?

a i'd like to go shopping.b No, i wouldn't. i hate scary films.e Yes,please. i'd like a coffee.d i don't know, but i wouldn't like to be a

doctor. It's a very difficult job.

4 Complete the dialogues with the eOITectform of would like to.

1 A i t:llik.eto get tickets to see the football matchon Saturday.1 come with me?

B Yes, 12 .Thanks.A i 3 buy the tickets today. They cost

HO each.B OK.Where 4 meet before the mateh?

A We can meet at my house at half past two.

2 A 5 go to the cinema tonight?6

B Yes,A Great. 7 watch that new film,

Shark Attack?

B No, 8 . I'm scared of sharks! Let'swatch a romantic film.

Look!

We can also use want to in informal speech.

i want to go to the beach tomorrow.Doyou wantto come?

Yes,i do.!No,i don't.-- -- - --

5 Work in pairs. Diseuss the questions.

1 What do you want to do after school?2 Which job would you like to do in the future?3 Would you like to visit other countries?4 Why do you want to learn English?

6 Teii the class your ideas.

Bit wants to 90 to tlniversify.Shet:llik.eto beadoetor.

UnIt7 Friendship..

Reading1 Read Ivan's e-mail to his friend Danny. Then

choose the correct altematives.

1 Ivan wants to have an exciting weekendbecause ...a his exams start on Friday.b his Iast exam is on Friday.

2 Ivan can go to the concert with ...a one friend.b four friends.

3 On Sunday, Ivan is going to see a film ...a with same friends.b with his brother.

1

i~ 0~[85end ~s W ~ ~ ~ i...rt fil -t. Pri.rity. IEOpti......

Hi Danny

How are you? Have you got anyplans for this weekend? Myexams finish on Friday, andI'm going to have a reallyexciting weekend!

My mum and dad have got fourtickets for the Shakira concerton Saturday night. Two of thetickets are mine, so i want toinvite you. i think Shakira'sbrilliant and i know you likeher. Would you like to come?You can come to my housebefore the concert.

On Sunday I'm going to watchthe new Bruce willis film with

my brother. It's a reallyfunny comedy film. Would youlike to come?

Best wishesIvan

.. Unit 7 Friendship

VocabularyAdjectives: descriptions

2 Read the sentences. Then match theadjectives with their opposites.

exciting borinq

i modern

2 funny3 brilliant

. This is a very exciting book. I can't stopreading it!

. Modern computer games are reallygood.

. I'm going to see a really funny comedy film.

. I think RobbieWilliams is brilliant! He's agreat singer.

. There are same old-fashioned elathes at themuseum.

. I sametimes go to sleep in sciencelessons!They're reallyboring.

. The weather is really awful taday. It's raining!

. I don't like 1V programmes about politics.They'revery serious.

3 Work in pairs. Choose adjectives fromexercise 2 to deseribe the places and eventsin the box.

museum football match shopping centreparty cinema picnic concert

bowling alley zoo beach

mllBeiim - o/eI-faBl1ionetianel borinq

4 Tell the elass your ideas.

/ elon't Me mliBelimB. / thinI;:hiBtory iB borinq anel /

elon't Me /ool;:inqat o/el thinqB.

Speaking5 Work in pairs. Choose same places and

events from exercise 3 and plan a perfectweekend.

· What do you want to do?· Where are you going to go?. Who are you going to invite?. Where are you going to meet?

6 Tell the class your ideas.

Were qoil1q to qo to the beach. Were qoil1q to have a

picl1ic al1t1...

WritingAn invitation:using a mind-map

7 You are going to invite a friend to dosomething at the weekend. Use your ideasfrom exercise S to complete the mind-map.

M~ we ek. et'\d

1 Work in pairs. Read the texts. Who is Jason'sgirlfriend? Why?

Who is Jason's girlfriend? ~. \

..1AsöN f~.. ~Jason lives in MortonRoad.He usuallL ~(...~> .walks to school with hisgirlfriend.They're in the sameclass and they're bothfifteen. Jason is polite and- -- ~-

cheerful. He doesn't like

bad-tempered people. At, the weekend he plays ,

football with his friends,and he goes to the cinemawith his girlfriendon

Sa1zday-evetfing:-He- --~o~sn'lJL~e .bomeworktbut.....tlls girlfrierl~helps him.

a BECkY is verypoliteandcheerfui.She'sgoingto watcha i

football match with some friends to day, because it's\Saturday. Then she's going to the cinema. She's good at

0(\ i drama,but she's lazyand she doesn't likehomework. i- -

a..f\<:!

8 Write an invitation e-maiL. Use the mind-mapand Ivan's e-mail on page 66 to help you.

. Tell your friend about your plans for aperfect weekend.

. Invite your friend to come with you.

~~~~~~~~~~~~~~~~~

, Projectidea! ~~ ~~ Makea posterabouta 'perfectweekend'. ~

~~::~~:~~~~~~~~-~

---

b i

liANNMthinksJasonisgoodatfootball.Shelikes ifi/ms,andshegoesto thecinemaonSaturday.Shewa/ksito school from Morton Road.She'sthirteen. .- ---- --- .....

c AL.Üi)öN is Jason'sneighbourandthey're in the sameclass.Shelovesfootball.WhenJasonplayswell,she'sveryfriendly,but she'ssometimesbad-tempered,too. '

dSARMis fifteen.Shelikesfootballandthecinema,but shecanonlygo to thecinemaonceaweek.Afterschoolshewalkshomeanddoesherhomework.Sheoftenhelpsherboyfriendwithhishomework,too!

- - -- -J----

UnIt7 Friendship~

Rules

A few days later.

Mel Hi, Tom.

Tom

Mel

Tom

Mel

Hi, Mel! How about going to afireworks show on Saturday?

That's a great idea! There's one atthe park in town. i have tobabysit for my little brother, butI'm free after seven o'clock.

Great! Shall we meet at eight?The fireworks are at half pasteight. Teli Jack and Holly!

OL<.i can't wait. Ilove fireworks.

Afterwards.

Mel Tom wants to go to a fireworks showon Saturday. i think it's a really goodidea. Why don't we go together?

Jack Sorry, i can't come. i have to do myhomework.

Mel

jacl<

Mel

jack

Mel

jack

We don't have to do it this week.

Yes,we do! It's for Monday. Anyway, ihave to visit my grandmother onSaturday.

Well, let's meet Iater!

No, i can't. My grandmother has to goshopping and i have to go with her.She's very old.

All right. Never mind. She's lucky tohave you!

I'm sorry. i'd rather go to thefireworks show with you.

~~ 45p)

BII Unit 8

PresentatIon

Before you read

1 Look at the photos. What do you think?Answer the questions.Photo A1 Where are Mel and Tom?

Photo B

2 Why is Jack unhappy?

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. ~

3 Read the story again and answer thequestions.1 When's the fireworks show?2 Where is it?

3 What time is Mel free on Saturday?4 What time is she going to meet Tom?5 What do es Jack have to do before Monday?6 Why can't Jack meet Mel on Saturday?

4 Complete the expressions.

1 I'm - after seven o'clock.

2 i can't _.

3 It's a reallygood_.4 -, i can't come.

5 She's lucky_!

5 Listen and repeat the expressions. ~

Act it out!

6 Act out the story. Work in group s of three.

VocabularyHousehold jobs

7 Match the pictures with the phrases in the box.

6

8 Choose the correct alternatives.

1 i always make/ do my bed in the moming.2 My litde sister never does/tidies her room!3 i often do/have the washing-up in the

evenings.4 i make/ dean my shoes every Sunday.5 My brother never tidies/takes out the rubbish.6 My dad sametimes does/makes the cooking

on Saturday evening.

9 Who does these jobs in your family?

My miim always tloes tlte coof;;il1tj,bllt Iltelp witlt tlte

wasltil1tj-lIjl.

Unit 8 Rules -ili

Grammarhave to

1 Look again at the Clifton Hill story andcomplete the sentences.

. i 1- babysit for my Httle brother.

. We 2- do it this week.

. My grandmother 3- go shopping.

2 Complete the grammar rules. Match the partsof the sentences.

1 Weusehave to ...2 Weusedon't have to ...

a when something isn't necessary.

b when something is necessary.

Wecan also use needn't to say that somethingisn't necessary.

It's Saturday tomorrow, so i needn't do myhomework tonight.

3 Write sentences with have to or don't have to.

Make the sentences true for you.

get up earlyi have to tjet t/fl early ottschool e/ays.

1 tidy my room 2 speak English at home3 do the ironing 4 clean my shoes5 babysit 6 walk to school7 do my homework

4 Complete the text about Tom. Use the correctform of have to.

get up earlystarts at seven o'clock. He (go) bybus because his dad to the footballstadium.

They 2-six! Tom and

(practise) for three hours.professional(train) very hard.On weekdays Tom 5washing-up aon Saturday hethe house becauseSunday he 7stay in bed!

lIIi8 Unit 8 Rules

..

iMaking suggestions

5 Look again at the CHfton Hill story andcomplete the table.

1going to a fireworks show?

Shallwe

Whydon't we2- at eight?3~ together?

4 ineet Iater!

6 Complete the dialogue with the phrases inthe box.

Sue at my

go out this evening. i haveto do my homework.

Sue OK. 2 go to the cinematomonow!

Tina Well, 3Sue

Tina

Tina

stay at home.watching a video?

meet at the

7 Work in pairs. Follow the instructions.Student A

Make suggestions to student B for the weekend.. play basketball. visit a friend

. go to a cafe

. go shoppingStudent B

Think about student A:ssuggestions and makenew ones.

A liowabot/t tjOitttjto the swimmitttj flool tomorrow.7

B i catt't tjo swimmitttj tomorrow. i have to hep mymt/tff. Let8 meet M St/tte/ayl

A OK Whye/M't we tjoshOflflitttj7

Listening1 Look at the photos. A teacher is going to

take her class on a school trip. Where do youthink theyare going to go?

2 Listen to the teacher and check your answerto exercise 1. Q

3 Listen again and complete the notes. Q

SC.HOOL TRIP

Da.,/ - Frida.,/Da.+e.- /s+h 1Cos+ - 2-The. blAs Ie.a."e.s

pOIAi"\ds

school a.+ 3

MUSt;UM RULt;S

No .food or 4,

No "",obile. 5-

Doi"\)+ +a.ke. 6

ii"\ +he. ""'IASe.IA""'.

4 What trips do es your schoolorganize forstudents?

Weplay bas/(etball matdres at otherschoo/8al1tiwesometimes qo to the theatre.

.....

VocabularySigns and rules

5 Match the signs with the rules in the box.

1

3

5 6

7

Spealdng6 Work in pairs. Plan a school trip. Discuss the

questions.

1 Where do you want to go?2 What do you want to do there?3 Where and when are you going to meet?4 What are the important rules for the trip?

7 Teii the class ab out your school trip.

We wal1tto qo to a cOl1certWe leam abol/t Mozartil1ol/r ml/sic le880118,al1ti we wal1t to hear hiS ml/sic.

Were qoil1q to meet at the cOl1cert hall...

8 Listen to other students' plans and vote foryour favourite school trip.

~~~~~~~~~~~~~~~~~

~ Project idea! ~

~~~:~:~:~~~~~~~~~

Unit8 Rules..

Reading1 Read paragraph 1 of the advert for a TV

programme and diseuss the questions. Q

1 What type of TV programme is it?2 Are there any similar TV programmes in

your country?3 Do you enjoy watching them?

2 Read the rest of the advert. Are the sentenees

true (.I') or false (X)? Q

1 There aren't any TV cameras in the academy.2 Star Academy is for music teachers.3 The students vote for their favomite singer.4 The winner gets a lot of money.5 The students don't have to go to the

music lessons.6 Students can visit their families in

the evening.

10

The twelve

15 and pe api e phone for

their favourite singer.

academy, students must be popular because

they have to win a lot of votes from the TV

viewers. Every week one of the students has

20 to leave the academy. The prize for the

winner is a cheque for one millian poundsand the chance to liye like astar!

lIiJI Unit 8 Rules

..

3 Mateh the words from the advert withthe definitions.

1 academy (line 5)2 talented (line 9)3 perform (line 14)4 vote for (line 15)5 viewers (line 19)

a These people watch the show.b Sing, dance or act for other people.e Very good at something.d Choose something.e A special kind of schooL.

4 Diseuss the questions.

1 Would you like to be a student atStar Academy? Why?jWhy not?

2 Are reality TV shows good or bad?

30

!:"

1#

Grammarmust and can

1 Look again at the last paragraph of the adverton page 72 and complete the sentences.

. You 1- get up early.

. You 2- go out in the evening.

. Your family 3- phone you, but you4- phone your family!

"2 Read the information in the Look! box. Then

match the parts of the grammar rules.

Must, mustn't, can and can't never change theirform.

i can ph one my family.

She mustn't miss a lesson.

We can't leave the academy.

They must work hard.

1 We use must ...

2 We use mustn't and can't ...

3 We use can ...

a to give permission.b when something is necessary.c when something is forbidden.

3 Read the rules for Star Academy and choosethe correct alternatives.

1 The students mustlmustn't take a singingtest before they start at the academy.

2 Students canlmust be good at music.3 Students can'tlmust stay at the academy in i

the evening.4 Students cani can't play sport in their free

time.S Students mustlmustn't work hard at the

academy.6 Students can'tlmust tidy their moms.

--

4 Complete the text with must, mustn't, canor can't.

mustn't and don't have to

5 Look at the sentences. Then complete therules with mustn't and don't have to.

. You mustn't wear shoes near the pooi.

. You don't have to wear swimming hats.

1 We use - to talk about rules.

2 We use - when you can choose todo something.

6 Complete the sentences to make them truefor you. Use mustn't or don't have to.

7 Work in pairs. Follow the instructions.Student A

Think of a place. Tell your partner a rule forthis place.Student B

Guess the place.

A Yoii Cem't eClt iii tltis picice.B lite clCl88room?

A No. yoliltClve to be qiiiet iii tltieSpicice.B A mileSelim?

A YeeS/

Unit 8 Rules ELI

Reading1 Read the dialogue between a student and an

athleties coach. Answer the questions.

i Is Jenny a good mnner?2 How often does she have to practise?3 Why can't Jenny come on Saturday?

,i

Jenny

Coach

1

i,

1

JennyCoach

JennyCoach

JennyCoach.JennyCoach

Jenny

Coach

Jenny

Coach

Do you thinkcompetitions?Well... You're a talentedmnner, but you have to practise.Yes, i know. How can i praetise?How about joining the athIeticsclub at this stadium?

Good idea, but what do i have to do?

You have to every moming. Aftera month, you're allowed to mn incompetitions!Really? When are they?There' s Saturday.Why don't you come and watch?Yes,please! That's great! What time is it?It's at eight o'clock in the evening.Oh no! i have to be at home on

Saturdayevening. It's my mother'sb irth day.

mn

i.

Wecan also use be allowed to to show permission.

You'ye allowed to run in competitions.

You'ye not allowed to miss any lessons.

IIJJI Uriit 8 Rules

~

Speaking2 Look again at the dialogue in exercise i and

complete the expressions.

3 Choose the correct alternatives.

A I've gotB Good What's her name?

class.~

A Excuse bus station?

B I'm not sure.jThat's fine. tourist.

at

4 Work in pairs. Follow the instructions.Student A

Tell student Babout these things.

. You've got a new computer.

. You can't meet tonight.

. It's your birthday.

. Your favourite team are the football

league champions.Student B

LIsten to student A and think of a repIy.

A Ive qot a new comptlter.B Titats qreat Can YOtlplay qames on it?

f

i l'm not )(2 , i know. ](3Good )(4 a pity. ](5 i think )(6 fine. ]

WritingA dialogue: making suggestions

5 Read Kirsty's e-mail to her music teacher andanswer the questions.

1 What do es Kirsty want to do?2 What talents do es she have?

j Dear Teacher

i want same advice. i want to be a pop star.i can sing and da nce, but i can't play anymusical instruments. i don't know what todo. Can you give me extra music lessons.

Can you help me?

Kirsty

1

i6 You are going to write a dialogue between

Kirsty and her teacher. What questions doesKirsty ask? What suggestions does theteacher make?

j

Questions

What do i haveto do.?

Suggestions

Howabol/t tak.in9

91//tar le880n8..?

~7 Write the dialogue between Kirsty and her

teacher.

. Include same of the phrases from exercise 2.

. Use your questions and suggestions fromexercise 6.

i~

Kirsty Do yol/ th/f!k.i can be a floflBtar.?

Teacher ye$, i think. BO. yol/ can B/f!9 and dance.

Yol/re very talenteri.

Kirsty qreat/ What do i have to do.?

8 Work in pairs. Act out your dialogues fromexercise7.

1 Com,plete the questionnaire. Then read the key.

2 How helpfuJ are you? Teii the class.

Are yon a helpfnl person?1 Your mother says, 'You have to tidy

your room'. What do you do?a Tidy your room.b Tell your mother you 've got homework.c Tidy your room for ten minutes and

then watch TV.

2 How often do you do the washing-up?aNever.b Sametimes.c Often.

3 Your father says, 'Take out the rubbish'.What do you do?a Take out the rubbish.

b Tell him you have to finish yourhomework.

c Phone a friend and then take out therubbish.

4 Your shoes are dirty. What do you do?

a Ask my brother or sister to dean them.b Clean them.

c Leave them. Your mother usuallydeans them.

5 How often do you make your bed?a Every day.b Never.c Once or twice a week.

/i~mop 11d1\\

juosldd inJdldl( AldA E dl,nox

'AZEIi!q E dl,noA SduiqdUIOS

inq 'inJdldl( AldA dl,noA SduiqdUIOS'ld~EUddi IEJ!dAi E AiqEqOid dl,nox

jOOi 'didOdd ldl(W JO )(U!l(l

'inJdldl( AldA i,UdlE nOA inq 'io°l(JS

iE WdpniS ~Uql0M.-plEl( E dl,nox

SI - II

01-9

S-o

- dl0JS inox 'Oq'S q'i q'i q'O q

'S e S'i e t'S e ç;'O e Z'S e I

A;})i./

i ;)

O;)

O;)

S;)

i ;)

Unit 8 Rules lIiII

-

Revision (Units 7 & 8)Grammargoingto

1 Complete the dialogue.~ - ~ -

Lauren

2 What are you going to do at the weekend?Write five sentences.

have to

3 Complete the e-maiL. Use the eorreet form ofhave to.

HiDanny,

Mum and Dadare awaythis weekendand we

1 (stay)at home. It isn't fair! We2 (do)the washing-upand we3 (take)rubbishout. And i4 (cook)the dinnerI i

5 (not do) the ironing - thaI-sAlice'sjob. Alice 6 (tidy) our roomsand she7 (make)our beds,too! i hopeshedoesn't touch my things. But she 8(not help) in the kitchen. It isn't fair!

Our friends9 (not do) jobs when theirparentsgo away.Theygo out and have fun.Pleasecome and seeus.We're so bored!Charlie

.. Revision (Units 7&8)

Making suggestions

4 Choose the correet alternatives.

1 .A1Let's/:J;lp\Vabout visit Peter tonight.B Good ideal \\That time 2shall wejwhy don't

we meet?

2 at the Internet

5I'd ratherjI have to do

3 A 6Let'sjHow about going shopping onSaturday?

B 71ean'tjI'd rather stay at home. There's areally good football mateh on 'IV.

cinema this

well' d rather ask Sarah to

must, mustn't, can and don't have to

5 Choose the eorred alternatives.

VocabularyAdjeetives:eharaeter

,

ji

1 Complete the words with a, e, i, o or u.

1 Lz y2 m__n3 s_lCsh

4 b_d-i-mp_cd5 p_Li-6 c h- _rCl7' 1 sJ----

8 h_lpCl9 h_rd-w_rk_ng

10 h_n_st

ii

j

Asking for and giving permission1

2 Write questions with the words in the box.Use Can i ... and May i ... .

1 apen

1 -i

i2

3

4i

ii

i

1-\

5

J

3 Mateh the answers with the questions fromexercise 2.

aNa, sorry. Your dad wants to send an e-maiL.b Yes,you can. Do you want vanilla or

ehocolate?c No, you ean't. There are sharks in the sea.d I'm sorry. This is a 'no-smoking' area.e Of course. What film is it?

f Sure. No problem. It's hat in here.

Household jobs

4 Look at the picture and write the list of jobs.

.2- ~.."

Cake

iii

r:~.~Things to do

1 Do the shoppil1tj.

Adjeetives: deseriptions

5 Choose the eorreet alternatives.

1 David Beekham is brilliantjawful atfootball. He scores a lot of goals.

2 Tomb Raider is a really excitingj old-fashioned computer game.

3 Tom Walsh is my favourite comedian. He'sso awfuljfunny.

4 i hate maths homework. It's difficult andboringjmodern.

5 My unde drives an old-fashionedjmodernear. It's fifty years old!

6 i don't like libraries beeause you have to bevery quiet and brilliantjserious.

7 1v game shows are awfuljfunny. i hatethem!

8 ModernjSerious computers are very fasI.

Revision(Units7&8) if.m

Bonfire Night.

Tom This is fantastic! Teli me about BonfireNight, Mel.

It's a special day for British people. Wecelebrate it on the 5th of November.

Tom Wow! Look at that! Ilove fireworks. Do yougive presents on Bonfire Night?No, we just have fireworks. We have smailparties at home, or big shows like this.

Tom This is great! In America, we have fireworkson the 4th of July, Independence Day.Where's Jack?

He's at his grandmother's house. He'shelping her with some jobs.Oh, right. Er, ... What about Holly?

She's at home. She isn't feeling welL.Oh, poor Holly! Is she OK?

i hope so.

There's a party at my brother's fiat soon.Can you all come?

Mel Great! i can help with the food if you like.

Tom Thanks. Maybe i can borrow some CDsfrom Jack.

Mel Mmm. Maybe.

Tom Wow! Look! Why don't you phone Jack?Telihim we're watching some fantasticfireworks. He's going to be really jealous!i know!

Mel

Mel

Mel

Tom

Mel

Tom

Mel

Tom

Celebrations

ELI Dnit 9

PresentationBefore you read

1 Look at the photos. What do you think?Which things are they taIking about?

fireworks DHolly Dschool DJack Da party D

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. Q

i

"i

3 Read the story again. Are the sentencestrue (v') or faIse (X)?

1 Bonfire Night is on the 5th of November.2 Tom isn't keen on fireworks.

3 Mel and Tom are at a big fireworks show.4 Jack is at home.5 There's going to be a party at Tom's house.6 Mel is going to help with the music.7 Tom wants Jack's CDs.

4 CompIete the expressions?

,

ii

1

1 lookat _!2 -, right.

3 Poor_!

4 She isn't - welL.

5 Can you - (ome?

6 He's going to be really -'

5 Listen and repeat the expressions. Q

6 Why is Mel worried at the end of the story?

i

1 Act it out!

7 Act out the story. Work in pairs.

VocabularyCelebrations

8 CompIete the words with af ef if o and u. Usea dictionary.

*~)/~~) ~t.#

*f(f*Ti~t"~'

1 Cr- works 2 p_rad-

3 pes_nt 4 cosI-m-

5 decetions 6 sw- _ts

7 crd 8 c_k-

9 CompIete the sentences with the words fromexercise 8.

In Turkey, a lot of people have Jecorati0t18intheir houses at New Year.

1 In Britain, people give a special - totheir friends on their birthdays.

2 In many countries, people eat - tocelebrate the end of Ramadan.

3 A lot of British people watch a - showon November the fifth.

4 In Rio de Janeiro, there is a big -through the streets for Camiva!.

5 In America, a lot of people wear a colourful- for Halloween.

6 In Britain, people send a - to theirfriends to celebrate Christmas.

7 In many countries, a wedding - is tall,with special white sugar on it.

10 Discuss the questions.

1 Which special days do you celebrate?2 When do you have decorations in your house?3 How do you celebrate your birthday?4 Which is your favourite celebration?

Unit 9 Celebrations -ili

GrammarPresent continuous (positive and negatiye)

1 Look again at the Clifton Hill story andcomplete the tables.

'mwearing a costume.am

12- some fantasticfireworks.You/We/They .. are

34- her with somejobs.

He/She/lt is

'm notam not ieating a hamburger.

I I h Iaren't .

1

.1. .

You We T ey... t ..>isteiimg.are no

He/She/lt5

is not6 well.

2 Complete the grammar rule.

Weuse the present continuous for actions thatare happening now/happen every day.

3 Read the Look! box. Then look at the pictureand complete the text with the verbs in thebox. Use the correct form of the presentcontinuous.

Spelling rules (-ingform)

watch - watching sit - sittingdance - daneing die - dying

lt' s the day of tAe carnival parade in our town,and lots of people are havll1tjfun.

The parade lorries 1 slowly along thestreet. On the blue lorry, aman 2 acarnival sOIlg.The driver of the lorry 3and a policeman 4 with a woman ina red costtime. They alllike the music.

Two children 5 near me and a boy6 cola. I'm a newspaper reporter.Can you see me Iri the picture? i 7glasses and i 8 about the carnival inmy notebook.

4 Write five true and false sentences about the

picture. Then close your book and say thesentences to apartner.

A The tali mal1 011the lorry 18 wearll1tj a redjacket

B ralse. Hes wearil1tj a pt/tple jacket

}

BII Unit 9 Celebrations

Listening1 Look at the photo and answer the questions.

1 Where are they?2 What time of year is it?

2 LIsten to part of a radio programme aboutChristmas. Which people are talking on theprogramme? ~

a nurse

a patient in hospital

D a doctor

D a reporter

DD

3 LIsten again. Are the sentences true (I') orfalse (X)? ~

1 British people like to spend Christmas withtheir families.

2 Linda doesn't like her job.3 Linda has got a special cake for the patients.4 Doris is a nurse at the hospitaL.5 Doris is unhappy taday.6 Doris wants to see her grandmother.

4 Discuss the questions.

1 In your country, whieh people have to workduring important celebrations?

2 How do you think they feel about it?

Vocabularymake and do

5 Complete the table of expressions with thewords in the box. Use a dictionary.

make

mal:.e a cal:.e

do

----

6 Complete the sentences with the expressionsfrom exercise 5. Use the present continuous.

Listen! He S mal:.il1qaSt/qqestf(JI1and I thinkit's a good idea.

1 My brotheruniversity.

2 I can't sleep because my neighbours

in economies at

. She' s at the3 Sarah

supermarket now.4 My mum's in the kitchen. She

for my birthday.5 I've got a maths lesson tomorrow, so I

now.

6 I because we haven't got anydean cups and plates.

7 I think you -right answer.

. That isn't the

7 Discuss the questions.

1 When do you usually do your homework?2 Do you do any courses after school or at the

weekend?

3 Where do you and your family usually dothe shopping?

4 Can your mother or father make nice cakes?

Speaking

8 Look at the photo. What do you think?

1 What nationality are the people in the photo?2 Where are they?3 Why are they celebrating?

9 Imagine you are a radio reporter. It's NewYear's Eve and you are with the people in thephoto. Deseribe the people and say whattheyare doing.

liello al1d welcome to the jJroqramme. Its tel1 mil1t/tes

to twelve 011New years fve al1dl'm stal1dil1q...

Unit 9 CelebrationsELI

Reading1 Read the sentences about Valentine's Day.

What do you think? Are the sentencestrue (.I') or false (X)?1 Every year people give 50 million flowers on

Valentine's Day.2 Men buy 50% ofValentine's Day flowers.3 Every year people send a million cards on

Valentine's Day.4 Women send 85% ofValentine's cards.

2 Read the magazine artiele quickly and checkyour answers to exercise 1. Q

3 Choose a title for the artiele.

a An awful Valentine's Dayb A jealous girlfriend on Valentine's Dayc Romantic ideas for Valentine's Day

i 1V I . ' D Y

.. .1

.a entine s ay. ou're sitting quiet yin a

restaurant with your girlfriend. What's shewearing? There's a delicious meal front of you.What are you eating -music is playing softly. Whid1 songare you listening to?

:lYou're holding a ,

girlfriend. What is it? There's a good chance thatyour present is flowers! Fiftymillion people giveflowers on Valentine's Day, and 3 out of 4 ofthose people are your girff(ienclhas got a card for you. people send alot of Valentine's cards - about one billion!- andwomen send 85%of them.

8 Butsome pebple cfon't~(jsts~hd lrbwers andcards on Valentine's Day. Oliver Brownis fromNottingham. He's celebratingValentine's Day in

. . --

ii redroses for hundred redballoons. He's going to tie the balloons to thetree her gari:is-11and sing to her!

'ILI

+Teresa Smith from Manchester always goessomewhere special with her boyfriend onValentine's Day. Everyyear they thin i<of a

they're going to go toa roller coaster.

5 Daniel Bates from has also got a crazyValeiitine's idea:., take his girlfriendon a Doaton the middle of the night.At midnight, he wants to asi<her to marry him.

only about flowers andng crazy this year and

''''f' 'o',

4 Read the artiele again and complete thesentences.

1 Valentine's Day is on ...2 On Valentine's Day, men often give ...3 Men send 15% of...4 Everyyear Teresa and her boyfriend go to ...5 At midnight on Valentine's Day, Danid Bates

and his girlfriend are going to be ...

5 Read the definitions and find the words inthe artiele.

1 Very nice, a good taste. (paragraph 1)2 To have in your hand. (paragraph 2)3 People have fun on this special train. it goes

very fast. (paragraph 4)4 Twelve o'clock at night. (paragraph 5)

i

l .. Unit 9 Celebrations

6 Discuss the questions.

1 Do you think Oliver, Teresa and Daniel areromantic? Why?jWhy not?

2 Which of these things do you think areromantic?. a card. chocolates

. flowers

. a meal in a restaurant

~~~~~~~~~~~~~~~~~, Project idea! ~~ Preparea (ard for Valentine's Day.Write a short ~

~~:~::~~~~:~~~~~~-~

GrammarPresent continuous (questions)

1 Look at the picture and ehoose theeorreet answers.

1 Is the gid wearing a white dress?Yes, she is./No, she isn't.

2 Are they sitting in a rtstamant?Yes, they are./No, theyaren't.

2 Complete the table.

Am

making a cake?

daneing?

1 you/we/they

he/she!it2

3 Work in pairs. Ask and answer questionsabout the picture. Use the present cantinuous.

they / listen to music?A Are they!isteninrj to ml/sic.?

B ye$, theyare.

1 the boy / give the gid same flowers?2 he / wear a black jaeket?3 they / smile?4 the gid / hold a card?5 they / eat a sandwich?

4 Read the examples. Then write the questions.

Whats she Weallflrj.?

She's wearing a red dress.

? They're drinking lemonade.? They' re having dinner

at a restaurant.

? She' s talking to her

12

3

boyfriend.4 ? They're playing a

romantic song.

---------

Adverbs

5 Read the example sentenees and answer thequestions.

. The music is very loud.

. He talks loudly.

. LIz is a slow driver.

. David drives slowly.

1 Adjectives deseribe nouns. Which words areadjectives?

2 Adverbs deseribe verbs. Which words areadverbs?

6 Find two adverbs and two adjeetives inparagraph 1 of the artiele on page 82.

7 Look at the information in the Look! box.Then change the adjeetives to adverbs andeomplete the sentenees.

Regular adverbs

Adjective Adverb

quick quickly

happy happilyca!refu carefu/ly

IrregularadverbsAdjective Adverbfast fastgood wellhard hard

Holly is studying (hard) for her test.Holly is studying hard for her test.

1 Jack is talking (polite) to his teacher.2 He is do ing his homework (careful).3 Tom's brother rides his motorbike (fast).4 Tom plays football (good).5 Jack plays his CDs (loud).6 His friends are daneing (happy) at the

school club.

8 Read the rules of the adverb game. Then moosean action from the box and play the game.

Unit9 Celebrations..

Reading1 Look at the photo. What do you think?

Answer the questions.

1 Which country are the people from?2 What are they doing?3 What are they wearing?

2 Read Flavia's letter to her penfriend andcheck your answers to exercise 1.

R. rontes CorreiaSantaTaesaRio de. Janeiro

IOth rebruar-y) 2001Dear Sue)

i 'm va-y bus-yat the moment because my friends andi are ,8etti~ read-y for the carnival in Rio. We're

finishi~ our costumes. This ~ar our ,8roup's theme isthe sea and my cosrume is a b~ silva fish.The carnival in Bracil is in kbruar-y or March and taKes

four da-ys (Saturda-yto Tuesda,y). ror three da-ys)peoplevisit their friends or ,80 to the beach for a barbecue.The-yusual~ eat fish and de.licious fruit.

On the last da-yof the carnival) thae 's a va-y b~parade.. Hundreds of ,8roups taKe part in the parade. andthae 's a compdition. We want our music and costumes

to win! Ever-yonedancEs and si~s loud~ as people inbeautifui costumes move throu,8hthe streets. Afta theparade.) the or,8ani1.Ersteli us the winner of thecompetition. it 's a va-y special moment.

At the end of the da-y)man.iJpeople sta-y in the street s.

The-ydance and sil1,8all throu,8hthe last n~ht of thecarnival. In the mornil1,8Jwe ,80 home to bed!Please write to me about -yourspecial celebrations.Best wishestlavia

BII Unit 9 Celebrations

-3 Read the letter again and answer the questions.

1 What's Flavia doing now?2 How long does the camival continue?3 What special foods do people eat during the

camival?

4 On which day is the parade?5 When do people go home on the last day?

VocabularyTime expressions

4 Look again at Flavia's letter and completethe time expressions with the prepositions inthe box.

1 - the moment

2 - February3 - three days4 - the last day5 - the end of the day

6 - the moming

Listening5 Read the sentences from a speech about an

important celebration. Put them in thecorred order.

1 e

a In the moming, important people givespeeches in our town.

b After the concert, many people go to thepark and have a picnic.

c Every year in July, we celebrate the birthdayof America.

d At the end of the day, we watch a fantasticfireworks show.

e i'd like to tell you about Independence Day.f Then there is a special concert for everyone.

6 LIsten to the speech and check your answerto exercise 5. ~

Speaking7 Give a short speech about a celebration in

your country. Use some of the timeexpressions from exercise 4.

/CIMe to teli yol/ abol/t...

WritingOrganizing ideas

8 Complete the notes ab out the Rio camival,in BraziL.

. IU'tWteof t~ e-elebrQ(tiOVl,?. W~vi,?

. for iww lOVlj?. spuiQ(lfood?. spuiQ(l dot~?. Q(aivihes?

9 Choose an important celebration in yourcountry and make notes about it. Includethis information.

. IU'tWteof t~ e-elebrQ(hOI't?. W~vi,?

. for iww lOVlj?. spuiQ(lftod?. spuiQ(ldot~?. Q(aivities?

10 Check your notes and organize your ideasinto paragraphs. Do you want to addanything else?

II Write a reply to Flavia's letter. Use theinformation from your notes.

1 Complete the song with the words inthe box.

times, come on!

times, come on!

goingon right herelast throughoutthe year

your good tjmes,and your

party with you

4 Come on now, celebration

let's all celebrateand have a good 3

Celebration, we gonna celebrate and a have agood time

5 4 around the world

It's up to you, what's your pleasure?Comeon!lt's time to come together

6 Yahoo! It's .' . Yahoo!

7 Celebrate gdod times, cOl'f1ei.o,n!It'5 a celebra'tioni

Celebrate good times, come ,on!lt' s a celebration

2 Listen and check your answers. e

3 Match the definitions with words andphrases from the song.i fuIl occasions (verse 2)2 continue (verse 3)3 the sound of happiness (verse 3)4 your decision (verse 5)5 all come to the same place (verse 5)

4 How often do you have a celebration?

Unit9 Celebrations..

Diet and lifestyle

At Me/'s house.

Mel What a great Bonfire Night!Holly You're so lucky!

Mel What do you mean?

Holly Oh, i don't know. It's just ... youohen do things with Tom, ... and,well,Ilike him ... a lot!

Really?Well, ... there's a party athis brother's fiat soan. I'm going tohelp with the food. Would you liketo help, too?

Holly Oh yeah! What are you going totake? i can make a pizza.

Mel Good idea! I'm going to take samecrisps and maybe same cola. Theproblem is ... Tom's going to askJack for his CDs.

Holly Why's that a problem?

Mel Well, Jack never lends his CDs to anyone.They're very important to him.

Holly Oh, dear.

Mel

"""

The next day.

Tom Jack! It's my brother'sparty in a couple ofweeks. Can you come?

Jack I'm not sure. Maybe.

Tom Oh. Well, my brotherhasn't got many CDs. Canwe borrow yours?

Jack Erm, ...No, sorry, i don'tthink so. i need them.

~

.. UnIt LO

PresentationBefore you read

1 Look at the photos. What do you think?Complete the sentences.

In photo A1 Md is telling Holly about ...2 Me! invites Holly to ...

In photo B3 Tom asks Jack for...

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. Q

3 Read the story again and complete thesentences with the correct names.

1 - likes Tom.

2 - is going to have a party.3 - is going to make a pizza.4 - is going to take same crisps.5 - wants same CDs.

6 - isn/t going to lend his CDs.

4 Complete the expressions.

1 You're so _!

2 What do you _?

3 Good_!

40h,_.

5 !'m not _.

5 Listen and repeat the expressions. Q

Act it out!

6 Act out the story. Work in groups of four.

VocabularyFood and drink

7 Complete the words with ai ei ii o and u. Usea dictionary.

1 chJk_n 2 ocn~s

i3 cjC- 4 poCC_s

5 pe- s 6 b_tcr

7 m_lk 8 b_j

9 on- _ns 10 s_g_r

8 Complete the table with the words fromexercise 7.

Meat Other

9 Think of more food and drinks and addthem to the table in exercise 8.

Pronunciation

10 Listen and repeat the words in the box.Then complete the table. Q

crisps

Li:i

meat

lil

i cl1id,el1

11 Discuss the questions.

1 Which fruit and vegetables are popular inyour country?

2 What do you usually have for breakfast?3 What' s your favourite food?

Vnit LO Diet and lifestyle -ili

GrammarCountable and uncountable nouns

1 Read the Look! box and answer the questions.

Countable nouns are things we can count.

an orange:oneorange, two oranges,threeoranges...

a potato: one potato, two potatoes, three potataes...

Uncountable nouns are things we can't count.

beej: eRCeec/, twe eecfs.. .mi/k:eRCmi/k, twemf//cs...

i Which nouns can have plurals?2 Which nouns are always singular?

2 Complete the table with words from thevocabulary section on page 87.

Countable nouns Uncountable nouns

{l°tCltoes bee(

al an, some and any

3 Read the example dialogues. Then completethe rules with alan, some or any.

A Is Holly going to make anysandwkhes forthe party?

ir ,No, she isn't gojJ].gtomakeanysandwiches.HoiiY is going tomake apizz(l.

A Is Md going to take any food and drink tothe party?

B Yes, she's going to take some crisps andsome cola, but she isn't going to take anylemonade.

1 Weusea and - with singular countablenouns.

2 Weuse- and- with pluralanduncountable nouns.

.. Vnit LO Diet and lifestyle

..

4 Work in pairs. Ask and answer questionsabout the picnk

A HClve they tjot cmy orCll1tjes?

B No, they hClVel1'ttjot ClI1YorCll1tjes,biit theyve tjotsome bClI1ClI1ClS.

5 Complete the conversation with alan, someor any.

MeI Do you wantCl pizza? There's a goodpizza restaurant on the High Street.No, thanks. Let's have 1-sandwiches at home. Have you got2- bread?

Yeah. But, I haven't got 3- butter.Well, what about a hamburger and chips?But I don't want 4- hamburger and

' h ' 5 h.

we aven t got - c ips.OK. What have you got?I think we've got 6- fruit. Do you7want orange?

But I'm starving!

All right. Let's go to a cafe!

Jack

Md

JackMeI

JackMd

JackMd

How much?IHow many?

6 Read the questions. Then choose the correctalternatives to complete the rules.

. How much bread do you eat every day?

. How many hamburgers do you eat everymonth?

1 We use much/manywith countable nouns.

2 We use much/many with uncountable nouns.

7 Complete the questions with how much orhow many.

i

2

3

4

5

brothers and sisters have you got?apples do you eat every week?water do you drink every day?sugar do you like in your tea?words do you know in English?

8 Work in pairs. Ask and answer the questionsin exercise 7.

VocabularyAdjectives: food

1 Match the pictures with the adjectives inthe box.

delicioiiS 1-

~2- 3-

l?

4- 5-

2 Write five sentences about food withadjectives from exercise 1.

i love salty foM Me erisps.

i tl1il11.el1iel.en iS delicioiiS.

Listening3 Tom is in a cafe. He's ordering an English

breakfast. Listen and tick the things that heorders. Q

TRADITIONALENGLISH'BREAKFAST

1 bacon

2 tomato es

3 eggs

4 sausages5 toast

o 9 coffee

10 fmit juice

4 Listen again and correct the waiter'snotes. Q

Table~IRADITIONALENGLISHBREAKFASI

bacon.;(. <.piecestomatoes )<

number ofeggs ~, fried~;I~number OfSqusages~numberofslicesoftoast~,~brown .1wit jam(§irmala~;1

(iej)'coffee, with mil~ miffi> i

5 Complet~ the dialogues. Then listen andcheck your answers. Q

WaiterTomWaiterTom

How manyl- wouldyou like?Twoi please.Do yol,tWant them boifed or i~?Fried, please.

Would you like 3- or coffee?Coffee, please.With 4_?

Yes,please.

WaiterTomWaiterTom

Speaking6 Work in pairs. Read the menu. Then follow

the instructions.

AU day English breakfastbacon, eggs (frled or boiled). tomatots.sausages, toast (brown or white)

Main meals Saladsehiekenandehips tomatosaladhamburgerandehips greensalad

Pizzaseheese and onibnehieken and tomato

Drinks

juiee:apple,orangetea, eoffee

Student AYou're a waIter in a restaurant. Ask student Bwhat hejshe would like.Student BYou're a customer in a restaurant. Decide whatyou would like from the menu and order samefood. Answer student!\s questions.

A qoM aftemool1. Wl1at woiild yoii Me?

B A pizza, please.

A Woiild yoii lil.e el1eese al1d Ol1iOI1,or el1iel.en

al1d tomato?

7 Change roles and do the activity in exercise6 again.

UnitLODietandlifestyle..

Reading1 Discuss the questions.

1 How many different kinds of fast food doyou know?

2 Do you like fast food?3 How much fast food do you eat every week?

2 Read the magazine artiele. What kinds of fastfood do es it mention? Q

3 Read the artiele again and answer thequestions.1 Does the wrIter think fast food tastes nice?

2 Does the wrIter think fast food is healthy?3 What can you read on cigarette packets?4 How many people in America are overweight?5 How many hamburgers do es an average

American eat in a week?6 What does the writer want young people to do?

-4 Find the words in the artiele and match them

with their definitions.

1 tasty (line 3)2 chew (line 5)3 warning (line 11)4 overweight (line 16)5 on average (line 18)6 diet (line 20)

a A fat person.b Typically or usually.c Delicious.

d Use your teeth to make food safi.e The food a person usually eats.f Natice of possible danger.

5 Discuss the questions.

1 Do you think fast food restaurants needhealth warnings?

2 Do you think your diet is healthy?Why?jWhy not?

Hamburg~rs..

Imaginethis:you're sittingin a fast foodrestaurant.You're eating a hamburgerand sometastychips,and you're drinkinga can of cola. Andwhat about havingsome ice cream withsweet

5 chocolate sauce? Wait! Stop chewing! It's adeliciousmeal, but do you knowhow unhealthyit is?

In America, some people want fast foodrestaurants to teli customers that their

10 and hot dogs are unhealthy. Cigarette companiesput health warnings on packets of cigarettes, soperhaps fast food restaurants need a healthwarning on their hamburgers - EATlNGFASTFOOD MAKES YOU FAT!

IIII!II UnIt LO Diet and lifesryle

. ..1

ljArecent surveyshowsthat more than 30% ofAmericansare very overweight.The problemisgetting worse,especiallywithchildrenand youngpeople. On average, Americanseat about threehamburgersa week. Is that why people are

20 overweight?We all need to think about our diet.We all need to eat more healthyfood.So, nexttime you order a hamburger - think before youeat!HAMBURGERSAREN'THEALTHY.

~

GrammarPresent simple and present continuous

1 Look again at the artide on page 90 andcomplete the sentences. Are the sentences in thepresent simple or the present continuous?

. You 're81ttll1tjin a fast food restaurant.pre8Mt COl1tll1UOU8

. You 1 a hamburger.

. Cigarette companies 2 healthwamings on packets of cIgarettes.

. Americans 3 about three

hamburgers a week.

~

~2 Read the Look! box. Then match the parts of

the rules.

1 Weuse the present continuous for...2 We use the present simple for...

a routines and habits.

b actions that are happening now.

We don't usually use be, like and want in thepresent continuous.

3 Choose the correct alternatives.

i My mother is trying/tries to lose weight atthe moment.

2 I/m eating/eat a lot of fruit and vegetablesevery day.

3 In this term's scIence project, we/re leaming/leam about healthy foods.

4 My brother is going/goes to the gym threetimes a week.

5 I'm walking/walk to school every moming.6 My friends are playing/play football in the

park, but I have to finish my homework.

4 Complete the sentences to make them truefor you. Use the correct form of the presentsimple or the present continuous.

I in 110twntll1tjan essay at the moment. (write)

i I - in my classroom at the moment. (sit)2 I - this grammar exercIse. (do)3 I - English lessons every day. (have)4 At the moment my teacher - on the

blackboard. (write)5 In this unIt, we - about food. (learn)6 I - a lot of healthy food. (eat)7 I - fast food. (like)8 Right now, I - about my lunch. (think)

5 Complete the postcard with the verbs in thebox. Use the present simple or the presentcontinuous.

~ i Medt

~ow o..re. Y°tA? i in havll1tj o.. ~re.o.. tti"",e. he.re. ir'\ Mo..r'\c.he.ste.r. i

1 0..11 o..botAt the. Britishli.fe.style.~ At the. ""'° "",e.r'\t , i2 ir'\ o.. c.o...fe. o..r'\d i 3-o.. tro..d it ior'\o..\ t=r'\~\ish bre.o..k.fo..st.

t=r'\~lish bre.o..k.fo..sts o..re. ve.ry r'\ic.e.,btAt the.y 4 ve.ry he.o..lthybe.c.o..tAse. the. .food is .frie.d i Britishpe.ople. 5 o.. .frie.d bre.o..k.fo..ste.ve.ry do..y. The.y tAstAo..lly ho..ve.c.orr'\.flo..ke.s or too..st ir'\ste.o..d , o..r'\dthe.y 6 te. 0...

Ar'\othe.r tro..ditior'\o..l British .food is.fish o..r'\d c.hips. i re.o..lly 7 it.i hope. Y°tA c.o..r'\ viS it "",e. SOOr'\.To"",

'h_h.

6 Deseribe the photo. Try to use the presentcontinuous and the present simple.

Tour teel1atjer8 are 81#ll1tj 111a cafe. They probably tjo

there every day af ter 8chool.

UnIr LO Dietand lifestyle ELI

-Reading1 Read the advert for a restaurant and answer

the questions.

1 What kind of food can you eat atthe restaurant?

2 What are the names of the restaurant/s

three special meals?3 Can you bring children to the restaurant?

4 When can you have breakfast at Maisie'sRestaurant?

5 What time does the restaurant close?

6 When can you try food from other countries?

Malsle'sRestaurant

r

Listening2 Listen to a radio programme about places to

eat. Match the restaurants with the food theyserve. Q1 Roma

2 Perfect!3 ]oe'sPlace

a hamburgersb sandwiches and cakes

c pizzas and salads

3 Listen to the radio programme again. Are thesentences true (.1) or false (X)? Q

1 Roma is open on Saturday afternoon.2 Jane doesn't like Mexican food.3 ]oe's Place serves some healthy food.4 You can listen to music at ]oe's Place on

Saturday afternoon.5 Perfect! is near the river.6 You can only eat at Perfect! in the afternoon.

.. Unit LO Diet and lifestyle

WritingAn advert: using positive adjectives

4 Look again at the advert for Maisie'sRestaurant on page 92. Which adjectivesdeseribe the words in the box?

meal - delieiotls

5 You are going to write an advert for arestaurant. Choose a restaurant type andanswer the questions.

~

1 What's the name of your restaurant?2 What kind of food does it serve?3 What's a special dish at the restaurant?4 What kind of people go there?5 What are the restaurant' s opening times?6 Are there any special nights?

6 Write your advert.

. Include same of your ideas from exercise 5.. Use positive adjeetives to deseribe yourrestaurant.

~""''''''T''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''~

, Project idea! ~~ Your best friend is home after a long holiday and ~~ you're going to prepare a surprise three-course ~mealfor him/her. Decidewhatyouaregoingto

~make and write a shopping list. --

1 Complete the erossword.

1 Those eakes are very nice. They're _!2 Crisps are very - .3 Lemons are -.4 Beefwith eakes and milk? That's _!

5 Ilave - and spicy Mexiean food!6 Sugar is_.

2 Find ten more types of food and drink.

Unit10 Dietandlifestyle..

B E T U C A G O V

F U L M B F P S E

S i G S U T E V G

p U' S K T O A E E

S O G H T A S G T

i N N A E T i E A

R i T F R U i T B

C O F F E E C A L

P N E K C i H C E

T S L M E A B L S

i i \S E G N A R O;

M E A T C R i O C

Revision (Units 9 & io)GrammarPresent condnuous

1 Look at the picture. Complete the text withthe verbs in the box. Use the correct form ofthe present continuous.

C'f'If'hr:itf'

""~~~

2 Write questions about the picture.

What are they celebratil1Çl.?

They're ceIebrating Christmas.

1 _? Mark is taIking to his parents.2 _? His dad is playing a computer game.3 _? The dog is eating some cake.4 _? They're wearing some paper hats.5 _? Mark's grandfather is sItting on the sofa.6 _? His sister is reading amagazine.

-ili Revision (Units 9&10)

al an, some and any

3 Look at the photo and complete the text. Useajan, some or any.

Present simple and present continuous

4 Complete the e-mail with the verbs in the box.Use the present simple or present continuous.

Hi, Jayne.i 'm W/'ltil1Çlthis e-mail at nine o'cloek on Saturdaymorning. My brother is stili in bed. He1 2

. He usually at ten o'cloek3

at the weekend. My mum breakfastin the kitehen, but my dad isn't at home. Healways 4 tennis on Saturday morning.After that, he 5 the shopping, and thenhe eomes home.

Today i 6 my new jeans. I'm going tomeet my friend Laura this afternoon. Laura and ioften 7 to the eine ma at the weekend.

We 8 eomedy films, and today we'regoing to see the new Eddie Murphy film.Bye for nowKelly

VocabularyCelebrations

1

1 Match the words in the box with the picture.Which two things are not in the picture?

j

i

i

i

j

make and do

2 Complete the sentences with the correct formof make or do.

i Jack usually - the shopping for his

grandmother. .2 Tom always - his homework before he

watches TV.

3 Holly usually - a lot of mistakes in hermaths homework.

4 Mel often - the washing-up for hermother.

5 Mel is going to - a cake at the weekend.6 Holly would like to - a course in

medicine at university.

Time expressions

3 Complete the time expressions with in, onor at.

i - September2 - the first day3 - the evening4 - the end of the week

5 - Wednesday6 - the aftemoon7 - the moment

8 _May

Food and drink

4 Add two more words to each group.

i potatoes, mushrooms, carrots, -,-.

2 lemons, bananas, -, -.

3 bacon, sausage, -,-.

4 cola, water, apple juice, -, -.

5 Complete the sentences about food anddrink. Make them true for you.

i My favourite food is -.2 i hate -.

3 i think - is/are very healthy.4 i usually have - for lunch.

5 My favourite drink is -.

6 i eat - every day.

Adjectives: food

6 Complete the sentences with the adjectives inthe box.

horrible

i My mum eats lots of - food likebiscuits and cakes.

2 My favourite meal is chicken and chips.i think it's_.

3 Chilli peppers are really -. You have toeat them carefully!

4 My brother loves - food like crisps andnuts.

5 i think bacon is _. i hate it!

6 Don't put that siice of leman in your mouth.It's very_.

Revision(Units9&10) .. iL

Nowand then

On Sunday.

Mel What's the matter, Jack?Why areyou so fed up?

jack There was a burglary at schoollast night, in the store room.

Mel Oh, no! Not the disco equipment!

jacl< Yeah! And all my CDs!

Thenext day.

Policernan Where was the equipment?

jack lt was in the cupboard.Policernan Were the CDs in the

cupboard, too?

No, they weren't in thecupboard. They were on thisshelf. i can't believe it!

Policernan Was it yourequipment?No, it wasn't. It wasthe school's discoequipment, but theCDs were mine!

Policernan There are a lot ofburglaries thesedays. It's terrible!There wasn't mucherime in this townwhen we were atschooL.

jacl<

jacl<

That evening at jack's house.

Holly Oh, no! That's awful!Mel Yes, they were very expensive. Jack's really upset. The CDs were

all his.

jack Ssh, .., Listen to this.

TV reporter ... and on Saturday night, there was a burglary at elifton Hill school.Therewas a boy in the area, with a blue jacket and a red baseballcap. He was near the bus stop, opposite the school playground.

ELI Unit II

PresentationBefore you read

1 Look at the photos. What do you think?Answer the questions.Photo A

1 Why do Mel and Jack look unhappy?Photo B

2 Who's Jack talking to?Photo C

3 Where are they?4 What's Jack do ing?

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. ~

3 Read the story again and correct the mistakesin the sentences.

1 There was a burglary at Jack's house.2 The burglary was on Friday night.3 The CDs were in the cupboard.4 The disco equipment was on the shelf.5 There was a boy in a red jacket near the schooL.

4 Complete the expressions.

1 - the matter?

2 Why are you so _?

3 i can't - it!

4 That's_!

5 Jack'sreally_.

5 LIsten and repeat the expressions. ~

Act it out!

6 Act out the story. Work in groups of four.

VocabularyFacilitiesin a town

7 Match the pictures with the words in the box.

stationstreet

8 Complete the sentences with the words fromexercise 7.

i don't walk to schooL.There's an 11l1dertjrOlll1dstatiol1 near my house.

1 Don't throw away your batties. Put themma

2 i have to use a

phone isn't working.3 You can leave your car in the

the supermarket.4 When the are red, you must stop.5 There aren't any cars on a6 There's a good in my street for

children to play in.7 i sametimes wait a long time at the

before abus comes.

7

2

because my mobile

near

9 Discuss the questions.

1 Which of these facilities have you got inyour town?

2 What facilities would you like in your town?

Vnit II Nowandthen ~

Grammarbe (past simple)

1 Look again at the Clifton Hill story andcomplete the table.

iHeShelt

i~wasl'l't nearlhebus stop.

YouWe

They2~/weren't at schooL.

2 Complete the paragraph with was, wasn't,were, or weren't.

3 Complete the tables.

Was I/he/shelit

atbome yesterday?i

you/we/they

Yes, i was./No,1 2~.

Yes,we 3~./No, we 4=--.

Pronunciation

4 Read the information in the Look! Box. Thenlisten to the dialogue and check thepronundation of was and were. Q

We use the weak form of was /W;:JZ/and were/W;:J/ in questions.

We use the strong form of was /WDZ/ and were/W3:/ in short answers.

A Were you and your friends at the cinemayesterday?

B Yes,we were.

A Was Sam with you?B No, he wasn't... Unit II Nowand then

5 Work in pairs. Practise the dialogue withyour partner.

6 Complete the quiz questions with was or were.

12::i45ii

moôn?

7 Work in pairs. Ask and answer the questionsin exerdse 6.

there was/there were

8 Look at the picture of the old man andchoose the correct alternatives.

"When i was young, this was a very quiet town.'i There werejThere weren't same old cafes,but 2 there werejthere weren't any Internetcafes. 3 There werejThere weren't same trams,but 4 there werejthere weren't any noisy,aeroplanes!

9 Complete the text." iAnd when I was young, - same

payphones in my town, but 2- any mobilephones. There 3- any DVD players orvideo recorders, but 4- a lot of cinemas.When I was a young man, 5- an airportnear this town, but 6- a train station.Trains were a very popular form of transport.'

VocabularyAcademic subjects and jobs

1 Check the meaning of the words in the boxand complete the table.

Subject

philosophy

2 Work in pairs. Think of famous people forthe jobs in exercise i.

finstein was a famotls scientist

Listening3 Look at the picture of The Oxford Story

museum and read the information. How is

The Oxford Story different to anormal museum?

The Oxford Story is a museum withdifference! A special train takes you on atour through the museum. As the traingoes through the rooms in the museum,you see life-size models of people from thepast, and leam about the history of Oxford.

4 Two students are talking about The Oxford Stof}'museum. Listen and tick the jobs they mention.Q

politidan D astronomer Darchitect D artist Dscientist D philosopher D

5 Listen again. Are the sentences true (.I) orfalse (X)? Q1 The museum shows visitors five hundred

years of history.2 At Oxford University, Margaret Thatcher's

subject was chemistry.3 Edmund HalIey was apolitician.4 Bill Clinton visited the museum.5 There's a cafe and a gift shop in the museum.6 A lot of people visit the museum.

6 Discuss the questions.

1 Would you like to visit The Oxford Stof}'museum? Why?jWhy not?

2 Do you know any interesting museums?

Speaking7 Work in pairs. Follow the instructions.

Student AChoose a famous historical person, but don'ttelI student B the person's name. Student B isgoing to ask same questions about your famousperson. You can only answer 'Yes' or 'No:Student BAsk questions and guess student 1\s historicalperson. Student A can only answer 'Yes' or 'No'.You can use same of these questions.

. Was this person a woman?

. Was hejshe from your country?

. Was hejshe an artist?

. Was hejshe famous a hundred years ago?

~~~~~~~~~~~~~~~~~, Project idea! ~

~ Makea posterabout a famousmuseumin ~

L:::::~~~~~~~~~~~-~

UnitII Nowandthen..

Reading1 Karen lived in a histarical house for a

televisian programme. Read paragraph 1 ofthe artiele and discuss the questions. ~

1 Do you think Karen enjoyed her timein the house?

2 What do you think was difficult for her?

2 Read the rest of the artiele and check youranswers to exercise 1. ~

3 Read the artiele again and answer thequestions.1 Did Karen like the food?

2 What did Karen's parents think of their dothes?3 Was the house very comfortable?4 What did the family miss?5 What did they do in the evenings?6 What is Karen going to do in the future?

r my familyand i were on a TV programme

ca~ Living History. The TV channel wanted to maket'rogramme about how ordinary people lived in

1800. They asked my family to liye in ahause withoutany telephones, televisions, computers or modemdothes. They filmed us in the house for two months,and we talked about our experiences on TV.

as a problem for us. My mum and i tried to.nteresting food, but there wasn't any

em food, like pizza or cola or hamburgers.My brother James hated the food, but i liked it.We cooked a lot of healthy vegetables.

O~-fashioned dot~es were r~alIy.,unLi~lJortable, and i missed my jeans. i hated~rothes, but my mum and dad liked theirs. it

was very difficult to wash, so we were quite dirty.Our bedrooms were realIycold at night -especialIymine!

-imi Vnit II Nowand then

L

....

4 Match the words from the artiele with the

correct meanings.

1 healthy (paragraph 2)a Good for you. b Nice.

2 uncomfortable (paragraph 3)a Nice to wear. b Not nice to wear.

3 dirty (paragraph 3)aNat tidy.

4 dull (paragraph 4)aNat interesting.

b Not dean.

b Old.

5 Would you like to be on the Living Historyprogramme? Why?fWhy noH

missed the TV

he Internet, butenjoyed life without

them. I talked to myfamilyalot, we playedcard games for hoursin the evening and weplanned our summerholiday. it wasn't dulI in ,the house. it was great. Ialsa studied a lot. I've gotimportant exams next month.

Jj~.. . ere same very difficult things about life in, but I realIy enjoyed my time in the house.

..'...'I discovered something very impartant. I canliye without the TV! Now, I'm not going to watchTV every evening. I'm going to talk to my familv alot more.

GrammarPast simple (regular verlis)

1 Look again at the artiele on page 100 andcomplete the sentences.

. The TV channel 1- to make aprogramme.

. My mum and i 2- to cook interestingfood.

. We all 3- theTV.

. We 4- our summer holidays.

2 Complete the table.

Present simple

askwant

Past simple

asked

enjoy

1

2

stopplan

stopped3

hatelike

hated4

trystudy

tried5

3 Complete the text with the words in the box.Use the past simple.

Last weekend i was in IstanbuL. i 1 ,... in myTurkish penfriend' s house, and she 2- mea lot of interesting places In the city. We 3-same museums and palaces, and i 4- myfriend a lot of questioils about the history ofIstanbuL. My favourite placewas the Princes'Islands. There are no cars on the islands, sowe 5- a lot. i 6~ to see a lot of placesin Istanbul, but i was only there for a weekend!

i.i...

Possessive pronouns ~i

LIi

ii4 Look at the sentences. Then complete the

table with the words in the box.

. i hated my dothes, but my mum and dadliked theirs.

. Our bedrooms were really cold at night -especially mine.

Possessive adjectives Possessivepronou OS

It'smy bag.They're you.. shoes.l1's hishomework.

They'reiie.. pendls.It's olirhol.Jse.

It's tll.eir dog.

It's mine.

They're 1~.It's 2_.They're 3-'l1's4_.l1's 5-'

5 Complete the dialogue with the possessivepronouns from exercise 4.

Teacher

DanielTeacherDanielTeacherDaniel

these?

at art. They're 1_.uns CD?

Williams.-

TeacherDaniel Simon and

Teacher

JoTeacherDaniel

board pen?lt's 5_1

Vnit II Nowandthen ml

Reading1 Read the text about Barcelona and choose a

title.

a Barcelona for touristsb The history of Barcelonac Barcelona - then and now

Barcelonaisanattractiveand excitingcity.Millions of

tourists visit Barcelonaeveryyear.

Ifs a town with a long history.ThefarnousartistPabloPicassoandthe architect Antoni Gaudiboth lived

in the city.you canvisitthe Picassomuseumand you

canseeGaudf'sbeautiful buildingsall overthe city.

In the past,somepartsof the city weredirty and

ugly"especiallythe old port area.Thenin 1992,the

OlympicGameswerein Barcelona,andthe city changed

a lot. Theold port areaisnow a beautiful place,with

lots of trendy shopsand cafes.

Therearea lot of newparksand museumstoo, and

somebeautiful beaches.you canspendtime in the

fantasticshoppingcentres,or at the lmaxcinerna.Whynot visit Barcelona200and seethe famouswhite

gorilla?Anddon't forget the OlympicStadium- ifs on

MontjuicHill, nearthe (ataloniao Museum!

There'ssomething for everybodyin Barcelona!

2 Read the text again. Are the sentencestrue (.1) or false (X)? Correct the falsesentences.

1 Gaudi created some fantastic buildings inBarcelona.

2 Before 1992, the port area in Barcelona wasan attractive place.

3 There are good shopping areas in Barcelona.4 The Olympic Stadium is ne ar the old port.

-i:i1I Unit II Nowand then

,..

Speaking3 Work in pairs. Look at the two photographs

and discuss the questions.

1 Are the photos from the same city?2 How old is photo A?3 What things are the same in the two pictures?4 What things are different?

4 Teii the class your ideas.

We thil1k. the photos are from cltfferel1t cities.

VocabularyAdjectives: places

5 Match the adjectives in the box with theiropposites.

ugly

1 beautiful-

3 trendy

2 ancient4 crowded

6 Complete the sentences with words fromexereise 5.

1 Ephesus is an - city in Turkey.2 There are a lot of - dothes shops in Paris.3 Football stadiums are always - on

Saturdays.4 That cafe is very - these days. Famous

people don't go there now.5 There's a - park near my house, with a

lot of flowers and trees.

6 There are a lot of factories in Birmingham.It/s an - city.

7 Our school is - in the summer because

the students are on holiday.8 i really hate - architecture. i like old

buildings.

7 Think of one place in your town or countryfor each of the adjectives in exereise 5.

There/; a very modem shoppil1q cel1tre il1my tOWI'I.

WritingAvoidingrepetition

8 Read the essay about Orlando. Thenunderline fo ur more sentences where the

student repeats information.

Of'ldhdoused to be d

srn.dll) Uhirn.poMdhtfOWh ih}1oridd.But theh d rn.dh

cdlled Wdlt Dishe~ dfrived

dhd Chdnied Of'ldhdoihtod rn.~or twrist cehtre.

Wdlt Dishe~ is ver~irn.pONdhtih the histor~of Of'ldhdobeCdUse his

COrn.Pdttyfouhocd Dishe~World. Or\dhdo is ih }1oridd.

~oWit 's d b~ tourist cehtre dhd rn.illiohsoftwrists visit Of'ldhdoOhholidd~ever~ ~df.

Wdlt Dishe~ is ver~ irn.poMdhtih the histor~ of

the cit~. Dishe~ World WdSthe first thern.e pdfk ihOrldhdo) but hOWthere dfe lots of other ihterestinipldces to visit. :Joucdh see how Hollywoodrn.dkesfiirn.s dt Uhiversdl StudiosJ see the shdfks dt

Sed World) or do sorn.e shoppini. lhere dfe d lotof 800d restdUrdhts) dhd ~u cdh dlso 8° shoppini!

Milliohsof tourists visit ever~ ~df. (orn.e toOr\dhdo - the ho\idd~cdpitdl of Arn.ericd!

We use used to to ta Ik about things that weretrue in the past, but aren't true now.My dad used to be an athlete, but now he's a bit fat.

9 Discuss the questions.1 Who was an

important person inthe history of yourcountry or dty?

2 Why was this personimportant?

Atatiirl( was I-1?ty

Importat1t formy COtlt1try

10 Write a short essay about a dty in yourcountry. What can tourists do there? Whowas important in the history of the dty?. Check that you don't repeat any

information.

1 Answer the questions.

Christopher Columbus discoveredAmerica in ...

1492.1320.

2 Where was the Colosseum?

a Rome.b

.

aeroplane {light?a 1850.

b 1903.

4 Lumiere brothers invented cine ma

19th century.

the 20th century.

who was Napoleon Bonaparte?

a French lead~r and ruler.a German architect.

6 which person was a president of theUnited States?

was first?

a The sateIlite.

b telephone.

8 Which person was a famous architect?

2 Work in pairs. Think of two more quizquestions.

Wl1lcl1 cOtlt1try was Sl1al(espeare from?

3 Ask the class your quiz questions.

Unit II Nowand then -iiii

Crime

The next day.

Holly Did you hear the news on TVlast night? lt was aboutthe burglary.

Tom Oh, yeah?Holly There was a witness. She saw a

boy in the area. He ran out ofthe school.

Tom What did he look like?

Holly He wore a red baseball capand a blue jacket, and he hada bag.

Tom Really? Listen! i have to go!See you Iater.

Holly Tom left quickly! Why did he dothat?

Jack Wait a minute! Tom's got a bluejacket and a red baseball cap. ithink Tom's the burglar!

Mel Don't be silly.Jack I'm hot! He wanted to borrow

my CDs. Remember?Mel Jack! That's not fair!

Holly Don't argue, you two. Anyway,Tom didn't want the discoequipment. Tom isn't a burglar!

Later, at jack's house.

Tom So,... then i remembered. i was near thecrime scene. i went to the CD shop andbought some CDs for my brother's party!Did you see the burglar?Well, i saw a man in a blue jacket and iremembered his car's number plate. irang the police and told them about it.They interviewed me and asked me a lotof questions. They checked the numberplate on their computer and caught him.The police arrested him this morning.

Mel That's fantastic, Tom! How did youremember the number plate?The Ietters were M - O- T.Wow! That's Tom - backwards!Yes.

Well done, Tom!

lIiII Unit 12

PresentationBefore you read

1 Look at the photos. What do you think?Answer the questions.Photo A

1 Where are they sitting?2 What are they doing?Photo B

3 What do you think they're worried about?Photo C

4 Whose house are they in?5 Are they happy now?

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. ~

3 Read the story again. Choose the carrectalternatives.

1 Tom/Hoiiy talks about the news.2 Tom stays in/leaves the cafe.3 Jaek thinks Tom is the witness/burglar.4 Holly and Mel agree/disagree with Jaek.5 Jack/Tom solves the erime.

4 Who says the expressions?

f

1 i have to go!

2 See you Iater.3 Wait a minute!

4 Don't be silly.5 That's not fair!

6 Well done, Tom!

5 LIsten and repeat the expressions. ~

Aet it out!

6 Act out the story. Work in groups of four.

VocabularyNouns: erime

\.

7 Match the pictures with the words in the box.

1

6

Q08~,( a>

~.. " ((

rN,tLu! .. ~

~{; \(1-:-~ ')

8 Complete the sentences with the words fromexercise 7.

Proteet your ear with an alarm system. Don'tbe the victim of acar erime.

1 You can keep money in a -'2 A - takes things from houses.3 Criminals wear gloves beeause they don't

want to leave -'

4 A - sees a erime.

5 Be eareful. That - can cut your hand.6 A - is a police offieer.

7 Don't wear expensive - in the street.

9 Discuss the questions.

1 Would you like to be a deteetive?2 Is it an interesting job?3 What's difficult about the job?

Vnit 12 Crime lIiiI

GrammarPast simple (regular verbs)

1 What can you remember ab out the CliftonHill burglary? Put the sentences in thecorrect order.

aTom telephoned the police. Db A radio station reported the erime. inc The police arrested a man. Dd Tom remembered something important. De The police checked the car number plate. Df Jack and Holly discussed the burglary. D

2 Look again at the Clifton Hill story and checkyour answers.

Pronundation

3 We pronounce the endings of past simpleregular verbs in different ways. Listenand repeat the verbs in the box. Thencomplete the table. Q

lti

as/(etI

ldl

Past simple (irregular verbs)

4 Look again at the CHfton Hill story andcomplete the table.

Infinitive Past simple

seerunwearhavelea"e

gobuyringtelicatch

lIiIII Unit 12 Crime

-

5 Make sentences. Use the past simple.

f>lAr8\df~at 5 5 ~reen Streetlime: 2.p.m.Witness: tMs Jones (ne~hbolAr)

Mrs Jones / hear anoiseMrs Ames hearCi a t1o/se

1 she / go outside

2 she / see aman next door3 the man / wear a baseball cap4 he / have a sports bag5 he / mn out of the garden6 Mrs Jones / ring the police

Past simple (regular and irregular verbs)

6 Complete Tom's e-maiL. Use the past simple.

Hi Steve

How are you? Guess what? i w/ttle88ecl (witness) acrime the other day! There was a burglary at our

1school and i - (see) the burglar's cari lt wasreally strangel

My brother 2- (have) a party last night. My

friends Mel, Holly and Jack 3- (be) there. We4- (listen) to some fantastic music and we5- (dance) a lot.

6i - (buy) some new CDs the other day. I've

got some great British music now. How's

everybody in Los Angeles? i 7- (ring) Matt in

Chicago yesterday. i 8- (talk) to him for a

long time. It was great!

Speak to you soon!Tom

7 Work in pairs. Ten your partner ...

. two things you did yesterday.

. two things you did at the weekend.. two things you did last month.

yesterclayevettit1tj, / rat1rjmy best {riettd. [hett / ...

VocabularyVerbs: erime

1 Mateh the pictures with the verbs in the box.

1

3 4

6

2 Complete the news reports with the verbsfrom exercise 1. Use the past simple. Use theirregular verb list on page 157 to help you.

Poliee cateh dangerous eriminalA dangerous eri m iinal 1 from prisonyesterday evening. polfce usedhelicopters and 2 him all night. The3man - same food from a supermarketand 4- in an empty old house in themiddle of Manchester. A witness phoiied the

.5"police and they later man fromhis fingerprints.

Police arrest card cheatThere was a fight town centreyesterday evening after 6~ in aeard game. His friends 7 . him down thestreet and afight began outsidethe cinema.The police arrived and 8 .. ..theman.

...

Listening3 Read the information about a radio

programme and answer the questions.1 Where was the erime?2 What did the eriminals steal?

This week on the programme we discussan unusual burglary. Find out how twoburglars stole some important paintingsfrom the London City Art Gallery!

4 Listen to the radio programme. What wasunusual about the burglars? Q

5 Listen again. Are the sentenees true (~) orfalse (,x)? Q

1 The wItness was outside the gallery.2 There was a carnival in London on the day

of the burglary.3 The burglars stole one painting.4 The witness ran after them.

5 The burglars escaped in a yellow car.6 The witness remembered the burglars' faces.7 He phoned the police.

Speaking6 Work in pairs. Look at the pictures and make

notes about what happened in the story.

7 Tell the class your story.

The men were from the ftalian Mafla.

Unit 12 CrIme -itii\

Reading1 Discuss the questions.

1 What erime films do you know?2 Do you like erime films? Why?jWhy not?

The (jodfather' iS a qood erime {tim. /t:S abol/t

qat1qsters.

2 Read about the film Catch Me if You Can andtick the things the artiele mentions. Q

teenage years D friends Dfamily D money Djobs D prison D

3 Read the artide again and answer the questions.

1 Why did Abagnale leave school?2 What was Abagnale good at?3 Why did he cheat people?4 Who does he work for now?

5 Why did Spielberg like Abagnale's book?6 Who stars in the film about Abagnale's life?

WhenAbagnalewasa5 He wasn't happy

study,so heran

10 dicaprio

ilmi Unit 12 Crime

...

4 Find the words in the artiele and match themwith their definitions.

1 qualifications (line 8)2 can-man (line LO)3 pretended (line 13)4 prison (line 27)a Acted.

b Exams from school or university.c A place for criminals.d This person cheats for money.

5 Discuss the questions.

1 Why was Abagnale's life of erime amazing?2 Was it a good idea to give Abagnale a job in

the FBI?

hanks

~.

..,

GrammarPast simple (negative)

1 Look again at the artiele on page i08 andcomplete the sentences.

. Abagnale 1 a job.

. He 2 how to fly apiane.

2 Choose the correct alternative.

To make the past simple negative we usedid/didn't before the verb.

3 Look at the pictures and write correctsentences.

He ekin't play tel1l11S on Monday

He playeti football.

play ten ni s onMonday

2 go to schoolon Satmday

4 havelunchat 1 o'clock

i send an e-mail

last night

3 listen to musicafter school

5 stay at homeon Sunday

4 What did you do at the weekend? Write trueanswers.

listen to musici dit/n't!Istento mtl8ic.i watcheti LV

i go swimming 2 stay at home3 play a computer game 4 visit relatives5 do my homework 6 ring a friend

~

Past simple (questions)

5 Read the questions and choose the correctanswers.

i Did Frank Abagnale have any qualifications?

Yes, he did.jNo, he didn't.

2 Did Frank go to prison?

Yes"he did.jNo, he didn't.

6 Complete the grammar rule.

To make questions in the pastsimple weuse- + subject+ verb.

7 Write the questions about Frank Abagnale inthe correct order. Then answer them.

Frank mn from away home Did ?Did Tran/( rtln away from home?

Ye&,he ditl.

i he plane fly Did a?2 detective a he become Did ?3 he Did for work the FBI?4 a write he Did book?5 direct Hanks Did Tom film the?

8 The police are interviewing a witness to acrime. Write questions and match them withthe correct answers.

i What time j you come home?2 you see j the bmglar?3 Where j be j the bmglar?4 What j he take?5 How j he escape?a Yes, i did.b He ran across the park.c At about half past ten.d He was outside my house.e My 1v and some money.

UnIt 12 Crime ila

Reading1 Read the story quickly and answer the

questions.

i Why was James unpopular?2 What did he want to steal?

3 What did Suzie think about his plan?

James Harman wasn't very popular. Hedidn't have a job, and he was lazy anddishonest. James Harman was a thief!'Why don't you look for a job?' asked hisgirlfriend Suzie one day.'I don't need a job,' said James. Tm rich! Ican steal things! i can steal anything!'James was always confident.'Would you like a video player? I can stealone!' he said. He was a very calm person.'Don't do it. It's really dangeraus!' Suziereplied.'I don't think it's dangerous,' said James,and he decided to go to the video shop inthe town centre.

VocabularyAdjectives: people

2 Read the story again and find the oppositesof the adjeetives.

i unpopular2 honest

3 poor4 shy

3 Which adjeetives from exercise 2 deseribeeaeh person?

Simon always cheats people. etisltOf1est

i Jim hasn't got any friends.2 Sarah doesn't like to speak in class.3 My sister found some money and gaye it

to the police.4 That man has got a yacht and a Mercedes.5 Pete had a party, and fifty people came.6 My brother is going to mn in arace. He's

really good at athletics and he thinks he' sgoing to win.

7 Helen hasn't got any money.

lIIiI Unit 12 Crime

i""'"

Speaking4 Work in pairs. Look at the seeurity eamera

pictures of James Harman' s erime andanswer the questions.i What did James do?2 What time of day was it?3 Did Suzie help him?4 How did James escape?

5 Tell the class your ideas.

fl1mes anet 511zie went to tlte town centre. fl1mesltaet

a biq baq anet...

WritingUsing adjectives

6 Read the story. Which paragraph isinteresting? Why? ~

A

Last night i heard a loud noise, so i lookedout of the window. i saw atall, blonde man

outside the supermarket opposite my house.He tried to break one of the big gl asswindows, but then he saw me and stopped.He jumped into a dirty, green car and droveaway.B

Later the police told me about him. He' s acriminaL i described him to the police. Hewore a jacket and jeans, and he had a bag. ihop e they catch him.

7 Add extra adjectives to the paragraph.The eriminal wore an o/dcoat, Nacl::shoes ...

The eriminal wore a coat, shoes and a jacket.He stood outside the house for a long time.Then he broke a door and went in. A womanheard the noise and called the police.

8 Look again at the security camera pictures onpage 110.You are go ing to write an ending toJames' story. Answer the questions.

. Where did James and Suzie go afterthe robbery?

. What did they do?

. Did the police eateh James?

. Did James go to prison?

. What happened to Suzie?

9 Write an ending to the story.

. Indude some of your ideas from exercise 8.

. Use adjectives to make your story interesting.

~TT~TTT~~T~~T~~~~, Project idea! ~~ (hoose your favourite erime film and make a ~

~ poster for it. Saywhat the film is about and ~

r.:ake a list of the actors and their characters.

~Include same pictures................-

i.

The witnesstest

Many people aren't good witnesses. They don'tremember things.Are you a good witness? Try omwitness test and find out!

1 Work in pairs. Follow the instructions.Student A

Look eareful1y around the room. Then doseyom eyes and answer the questions.Student B

Ask the questions to student A and give pointsfor his/her anSwers.

are our

- chairs an

3 Howmanystudents4 Is the student behind

5 Is the windq\,!9pen or closed?6 WhaPs on 'the blacKbbcirCi:?

in the room?

glasses?

2 Now change roles. Ask and answer thesequestions.

Is the

4 What's

5 Are

6 What'syour

or closed?

sk?

on the walls?

wearing?

3 Read the answe.r key. Are you a good witness?

Unit12Crime-

...

Revision (Units II & 12)GrammarPast simple

1 Read the deteetive's notes and write sentences.

aman / break / the shop windowAman brol::e the shop window.

1 he / steal / a lot of gold jewellery2 a neighbour / hear / burglar alarm3 the burglar / be / frightened4 he / leave / the jewellery shop5 he / mn / across the park6 a witness / see / the man in the park7 he / take / a photo of the man8 the witness / ring / the police9 the police / catch / the burglar in the park

2 Complete the newspaper artiele with thewords in the box.

local Photogra-pherCatchesBurglarOn.Ca.mera!Last night a teenage1photographer -the police to catch adangerous burglar.Vikram Singh talked toour magazine:

Tm very keen on

~hotog,"phY.La" Right i '1in thepark3 .

because 1 to take same photos of the

sky at night for my new emibition. At about tWoo' clock in the moming, 14 a man in a

blue jacket. I 5 . hisphoto beca:tise he6 - alot of goldjewellery in a plastic

bag! He' . me because it was dark. ihave a digital camera so iS aflash.Later i 9 the police, and theyLO the burglar from the photo.'

Congratulations from all of our readers, Vikram!

iiLi Revision (Units Il&12)

3 Write the questions in the correct order.Then look back at the newspaper artiele andanswer them.

you the Why were park last in night?Why were YOtlin the parI:: /ast niqhP

8ecatlse / wantecl to tal::e some photos.

1 What see the time you did man?2 What man the have did ?

3 he you Did see?4 you What do did?5 How the man police the did identify?

Possessive pronouns

4 Complete the dialogue with possessiveadjectives and possessive pronouns.

Mum This was 1~ house. We livedthere for.five years.

Mandy And whose dog is that?Dad it was the neighbours' dog. It was2

~, not ours.

That' s you, Mandy. And that teddybear was 3 ""-. Mum gaye it to you.

Mandy And there's Mum with 4- mabilephane.It was enormous!

Mandy Whose bag is that?Mum it was 5_.lt was your first

school bag.

[oak, there's 6 old b icycl e.i loved that bike!

Dad

Dad

VocabularyFacilitiesin a town

1 Write the correct words.

i

3

5

2

4

6

7 8

Aeademic subjeets and jobs

2 Complete the sentences with a subject ora job.

i like visiting galleries and looking at art.

i Plato was a famous Greek

2 I'm really good at biology and chemistry. I'dlike to be a -

3 Gaudi was anBarcelona.

4 My mum is a member of the Green Party.She talks ab out a lot.

5 Pablo Picasso was a famous

6 i want to study at universitybecause i like modern buildings.

J.

. He lived in

Nouns: erime

3 Complete the sentences with the words inthe box.

i Las.tweek i was the of a crime.A bmglar went into my house!

2 A cam e to interview me after thecnme.

3 The bmglar took somebedraom.

4 Two saw a man in a black jacketnear my house.

5 The criminalleft on the doorbecause he didn't wear gloves.

6 He didn't steal any money because it was ina

fram my

Verbs: erime

4 Choose the correct alternatives.

i A thief stole/arrested my bag.2 i chased/hid him down the street, but he

was very fast.3 The criminal cheated/ escaped by running

into a shopping centre.4 The police searched/stole for him for two

hours.

5 i finally saw him in a shop. iidentified/cheated him to the police.

6 The detectives arrested/ escaped him as heleft the shopping centre.

Adjeetives: people

5 Complete the words with a, e, i, °, or u.

i c_nCd_nt

2 cch

3 _np_p_i-r4 h_n_st

5 p_p_i-r6 p__r7 d_sh_n_st

Revision (Units 11&12) iiLi

Famouspeople

Mel Did you read about Tom in the paperyesterday?

Holly Yeah. Loca!Hero So!vesBurg!ary!Fantastic!

Mel There was a good photo of him, too.Holly Yes, but he looks better than that in

reallife! He's so good-Iooking!Mel Mmm. He is attractive.

Holly Do you th ink he's as attractive as Jack?

Mel No! Jack is taller than Tom. i prefer taliboys.

Holly Well, i think Tom is really great.

Mel He's a good footballer, too. He wants togo for a trial for the Manchester Unitedyouth squad.

ml Unit 13

Holly Wow! That's really caol. Ryan Giggsplays for Manchester United.

Mel And Ruud van Nistelrooy!

Holly Wow! Tom is so fantastic! i really likehim.

Mel Why don't you ask him to go out withyou?

Holly Mmm, maybe. But he probably likesyou more than me.

Mel Me? But I've got a boyfriend.

Holly i know, but you're prettier than me.

Mel No, I'm not! Loads of boys like you.

Holly Yeah, but Tom is special. i haven't gota chance.

PresentationBefore you read

1 Look at the photo. What do you think?Which things are they taIking abouI?

the burgIary Dpop stars Dfootb all DTom DCDs Dthe disco equipment D

Comprehension

2 Read and listen to the Clifton Hill story.Cheek your answers to exercise 1. Q

3 Read the story again. Are the senteneestrue (.I) or faIse (1)?

1 There was a photo of Tom in the newspaper.2 Mel doesn't think Tom is attractive.3 Tom is very tall.4 Tom is going to play for the Manchester

UnIted youth squad.5 Holly is going to ask Tom to go out with her.6 MeI thinks Holly is pretty.

4 CompIete the expressions.

1 He's - good-Iooking!

2 1- tali boys.

3 That's really _.

4 - of boys like you.

S i haven't got a _.

5 LIsten and repeat the expressions. Q

Act it out!

6 Aet out the story. Work in pairs.

---iii.

VocabularyAdjectives: physical appearance

7 Cheek the meaning of the adjectives in thebox and write pairs of opposites. Whichadjeetive has got two opposites?

s/im - fat

8 Read the Look! box. Then Iook at the picture.Which adjeetives from exercise 7 deseribeeaeh person?

We use attraetive to deseribe men and women,

but we use pretty for women only.

,.r,.r A~rV'

9 Work in pairs. Deseribe a student in yourclass and guess who it is.

ASite::; C{iiitesitort Her Itair is /0111al1d dar/\, al1d

site::; very pretty.B /s it Meh&5a?

A Yes/

Unit 13 Famouspeople BEL

GrammarComparatives

1 Look again at the CZifton Hill story andcomplete the sentences.

. He looks 1- than that in real life!

. Jackis 2- than Tom.

. You're 3- than me.

2 Complete the table.

Adjectives

talistrong

comparatives1

2

nice 3

fatslim

fatter4

prettylIgly

5

6

famousattractive

more famous7

goodbad

8

worse

3 Complete the sentences with comparativeadjectives.

1 Ben Affleck is

(attractive)2 Real Madrid is

United. (good)3 Robbie Williams is

19Iesias. (famous)4 David Beckham is

Owen. (rich)5 Robin Williams is

Cruise. (funny)6 Nicole Kidman is

Winslet. (slim)

Matt Damon.

Manchester

Enrique

Michael

Tom

than Kate

BiII Unit 13 Famous people

--

4 Work in pairs. Do you agree with thesentences in exercise 3?

A i atjree w/tfi $entence 1.Ben Affied. 1$moreattractlve than Matt Damon.

B i dOt/'tatjree/ i thlnK.Matt Damon 1$more

attractlve than Ben Afflecl\..

as ... as

5 Which sentences have got the same meaning?Match sentences 1-3 with sentences a-c.

1 Tom isn't as talI as Jack.2 Jack is as old as Tom.3 Tom's hair isn't as dark as Jack's.

a Tom and Jack are the same age.b Jack is taller than Tom.c Tom's hair is fairer than Jack's.

6 Rewrite the sentences with as ... as ornot as ... as.

Mel is talIer than Holly.fiolly I$n't a$ tali a$ Mel.

1 Holly and Mel are the same age.2 Holly is quieter than MeL.3 Jack is better than Holly at maths.4 Mel and Tom are both friendly.5 Mel is more cheerful than Jack.6 Tom and Jack are both hard-working.

7 Work in pairs. Compare each pair of things.Antalya and Istanbul

A Antalya I$n't a$ Intere$tlntj a$ istanbuL.

B i don't atjree. Antalya 1$ more Intere$tlntj and

'prettler than istanbuL.

1 hamburgers and pizzas2 Spain and Britain3 footballers and pop stars4 London and Moscow

VocabularyHeight, weight, distance and age

1 Match the questions with the answers.

1 How old are you?2 How tall are you?3 How high is that mountain?4 How long is the bridge?5 How far is the journey?6 How heavy is your bag?a 1 metre 52 centimetres.b 346 kilometres.

c 10 kilograms.d 1,490 metres.e I'm 14.f 8,848 metres.

Listening2 Look at the photos and compare the actors

and actresses.

Sharon i8 tlar/(erthan RocS:5,anti / thin/( 8hes moreattractive than Jti/iet

N&lfwie: Ford H&lfrt

Aje: 15Heijkt: 1 wietre 80cevit1wietres

tJ&If~:RQss l<J.eiVt

Aje: 31Heijkt: 1 wietre 75cevit1wietres

i.

..

.

..

...

.

.

...

..

.

..

.

...., N.~; ]vJUt .rJ;'-j" Age. '2-q.! Heijkt: 1 wietre n.. ceVttiwietres

'i

N&If~:5/1&1ftdl't 506/&lfr

A3e: '2-1Heijkt: 1 wietre 75cevit1wietres

3 LIsten to a conversation between a film

director and his assistant. They have tochoose an actor and an actress for their newfilm. Who do they choose? Q

4 LIsten to the conversation again and findfour mistakes in the notes below. Q

'5//2i) J..is assistarit

Ross is

tal/er tii.ariÇord.

:J"(/lietbettertii.ari

i

i

a '5J..arori iso/der tii.a.ri

'5J..arori 's jotbea//t1f/// ~es .

5 Discuss the questions.1 What did the director and his assistant

disagree about?2 Do you think they made good choices?

Speaking6 Complete the dialogue with the phrases in the

box. Then listen and check your answers. Q

Director Sharon is a

AssistantDirectorAssistant

they?twenty-nine andnty-one. Sharon is a

lot younger than Juliet.3 4 h ' .

s e s prettierDirectortoo.

Juliet's eyes are

7 Work in pairs. Look again at the photos ofthe actors and actresses in exercise 2 andfollow the instructions.

Student A

Imagine you are a film director. You are goingto choose one actor and one actress for themain parts in a new Tarzan film.Student A

You are the directors assistant. Explain whoyou think is right for the film. Use phrasesfrom exercise 6.

Unit13 Famouspeople..

Reading1 Look at the photos and discuss the questions.

1 What do you know about stuntmen?2 How is Jackie Chan different from other

stuntmen?

'i

j .'iii

3

4

2 Read the artiele quickly and check youranswers to exercise 1. Q

3 Read the artiele again. Are the sentencestrue (..') or false (X)? Correct the falsesentences.

1 Gary Davis's jump was nearly 50 metres long.2 Simon Crane flew two planes at the same time.3 Jackie Chan was interested in stunts when he

was a child.

4 Jackie Chan appears in mare than sixty films.5 He has got his own training company far

stuntmen.

6 His films are very serious.

ml Unit 13 Famous people

4 Discuss the questions.

1 Do you like actian films? Why?jWhy not?2 Would you like to be a stuntman ar

stuntwoman?

GrammarSuperlatives

1 Read the sentences from the artiele on page118. Then choose the correct alternative tocomplete the grammar role.

. That's the longest jump ever In acar.

. The most dangerous stunt In a film was InClifthanger.

We use superlative adjectives to comparetwo/three or more people or things.

2 Complete the table.

Adjectives Superlatives

longhigh

1

2

fatbig

the fattest3

happyfunny

the happiest4

hard-working the most hard-

working5

dangerous

goodbad

the best6

3 Complete the questions in the 'Suecess!'quiz. Use superlatives.

4 Work in pairs. Choose the correct answer foreach question in the questionnaire.

5 Now turn the page upside down and checkyour answers.

6 What do you think? Discuss the questions.

1 Who Is the best pop star In the world?2 Which is the best ever film?

3 Who is the most successful sports person inthe world?

4 Who Is the prettIest actress In the world?5 Who Is the best footballer in the world?

The css quiz!(rich) man in America has got over $100

billion. His name is ...a Eminem.b Bill Gates.c Bruce Willis.

1

2 SaHyRide was (young) astronaut ever to flyon a space shuttle. She was ...a 23 years old.b 32 years old.c 45 years old.

3 625 is (big) number of fan clubs for one popstar. Thepop star is ...aMadonna.

b islvis Presley.c Robbie Williams.

5 In 2000, film producerspaid an actress

(high) ever fee ($20 million) to appear in afilm. The actress was ...

a Julia Roberts.b Catherine Zeta Jones.c Nicole Kidman.

4 In 2002, Hakan Sükürscored (fast)

goal in the history ofthe World Cup. Hescored the goal after ...a 11 seconds.b 30 seconds.c 2 minutes and 16seconds.

6 Richard Kiel stars in James Bondfilms and he' s (taH)actor in the world. Kiel is ...a 1.98 mf'trf'S

2.08 metres taH.c

7

;)9 ~S; ~17 qi: qz qiSJ;}A\SUV - -

IJnir n F;:imomnf>onlf>..~.

Reading1 Look at the poster and answer the questions.

1 What is the competition for?2 What does the poster ask you to do?

2 Read Kate's letter to the judges. Who doesshe want to win the competition?

43 Chestnut AvenueSouthamptonS02 3JN

14th June, 2004

International Music Day Competition13 Fairford GardensLondonW1A 4XF

Dear Sir or Madam

i am writing to you about the new world stamp tocelebrate International Music Day. i think Madonnais the most successful female singer in the world,and i would like to put her face on the new stamp.

Madonna's career started more than twenty yearsago with her first single, Holiday. Today she's asuperstar all over the world. Her music and videosare always newand exciting, and she is neverafraid to change her image and try new elothes andhairstyles. Her music and her appearance influenceyoung people everywhere.Madonna is a singer, musician, daneer, actress andbusiness woman. i think she is an amazing personand a true 'Queen of Music'.i look forward to hearing the results of thecompetition.Yours faithfullyKate Petty

Dil Unit 13 Famous people

3 Read the letter again. Are the sentencestrue (v') or false (X)? Correct the falsesentences.

1 Madonna made her first single nineteenyears ago.

2 Madonna often changes her appearance.3 Young people like to copy Madonna's styles.4 Madonna is only famous as a singer.5 Kate Petty wants to know who is going to

win the competition.

Spealdng4 Who do you think is the 'King or Queen of

Music'? Choose a pop star and make notesabout himjher.

1 When did hejshe start in the music business?2 What kind of music does hejshe play?3 What's special ab out your pop star?4 Why is hej she better than other pop stars?

5 Work in pairs. Explain who you think is the'King or Queen of Music'. Use your notesfrom exercise 4.

WritingA formalIetter

6 Look again at Kate's letter. Are the sentencesabout formalletters true (...') or false (X)?Correct the false sentences.

1 You write your address at the top of a farrnalletter on the left-hand side.

2 You write the date below your address.3 You put the address of the person you are

writing to at the bottom of the letter.4 You can use the first name of the person you

are writing to.S it isn't a good idea to use contracted forms

(e.g. I'd like) in a formalletter.

7 How does Kate use expressions 1-4 in herletter? Match the expressions with uses a-d.1 Dear Sir or Madam

2 i am writing to you. . .3 i look forward to hearing ...4 Yours faithfullya To finish the letter.b To start the letter.

c To explain the reason for her letter.d To ask the other person to reply to her letter.

8 Whose face would you like to put on the newworld starnp? Write a formalletter to thejudges of the competition.

. Look again at your notes from exercise 4 anduse your ideas.

. Use the expressions in exercise 7.

~~~~~~~~~~~~~~~~~, Project idea! ~~k b ' . ""'iii

~ Mae a postera out your King or Queen ~

~~~~~~~~~~~~~~~~-~

1 Complete the song with the words in thebox.

2 Listen and check your answers. Q

3 Match the words with the definitions.

1 promises anat with other people2 dreams b things you say you are

going to doc hopesd like more, prefer

3 rather4 alone

4 Who do you think the song is about? Choosethe correct alternative.

a the singer' s brotherb the singer's boyfriendc the singer's friends

ii

li

TTn;t 1~ i::"mnl1<n"nnl" .....

Jobsfor the future

The next day.

jack Lookat this!Holly What is it?jack It's an article about James

Wilson, the first teenageastronaut!

Holly A teenage astronaut?jack Yeah. He won a competition.

He's going to go into spacenext year. They're training himnow.

Was that the prize?Yeah.

Wow! That sounds great.Mm, it does! Butthat kind ofthing never happens to peoplelike us. We won't becomefamous.

HollyjackHollyjack

.. Unit 14

i don't agree. You're a great DJ,and one day you'll be onRadio 1.

jack i don't think so.

Mel Yes,you will!Whynot? Andmaybe 1'11be a model!

Holly i don't want to be famous. i'dlike to be a nurse, or a teacher.i think you'll be a fantasticnurse. Anyway, one day Tomwill play for ManchesterUnited, and then he'lI be asuperstar!

jack i don't think so. Tom is a goodplayer, but he isn't goodenough to play for ManchesterUnited.

Don't be such a pessimist,Jack!

Mel

Mel

Mel

~-~- ~

PresentationBefore you read

1 Look at the photo. Me! is thinking about thefuture. What are her predictions? Choose thecorrect alternatives.

1 Jack will be a famous ...a news reporter. b DJ.

2 Mel will be ...a a modeL.

3 Holly will be a ...a nurse.

b an actress.

b teacher.

4 Tom will be a ...

a basketball player. b footballer.

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. Q

i

Ji

3 Read the story again and complete thesentences with the correct names.

1 - is reading about an astronaut.2 - won a competition.3 - is optimistic.4 - doesn't want to be famous.

5 - thinks - will be very famous oneday.

6 - doesn't think - will play forManchester United.

i

J,

4 Who says the expressions?

1 look at this!

2 That sounds great.

3 i don't agree.

4 Whynot?5 i don't thin k so.

6 Don't be such a pessimist!

5 Listen and repeat the expressions. Q

6 Discuss the questions.

1 Which job would you like to do?2 Would you like to be famous? Why?jWhy not?

Act it out!

7 Act out the story. Work in gwups of three.

VocabularyJobs

8 Match the pictures with the words in the box.

1

7

2

5 6

8 9

9 Match the definitions with the jobs fromexercise 8.

This person writes for a newspaper. jOiima/ist

1 This person catches erirninals.2 This person works in a hospital.3 This person gives concerts.4 This person is usually tali and attractive.5 This person flies an aeroplane.6 This person plays a team game.7 This person checks people's teeth.8 This person travels in space.

10 Discuss the questions.

1 Which job is the most difficult? Why?2 Which job is the most fun? Why?3 In which jobs can you become famous?4 In which jobs can you become rich?

T Tn;t lA. TAh< (At' thA hitllt'A IIIIt."--

Grammarwill (predictions)

1 Look again at the Clifton Hill story andcomplete the table.

iYouHeSheitWe

They

12- on Radio1.

willplayfor ManchesferUnited.

3 4 famous.will not

2 Match the parts of the grammar mles.

1 Weuse will...2 Weusewon't ...

a to make positive predictions about the future.

b to make negative predictions about the future.

3 Make predictions about the future. Completethe sentences with will or won't.

1 Spain - win the next World Cup.2 Britney Spears - become a successful

actress.

3 The next Glympic Games - be inMadrid.

4 David Beckham- return to ManchesterUnited.

5 The next Harry Potter book - be verypopular.

6 Elijah Wood - win an Oscar next year.

will (questions)

4 Read the questions. Then choose the correctalternative to complete the mle.. What will Jack do in the future?. Will Tom play for Manchester United?

In questions, we use will before/after the subject.

ml Unit 14 jobs for the future

5 Complete the dialogue. Write Holly'squestions to the fortune teller.

Holly WII i be hClppy.?Zen Yes,you will. You'lI be very happy!Holly 1Zen No, you won't. You'lI never become

famous, but you'lI have famous friends.Holly 2 ?Zen No. You won't go to university, but

you'lI work in a hospital.Holly 3Zen Yes.You'lI be a good nurse.Holly 4Zen No. You won't be rich, but you'lI

marry a rich man.Holly Really? 5Zen I'm sorry. The picture is fading. i don't

know who you'lI marry.

?

?

?

?

Pronundation

6 Find four examples of the contractedform of will in the dialogue in exerdse 5.YOL/Li be very hClppy

7 Listen to the dialogue in exerdse 5 andcheck the pronundation of the contractedform of will. ~

8 Work in pairs. Practise the dialogue withyour partner.

9 Work in pairs. Discuss the predictions aboutwhat will happen in the Clifton Hill story.

Holly will start at Clifton Hill schooL.A ye$, IthinI:. Bhell qo to Cltfton Hill Bchool

becClI/BeBhe wClntB to be necir Tom.

B i dtsClqree. ithini:' Bhell BtClY Clt her Bchool

1 Mel will become a modeL.

2 Tom will play for Manchester United.3 Tom will go back to America.4 Jack will buy a moped.5 Me! will find a new boyfriend.

VocabularyAdjectives: personality

1 Check the meaning of the adjectives in thebox and complete the table.

Positive Negative-i moOtfyclever

"

2 Which adjectives from exercise 1 deseribeeach person?

Mark is happy one moment and sad thenext. moOtfy

1 My sister is very intelligent.2 My dad enjoys making things.3 Liz doesn't like meeting new people.4 My friend always does what she promises.5 David often gives presents to other people.6 My brother is always fun and full of energy.7 Paul always thinks something bad is going

to happen.8 My cousin never tells me what she's do ing.

Listening\

3 Look at the horoscope chart and answer thequestions.

1 Which students in your class have got thesestar signs?

2 Are the descriptions true?

2tqU~i'lU$Jan. 20 - Feb. 18

Pasitive characteristics: hard-warking andgenerousDangers: pessimistic

<1l$C&$Feb. 19 - Mar. 20

Pasitive characteristics: creative andvery 1

- 2Dangers: quite -

~llt)!'~

Sept. 23 - Oet. 23 ~Pasitive characteristics: friendly and romantic~Dangers: abit mean

00 "'~"""" ,~=.o o "0' ..'~~O o.". """" ..,..'~ .' ..

$COi'flOOet 24 - Nov. 21

..h

.. 3d

4Pasitive c aracteristics: - an -Dangers: sametimes jealaus

4 LIsten to a radio programme abouthoroscopes. Complete the horoscopechart with the correct adjectives. ~

5 LIsten again. Choose the correctalternatives. ~

1 Chris likes/doesn't like his job in the bank.2 Chris will be a detective/bank robber.3 Maria is at school/university.4 Jeremy thinks Maria's jealousy is/isn't a

problem.5 Maria will be a doctor/an artist.

Speaking6 Work in pairs. Follow the instructions.

Student A

You are a caller to the HoroscopeShow. Chooseone of the cards and ask student A yourquestions.Student B

You are Jeremy Stein from the HoroscopeShow.LIsten to student B and answer his/herquestions. Use the information in thehoroscope charto

Jeremy Hello.How cani hep.?Caller H~ l'mSimon.l'm a A8ces. Next montft,l'm

qoinq to move...

Name: MaggieStai- si9cniScorpio

QI..I~s~iQns\:I'mgoingto go cçimping with afriend; She's anAquarius. Will we geton well together? Willwe have fun?

TT_!~ '" T_L, r L, L...

Reading1 Read the interview from Right Now!

magazine and choose a tide. ~

a Living in spaceb Exploring spacec The future of space

2 Read the interview again and answer thequestions.

1 Is Joe excited about the trip?2 What do the astronauts do when they're not

working?3 Where do they sleep?4 Why is it sametimes difficuIt to sleep?5 How do the astronauts wake up?6 What does Joe think about space food?7 What does Joe promise the interviewer?

Next week, Joe Bensoh w.illbeglhhissecond trip ina space shuttle. He talkedtc:> meaboutHfein space.

1 RN Are you looking forward to your next tripin space?

Joe Yes,i am. i thinkifll be great!

RN i know you work hardin space, but do you have anytime off?

5 Joe Of eourse! We play garnes, wateh videos, talk to ourfamilies on the radio or tusLlook out of the window!Did you know sunsets and sUnriseshappen every forty-five minutes in space?

RN That's amazing! What aboHt sleep? Is the shuttle bigenough for beds?

Joe Yes.We usually sleep in sleepingbags on a bunk bed.We have to tie ourselves to the bed so we don't float.We rest for eight hours, buhornetimes the shuttle istoo noisy and we can't sleep.

15 RN Do you havealarrn clocks in space?

Joe When it's time to get up, the Mission Control Centresends wake-up musiÇ.Everyday they choose a specialsong for a different astronaUt.

RN That's really nice! What aboutfood? What's it tikel

20 Joe Well, we eat a lot of differentfood. We eat fruit in itsnatural form, butwe add water to other food.lt tastesfine.

10

RN I'd love to try some space food!

Joe 1'11bring you some.

25 RN Really?

Joe Sure! i won't forget.

RN Great! And will you come again for anather interview?

Joe Of course! 1'11teli you an about my trip.

-iD Unit 14 jobs for the future

---

3 Read the definitions and find the words inthe interview.

1 Free time.2 The time in the evening when you last see

light in the sky.3 The time in the moming when light first

comes into the sky.4 Move slowly in the air.

4 Would you like to be an astronaui? What arethe advantages and disadvantages?

~TTTTTTTTTTTTTTT~, Projectidea! ~~ Makea posteradvertfor a trip in the space ~~ shuttle.Deseribethe journey,the foodand the ~

~~m~~~:~~~~~~~~~~-~

Grammarwill (promises)

1 Read the sentences from the interview onpage 126. Which three sentences are promises?

. i think it/ll be great!

. ni bring you same.

. i won/t forget.

. ni telI you all about my trip.

2 Complete Joe/s promises to his family. Usethe verbs in the box with will or wonlt.

5ee

i IIBeeyou soan.

1 i to you every dayan the radio.2 i anything dangerous!3 i in a diary every day.4 i very careful.5 i to take photos.6 We on holidayafter my trip.

3 Make promises for each of the sItuations.

You/re going to work in a shop during thesummer holiday. What do you promise yournew bass?III wod; nartl.

1 Your best friend telIs you a secret. What doyou promise him/her?

2 You borrow same money from your sister.What do you promise her?

3 You forget to do your homework. What doyou promise your teacher?

4 Your room is very untidy. What do youpromise your parents?

5 You break your litde brother's tay car. Whatdo you promise him?

6 You/re going on a long holiday, but your sistercan/t come. What do you promise her?

1

too and enou9h

4 Read the example sentences. Then choose thecorrect alternatiye to complete the grammarrules.

. The jacket is toosmaIL.

. The jacket isn/tbig enough.

1 We use too before/after the adjective.

2 We use enough before/after the adjective.

We use too and enough when we aren't happyabout a situation.

5 Complete the sentences with too or enough.

Models have to be very talI. Mel is onlyi metre 58 centimetres.

Mel iB too Bnort. (short)

Mel iBn't tali enolltjfl. (talI)

1 In Britaini you have to be seventeen yearsold to ride a motorbike. Tom is only sixteen.He . (young)He . (old)

2 Students have to get 80 marks to pass themaths test. Holly has only got 75.Holly/s marks . (high)Holly/s marks . (law)

3 The CD costs fl5. Jack has only got flO.The CD . (expensive)The CD . (cheap)

4 The shoes are size 37. Holly needs size 39.The shoes . (big)The shoes . (smaIl)

5 Tom doesn/t like British weather.

It . (warm)it . (coid)

Umt 14 Jobsforthefuture IID

Reading1 Read Aunt Rita' s letter to Myra. Where does

Myra live?

/4- Coo~ srre-e-r

/VIe-IboVlr;ie-,AVlsrrali-a2/ sr f/ ove-ivibe-r, 2004-

De-ar /VIljraJVlsr a ,.ore- ro salj 'Happlj Bi-rr/A.dalji'

i. /A.ope- IjOVl Ii-~e- r/A.e- pre-se-,.rl YOVlrGOVlsi-,.S bor/A. se-,.d r/A.e-i-r love- a,.d be-srwi-s/A.e-s, /VIarr/A.a wu! de-!-i-,.i-re-IIj se-,.d

IjOVl a,. e--iviaU soo,.,/viarr/A.a 's i-,. /A.e-r iasr Ije-ar ar SG/A.ool,.0w, i. Ga,.'r be-li-e-ve-i-rl S/A.e-'s ,.or sVlre-w/A.ar ro do ,.e-x1: s/A.e- love-s la,.gVlage-s,

so pe-r/A.aps s/A.e-'II srVldlj Fre-,.G/A.a,.dspa,.i-s/A. ar vi,.i-ve-rsi-rlj' i. /A.ope-s/A.e-

sraljs i-,. /VIe-IboVlr;ie-,TLivi's ,.i-,.e-re-e-,.,He- /A.as,.'r gor a Job,

bVlr /A.e-sOIVle-ri-ivie-splaljs r/A.e- pi-a,.o a,.d

si-,.gs wi-r/A. a 10Gal pop groVlp, /VIaljbe-/A.e-'IIbe- a falVloVls si-,.ge-r o,.e- dalj'

vv/A.ar aboVlr IjOVl? vv/A.ar are- ljoVlr /A.ope-sfor r/A.e-fVlrVlre-7 VVri-re- a,.d re-II ivie-I

Gi-ve- IVIIj love- ro e-ve-rljbodlj' VVe-'11probabllj vi-si-r Bri-rai-,. ,.e-xr Ije-ar, so i./A.ope- we-'II se-e- IjOVl soo,.,Lors of love-Avi,.r Ri-ra

VocabularyAdverbs of probability

3 Find the adverbs in the box in Aunt Rita' s

letter. Then answer the questions.

i Which adverb means that something iscertain?

2 Which adverb means that something is verylikely?

3 Which two adverbs mean that something ispossible?

4 Which adverbs go befa re will?5 Which adverbs go after will?

ml UnIt 14 ]obs for the future

r-

2 Read Aunt Rita's letter again. Are thesentences true (.f) or false (X)? Correct thefalse sentences.

i It's Myra's birthday.2 Aunt Rita has got two children.3 Martha is at university.4 Tim isn't working at the moment.5 Tim plays a musical instrument.6 Aunt Rita is planning to visit Britain.

~

Speaking4 Work in pairs. Make predictions about what

you'li do in the next five years. Use the ideasin the box.

A /1/ c:lefil1lte/yrjOto t/t!iversify. / wtmt to stt/c:ly

ft!rj!t$ft.

B /1/jlrobab/y rjOto t/t!iversity, too, bt/t / WOt!'tstt/c:ly

ft!rj!t$It. Peritajls /1/ stt/c:ly fl;1jlat!ese.

WritingAn informalletter

5 Look again at Aunt Rita's letter. Then readthe sentences about informalletters andchoose the correct alternatives.

1 You start an informalletter with the first

name/name and surname of the person youare writing to.

1 You write your address on the left/right atthe top of the letter.

3 You write the date above/below your address.4 You can/can't use contracted forms in an

informalletter.

5 You finish the letter with your first name/name and surname.

6 Are the expressions formal or informa!?

Dear Sarah informal1 Dear Sir or Madam1 Write and tell me!3 See you soan!4 i look forward to hearing from you.5 Take care!

6 i am writing to you about ...7 Yours faithfully8 i hop e you got my last letter.

7 Imagine you are Myra. Write a reply to AuntRita's letter. Use some of the informalexpressions in exercise 6.

. Thank your aunt for her present. What didshe send you?

. Tell her your news. What are you studying atschool?.Write about your hopes for the future. Whatwill you do when you finish school?

~---oi.

1 Answer the questions.

,

ID

e of the suit.

2 Work in pairs. Think of two more quizquestions.

3 Ask the class your quiz questions.

Vnit 14 Jobs [or the [uture -iD

Revision (Units 13 & 14)GrammarComparatives

1 Compare the words. Write sentences.

dogs / cats (smaIl)Cats are sma//er than dOtjs.

1 CDs / DVDs (expensive)2 one kilometre / two hundred metres (far)3 Manchester United football team / Oxford

United football team (goad)4 mopeds / motorbikes (big)5 eighty minutes / one hour (long)6 Madonna / Britney Spears (pretty)7 London / Istanbul (hat)

Superlatives

2 Complete the dialogue with supedatiyeadjectives.

Jaek

Holly

Tom

BD Revision (Units 13&14)

will

3 Make predictions ab out the future. Completethe sentenees with will or won't.

1 Turkey - win the next Eurovisian SongContest.

2 David Beckham - score a lot of goalsnext year.

3 Madonna - make a lot of new CDs.

4 The next Leonarda DiCaprio film - bevery popular.

5 Cameron Diaz - become a pop star.

4 Complete the dialogues with the verbs in thebox. Write promises.

A i don't wantto walk to work in this rain.

B i i yoüto work in my car.

dirty shoes.them.

A Remember to take the keys!B Don't worry, i 3

but don't come

i promise!

too and enou9h

5 Rewrite the sentenees with too or enough.

The boys are too young to go to university.The boys aren't o/d enotltjh to tjo to tlniversity

This coffee isn't cold enough for me todrink.

ThiS coffee iS too hot for me to drinl{.

1 The camera is too expensive for me to buy.2 My dad isn't slim enough.3 The T-shirt is too smaIl for you.4 Let's leave. This film isn't interesting enough.5 The girls are too short for the basketball team.6 This exercise isn't easy enough.

VocabularyAdjectives: physical appearance

1 Look at the picture and complete thedescriptions.

. 1Betty IS S-,2 t- and very

~ 3 p_. She's got4f- hair.

Steve is 5 S_, and

quite 6 f_, but he' sals o very 7 S-. He'sgot 8 d- hair.

Height, weight, distance and age

2 Match the pictures with the questions inthe box.

1

3

...

3 Match the questions from exercise 2 withanswers a-f.

a 1 metre 17 centimetres.b 346 kilometres.

c 18.6 kilograms.d 2,737 metres.e 14.f 8,000 metres.

Jobs

4 Match the statements with the words inthe box.

Ilove flyingaeroplanes.It's a greatjob!

{lilot

1 '1 scored three goals last Saturday!

2

3 Youshould dean your teeth twice aday.

I'm writing a news report about the economy.

5 You've got a bad cold and a cough.You should go to bed.

6 We' re going to arrest this man. Wethink he' s the burglar.

i often change my elathes ten times aday!

Ac:ljectives: personality

5 Complete the words with a, e, ii o or u.

1 cC_I-v-

2 m- _d y3 p_s s_m_s I-c4 c Lv_r5 r_L _b L

6 g _n_r- _s7 s_c cI-v-

8 Lv_l y

Revision (Units 13&14) iiiii

Health and sports

At the leisure centre.

Mel

Tom

Mel

Tom

Mel

Tom

Mel

Tom

MelTom

MelTom

Mel

IIDII Unit IS

Hi, Tom! What are you doing here?

I'm training. The Manchester Unitedfootball trials are next Saturday. If iperform well, 1'11be in the youth squad!That's brilliant! So, are you trainingreally hard?Yeah. If i don't train every day, i won'tbe fit enough. What about you? Are yougoing swimming?

Yes, I'm trying to be healthy.

Why don't you go jogging with me onemorning?What time?

We can meet at six o'clock.

That's very early!

You won't get fit if you stay in bed! Oh,well. How's Jack by the way?

He's OL<,i suppose.

Is he happy now he's got his CDs back?Mmm.

Shall we go and watch Tom's footballtrials next Saturday?

You promised to come shopping withme on Saturday.

Oh yes, i forgot. That's a shame!No, it isn't. Tom isn't going to get intothe youth squad.Oh, Jack! Tom's really good at football.He doesn't have a chance!

i suppose you're right.

PresentationBefore you read

1 Look at the photos. What do you think?Answer the questions.Photo A1 Where does Mel meet Tom?2 What's Tom do ing?3 What's Mel doing?Photo B

4 What are Me! and Jack talking about?

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. ~

3 Read the story again and answer the questions.

1 What's Tom training for?2 Why doesn't Mel want to go jogging?3 What are Jack and Me! going to do on

Saturday?4 Does Jack think Tom will get into the team?5 Does Mel agree with him?

4 Complete the expressions.

I.J.

1 - about you?

2 That's very _!

3 How'sJack _?

4 He's OK,_°

5 - a shame!

6 i suppose _°

5 Listen and repeat the expressions. ~

Act it out!

6 Act out the storyo Work in groups of three.

VocabularyKeeping fit

7 Match the pictures with the activities in the box.

is

7

4

rir

8 Complete the table with the activities fromexercise 7. Which activity can you do indoorsand outdoors?

Indoor activities

do marticil arts

Outdoor activities

9 Discuss the questions.

1 Which activity is the most difficult?2 Which activity is the easiest?3 Why is it important to be fit?4 How do you keep fit?

Unit 15 Healthand sports Bil

GrammarFirst conditional

i Look again at the Clifton Hill story andeomplete the sentences.

. If i 1- well, i 2- in the youth squad!

. If i 3- every day, i 4- fit enough.

. You 5- get fit if you 6- in bed!

2 Read the information in the Look! box. Then

eomplete the rule.

The if-Ciause can come at the beginningor at theend of a sentence.

When it comes at the beginning, we use a comma.

if he eatsa lot of sugar, he'IIget fat.

When it comes at the end, we don't use a comma.

He'lIgetfat if he eats a lot of sugar.

To make the first conditional we usethe presenttense in the 'if' clauseand - + infinitive inthe main clause.

3 Complete the sentenees ab out Simon.

eat a lot of hamburgers / get fatIf SimOf1 eat8 a lot of hambiirqers, hell qet fat.

i Simon not exercise / not be fit2 he not have any friends / wateh TV all day3 he go to bed Iate / feel tired4 he drink a lot of cola / get bad teeth5 he get bored / not go out6 he not play sport / not be healthyand strong

.. UnIt is Health and sports

4 Look at the pictures and eomplete thesentences. Use the verbs in the box.

i If he isn't earefuL, ... 2 She'll get very fat. . .

3 If she doesn't mnfast, ...

4 She'll bum herhand.. .

5 Mateh the questions with the correet answers.

i Where will we go tornanow if the weather'snice?

2 Will you go to the football match?3 What will you do if you pass all your exams?4 If i rent a DVD, will you eome to my house?

a I'll have a party.b i think we'll go to the park.c i will if i finish my homework.d Yes, i will if i can get tickets.

6 Complete the questions with the eorreetform of the verbs.

In this week's edition of Teen TImes, we interviewMary Jones, a fitness instructor from Leeds.

TT

(heip) me?Mary You can do any sport you

enjoy. Jo"'ggingand swimmingare good.i !ikejogging. But 3(I/get) very fit if4 (I/go) jogging?

Mary Yes.You'IIget fit if you go three or fourtimes a week.

5And how about food? (I/get) fatif 6 (I/eat) a lot of sugar?

Mary Well, don't eat lots of sugar. A little sugaris OK.If 7 (I/go) on adiet, 8(I/feel) healthier?

Mary Yes, but remember to eat fresh food anddrink a lot of water.

TT

TT

TT

-iii

Listening1 Read the information about a radio

programme. How do you think we can stayhealthy in winter?

2 Listen to the programme and tick the topies thehealth expert mentions. Q

exercise D pollution D illnesses D diet D

3 Listen again. Are the statements true (.I) orfalse (X)? Q

1 Tina Carling is a doctor.2 Indoor activities are better than outdoor

activities in the winter.

3 Tina thinks jogging is a good idea inthe winter.

4 Tina says you can get vitamin C fromfresh fruit.

5 It's a good idea to drink coffee every day.

VocabularyIllnesses

4 Complete the words with a,e,i,o and u. Use adictionary.

_.- -~--i

1 a c_Id 2 a c- _gh

3 a soc the _t

5 SI-mach-_che

7 b_ck_che

1

4 a he_d_che

6 e_r_che

I,8 I- _thach-

5 Complete the sentences with the illnessesfrom exercise 4.

Turn off the music. I've got earclcne.1 Mandy ate too much pizza. Now she's

got_.2 Can I have an aspirin? I've got a -'

3 I carried a lot of heavy boxes yesterday.Now I've got -'

4 If you get -, go to the dentist.5 My dad smokes a lot and now he 's got a

really bad -'

6 Don't go outside in the cold without ajacket. You'll get a -'

7 I shouted a lot at the football match. NowI've got a -'

Spealdng6 Complete the dialogue with the phrases in

the box.

DoctorPatientDoctorPatientDoctorPatient

How do yo/l (eel?

very well.?

\a very bad sore throat.

I've alsa got a

!j,d

Doctor

Patient

Doctorof my head.

Get plenty of sleep. 4

three times a day, and 5of water.

doctor. Go odbye.Patient

)

7 Work in pairs. Follow the instructions.Student A

You are a patient. TelI student B how you feeland explain when your illness started.Student B

You are a doctor. Ask student A how hejshefeels. Find out when the illness started and giveyour advice.

8 Change roles and do the activity in exercise 7again.

Unit15 Healthandsports..

Reading1 Look at the photos and discuss the questions.

FREEZIWGWATERORWARMMUl>?This month In HealthFocus, .:Maddie GolIins triestwo unusual health treatments.

Ice dippingi Last month i Went to Russia to try 'ice-dipping.' Ice-dipping is a poptilarhealthtreatment in extremely coM phicesUke Finlandand Russia.

2 Experienced iceMdippersgointo a saui;iaJirst,and then they swim in icy i'ivers. The temperaturein the sauna is 50" C. After the saui;ia,they walkacross the ice and jump intQ thefl'eezii;ig water.

3 When i went ice-dippii;ig; i didn'thave to gointo the sauna because i was abegii;mer; i wentstraight into the eold water. !'had to get oÜt of thewater after thirty seeands b~cause it was freezing!4 When i came Qut,TCOlildn'tfeelmy legs!It was the middIe of the winter. and i was outside

in a swimming eastume! It's good for your heart,and i felt great afterwards. Butjf you don't likethe cold, then ice-dipping certainly isn't for you!

2 Read the artiele quickly and check youranswers to exercise i. ~

3 Read the artiele again and answer thequestions.

1 Where did Maddie go ice-dipping?2 What do ice-dippers do before they jump

into the water?3 How long did Maddie stay in the water?4 How did Maddie feel after ice-dipping?5 How long do es a mud bath take?6 How did the customers at the health club

feel about mud baths?7 Why did Kate have mud baths?

.. Unit 15 Health and sports

.....-

Photo A

1 Where do you think the photo is from?2 What is the man do ing?Photo B

3 What is the woman do ing? Why?

~,

Mud baths5 if you'vegot badskin, mud ba.thsare reallygood for yoü. Whenyouhave a mud bath, theycover YOl1l'skin with different types of mud.Then you relax and wait för ai;ihour. Your bodygets a lot of impol'tant;rninerals from the mud,and the treatment cleans yoÜr skin.

6 i wei;it to the1Hai;igle -BtealthClub to try amüd bath, and i spoke to some customers there.They think themud haths are amazing! Onecustomer,Kate, usedmudba.ths to treat her skinproblems. .;Beforethe IDl1dbath treatments, sheeauld only usespecial.soap from the doctor, andshe couldn'tgo swiinming in the sea. Then shetried mud baths andrecovered from her skinproblems. Mud baths changed herlife!In next month'sinagazine, Maddie is going tovisit a spor.tscampinAmerica.

4 Match the pictures with words from the box.

5 Discuss the questions.

1 Would you like to try one of these healthtreatments? Why?jWhy not?

2 Can you think of any other unusual treatments?

GrammarZero conditional

1 Look again at the artiele on page 136 andcomplete the sentences. What tense do we usefor the zero conditional?

. If you 1- the cold, then ice-dippingcertainly 2- for you.

. If you 3- bad skin, mud baths 4-

really good for you.

2 Read the example sentences. Then match theparts of the grammar rules.. first conditional

i won't go cycling if it rains.. zero eonditional

If you've got a cold, vitamin C is good for you.

1 Weuse the first conditional to taIkabout ...

2 We use the zero conditional to talk about ...

a facts and things that are alwaystrue.

b things that are possible in the future.

3 Read the Health Focus questionnaire andehoose the eorrect answers.

How much do youl.<now about ~ealthy living?Takeour HealthFocusquestionnaire.

d~

~1 If you drink a lot of coffee,

a you sleep very welL.\. b you don't sleep welL.

2 You get a lot of protein ...a if you eat meat.b if you eat vegetables.

3 People become fat ...a if they eat a lot of bread

and pasta.b if they eat a lot

and vegetables.

4 If you've got backache, ...a jogging is good for you.b swimming is good for ya

s Youhave healthy teeth .a if you drink a lot of milk.b if you drink a lot of water.

,

4 Write two more questions for thequestionnaire. Then ask the elass your questions.

-

Past modals

5 Read the sentenees from the artiele on page136. Then eomplete the table.

. i didn't have to go into the sauna.

. i had to get out of the water afterthirty seconds.

. She eould only use special soap fromthe doctor.

. She eouldn't go swimming in the sea.

6 Complete the letter to Health Focus magazine.Use had to, didn't have to, could or couldn't.

De..o.-.{

Jo

Ot<.

Unit IS Health and sports iiLi

Preseni modals Past modals

can 1

can't 2

have to 3

don't have to 4

Reading1 Read the artiele and choose a tide.

a When i first went mountain dimbingb The dangers of mountain dimbingc How to be a good mountain dimber

correctenoughto

4 if you decide to go mountain dimbing, youwilI see same amazing places. lt's a greatsport and you'lI feel fantastic. Youdon't haveto be a professional, but be careful, prepareproperly and keep fit.

2 Read the artiele again. Are the sentencestrue (.f) or false (X)? Correct the falsesentences.

1 It's a good idea to take a lot of equipmentwhen you go mountain dimbing.

2 You must always go mountain dimbing withother people.

3 Only fit people can go mountain dimbing.4 You can only dimb for one hom at a time.

ml Dnit 15 Health and sports

-----

Speaking3 Look at the photos and discuss the questions.

"

1 What are these sports?2 Why do people do them?3 Would you like to do them?4 Are the sports dangerous?5 What training and preparation do people

have to do?

VocabularyVerbs and nouns

4 Read the example sentences and answerthe questions.1 Which word is a noun?2 Which word is a verb?

. You need to prepare well.

. Youneed to do a lot of preparation.

5 Check the meaning of the words andcomplete the table.

Verb Noun

cI/SCt/88/Mdiscuss

prepare

communication

training

practise

building

WritingWriting an introduction and a conclusian

6 Look again at the artide on page 138. Matehthe paragraph headings with the correetparagraphs.

a Some final thoughts parC1qraph4b Diffieulties and dangersc Introduetiond Fun in the mountains

7 You are going to write an artide ab out how tobe good at sp ort. Choose a sporto Then answerthe questions and make notes.

.i

i'1

-1i 1 Why do you like this sport?

2 Is there anything difficult or dangerousabout it?

3 What training do you have to do?4 How ean you make the sport safer?5 Do you have to eat a special diet?

8 Check your notes and organize your ideas intotwo main paragraphs. Then write anintroduction and a eondusion.

<J

9 Write your artide.How to be a champlol1 rootbaii p!aver

Tootba!! IB aqreat Bport, bllt yoiihave to be very {It ...

~ ~, Projectidea! 41

~ Makea poster about how to keep fit and healthy. ~

~~(~d:i:::i~i~~~x:c:e.:n~~~ - ~

.......

1 Read the squares in the game. Which squaresare good? Which squares are bad?

2 Write more good andbad situations forsquares 3, 6 and 8.

3 Now read the rules and play the game.

1 Ifyou throw a 1, 3 or 5, move one space.2 Ifyou throw a 2, 4 or 6, move

two spaces.3 You mustthrow the exact number to finish.

Unit15 Healthandsports..

Amazing stories

TwoweeksIater.

Holly Guesswhat happened yesterday evening?Mel i don't know. Were you preparing for the

maths test?

Holly No, i wasn't. i was at home. iwasn'tdoing my homework. My mum and iwere chatting and we were watching TV.Then the phone rang!

Mel Whowas it? Come on, teli me!Holly ltwas ...jack Look!There'sTom!i don't believe it! He's

on TV!Mel What?

jack It's the Manchester Unitedyouth squadmatch - and Tom's playing!

Later.

Mel Can we ta Ik,Jack? I'm really unhappy.Why are you so jealous of Tom?

i don't know. It'sjust, ... he's good ateverything and he's so competitive. Nowhe's in the Manchester United youthsquad and he's really successful! I'm sureyou like him more than me.

Listen, Jack! Tom's just a friend. You're agreat person and a fantastic DJ! i reallylike you a lot. You're my boyfriend andyou always will be.Thanks, Me!. I'm sorry.

jack

Mel

~

Mel What did you want to teli me thismorning, Holly?

Holly Oh, yesi Guess who rang me last night?Mel I've no idea!

Holly Tom! He asked me to meet him in a cafe.Then we're going to go to the cinema. ican't believe it. He likes me!

Mel Wow!That's really exciting!

lJIiI Unit 16

PresentationBefore you read

1 Look at the photos. What do you think?Choose the correct alternatives.

1 Tom will ...a arrive Iate.

b appear on TV.2 Jaek will ...

a have a party.b talk to Md about Tom.

3 Tom and Holly will ...a argue.b go out together.

Comprehension

2 Read and listen to the Clifton Hill story.Check your answers to exercise 1. ~

3 Read the story again and answer the questions.1 Who does Jaek see on TV?2 Why is Jaek jealous of Tom?3 Does Md want to go out with Tom?4 Who rang Holly?5 Where is Holly going to go with Tom?

4 Complete the expressions.

1 Guesswhat _?

2 (ome on, - me!

3 He'sgood at _.4 Tom'sjust a _.5 I've no_!

5 LIsten and repeat the expressions. ~

Act it out!

6 Aet out the story. Work in groups of three.

.

VocabularyNouns and adjectives

7 Check the meaning of the words andcomplete the table.

Noun

beauty

Adjective

beCllltl(1I1

success

decisive

competition

dangerous

comfortable

safety

8 Complete the sentences with words fromexercise 7.

1 You won't be - in the exam if you don'twork hard.

2 i don't like paraehuting. It's too _.3 She's so -. She'll be a model one day.4 He's very good at swimming. He wins every

swimming _!

5 Come on. Make a _. Which film do youwant to wateh?

6 This chair is really -. i ean sleep in it.7 You must wear a seat beIt in the ear. - is

very important.

9 Diseuss the questions.

1 What would you like to sueeeed at?Why?

2 Do you like eompetitions? Why?jWhy not?

Unit 16 Amazing stories BILL

GrammarPast continuous (positive and negatiye)

1 Look again at the Clifton Hill story andcomplete the table.

iHe

Shelt

was/l~doingmyhomework.

WeYou

They2_/weren't watching TV.

2 Look again at photo A from the Clifton Hillstory and make sentences about it.

Jack i watch 1VJClC/( WClS wCltchil1q TV

Holly i do her homeworkHo//y WClSI1:dOil1qher homewor/(.

i Tom i play football2 Jack i eat a hamburger3 Holly and Mel i sit on the sofa4 Holly i read a book5 Me! i ask Holly a question6 Jack i IIsten to music

3 Complete Tom's diary with the verbs in thebox. Use the past contInuous.

Tuesday 15th

You'\\ I'\e.ve.( beli..e.ve. LI:.. i 5O,w Ç<.uud V(AI'\

Ni..SI:.e.I(OO~ i:.oo"':} i. i 1 for o.fri..e.l'\d oul:.si..de. I:.he. fool:.bo.II sl:.(Adi..u~. Ç<.uud

2(Al'\d (Al'\oI:.he.( pl"':}e.( 0.101'\8 i:.he.

(O(Ad. The.~ 3 . bul:. i:.he.~ di..dI'\'l:'4look ve.(~ ~. The.~

Ç<.uud i..s ve.(~ f(Ashi..OI'\o.ble. - he.

o. ve.(~ e.)<...pe.I'\Si..ve. Ie.(Al:.he.( <:'00.1:.1. II:.

6 . bul:. he. 7 0.1'\ u~b(e.II(A.

BILL Unit 16 Amazing stories

Past continuous (questions)

4 Complete the tables.

Was

1

helping?I/he/she/it

you/we/they cooking?

Yes, i 2-=--./No,1 3-=---

Yes,we 4-=--./No, we weren't.

5 Complete the dialogue with Sue's questions.Use the past continuous.

Sue

AmySue

Amy

Sue

AmySue

Amy

Sue

Amy

Sue

Amy

Sue

Amy

Sue

(you i shop FGuess what! i was In

Sharon Stone!What

(shel do Fdrinking a caffee.

(she/sItFCircus. She

(ti}ey!talk ab out) ?so i

( she i wear)?a black dress and dark

(theyi make a film)?i couldn't see any

(youi stand)

Amy Not very long. A bodyguard asked me

6 Work in pairs. Ask and answer questionsabout what you were doing yesterday.

A WhClt were yoii dOil1qcit eiqht oc/oc/(yesterdClY

momil1q?

B / WClSeCltil1qmy breCl/(fClst

i~ 2

Reading1 Look at the photos. What do you think the

three stories are ab out?

i thil1!; the (I/8t 8tory i8 ciboiit ci 8torm.

2 Read the stories in Teens Today magazine andcheck your answers to exercise i. Q

3 Read the stories again and answer thequestions.

i What were Sarah and her friends do ingwhen it started to rain?

2 What happened to Sarah?3 How did David become rich?

4 Why doesn't he tell his university friendsabout his money?

5 What was Megan doing when she saw theanimal?

6 What did Megan's friend think?

4 Read the definitions and find the words inthe stories.

i Bad weather with wind, rain and sametimeslightning. (story i)

2 Hit very hard. (story i)3 A person with a millian pounds. (story 2)4 Very cold. (story 3)

5 Discuss the questions.

i Do you know any amazing stories?2 Do you watch 1v programmes about

amazing stories?

i 8C1W ci protjrClmme ciboiit ClI1cimClzil1tj per8011. He fell

from ClI1cieroplCll1e ClI1c18l1rvivecl.

.""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""4

~ Project idea! ...

~ ~a~:::~~:I:..::~:t:~~~BII Unit 16 Amazing stüries

.

--, ".~B

fo,be dj/ve

i

i

i

David

i

'

1

i

i

a ii

i.,i

i

,i,,..

.i,

Megan

GrammarPast continuous and past simple

1 Look again at the stories on page 144 andcomplete the sentences.

. i 1 with my friends.

. Suddenly lightning 2

. i 3 for my exams.

. i 4 at my ticket.

. We 5 to go for a walk.

. it 6 under a tree.

me!

2 Choose the correct altematives to completethe rules. Then re ad the Look! box.

1 We use the past simple/past continuous for acompleted actian in the pasI.

2 Weuse the past simple/past continuous for alonger actian in progress at a time in the pasI.

We don't usually use be, love, like, believe,understand, want, know and think incontinuous tenses.

3 Look at the picture and complete the story.

4 LIsten to the story and check your answers toexercise 3. ~

Time expressions

5 Read the sentences and complete the ruleswith when and while.

. While i was cycling home, i saw a ghost.

. We were eating dinner when the telephonerang.

. As i was leaving schooL, i saw Jim.

. ]ust as i was going out, it started to rain.

1 We usually use as,just as and - withthe past continuous.

2 We usually use - with the past simple.

6 Match the parts of the sentences.

7 Write the words in the correct order.

arrived having was a i they Just as showerJiist as / wasl1avil1q a sl1ower, tl1eyarrivec/.

1 my while washing The phone i ranghair was

2 friends i as My getting arrived wasdressed

3 when the They news home arrived heardthey

4 match We just as stadium arrived the thewas starting at

5 alarm cooking i While dinner the firewas rang

8 Put the time expressions in the correct order.

a this moming in b last month Dc in 1995 D d this time last week De six months ago D f yesterday D

9 Work in pairs. Ask and answer questionsabout the times in exercise 8.

A Wl1at were yoii dOil1qii'!1995.?

B / was /ivii'!qii'!Al1kara. / was at flrimary scl1001

Unit 16 Amazingstüries Bil

Reading1 Read Mel's diary and answer the questions.

1 Is Holly good at cooking?2 What did Jack do when he saw Tom on 1V?3 Why is Holly happy?

Saturday 17th

VocabularyExtreme adjectives

2 Read Mel' s diary again. Then match theadjectives with adjectives from the diary withasimilar, but stronger meaning.

hungry

1 tasty2 bad

3 surprising4 good

starvil11

~ Vnit 16 Amazing stories

3 Read Penny's e-mail and choose the bestaltematiyes.

HiJo1

Last weekend i went to a good/wonderfulpartv! i had a fantastic time! When i arrived,i was 2 hungry/starving, so Iate sixsandwiches and a pie. The sandwiches werequite 3 tasty/delicious, but the pie was4 horrible/bad! Then i met a boyand wetalked for the whole evening. It was really5surprising/amazing because I'm usuallyvery shy! Inever speak to boys! My friendsare happy, too, because he works at thecinema and he can get us free tickets!E-mail me soan.Bye!Penny

Pronundation

4 Sometimes we don't pronounce the letterh in a word. Listen and repeat the wordsin the box. Which four words have got asilent h? Q

Speaking

5 Work in pairs. Follow the instructions.Student A

You are Tom. Imagine you are going to phoneHolly and ask her out. Think about these things.

. where to go

. what to do

. when to meet

Student B

You are Holly. Imagine Tom is going to ask youout over the phone. What are you going to say?

6 Change roles and do the activity in exercise 5again.

WritingOrganizing information

7 Read the two diaries. Which diary is better?Why?

aJanuary 2005

25 Tuesda1j

T h.~eX ~ ')Ct2..b--t eXO-\)toJ9-\).~ we" -so-w 'ne

Lord.. oç -tl\e. K(~8$'ol\,1)VD, wk6--t ~

O,M~'i:L~') -9Lc"", - eXLci'l\.-'t')0 -to be:eXlAdLl ""'LeXl\.-~')kt

T ')ot lAp ~t eLE;h.-t o'c.l06kMeX T W~?

l~te -901" -sc.h.ool, bv..t -f:h~l\.-we: plp.-\)e:eX

-9ootb~ll L~ th.e 6--9tt2..cj\coo~~eXw~tc.h.eeX

th.e DVD L~ th.g E;.Je~L~')J ?o T h.~eX ~

~Lc.e eX~,:\,

T ""'L-s-se& brt2..o.-k-9~-st t,E;.c.~v..?e ')otlAp

l~tE;., -So :i:: w~? ,s,t9-cJi;.I'c') whe~ T ')otto -sc.hool.

b

$i><.

ta.ke ""''Ibrea.k.f'a..st wea.f\d wef\t

~oodb'le .We ha.d a.

""'orf\if\~,a. c.la.$$ picf\ic.the $c.hool.

i pla.'Ieda..f'ter

the evef\if\~. i

8 Put the events in the correct order.

Sunday 8th Junea Iate a pizza for Junch.b i did my geographyhomework

all moming.c In the evening I went to the

swimming pooi.d I got up Iate to day.e I met my friends at 3 o'clock

and we went shopping.f I watehed sport on 1v before

I went to bed.

D

D

DD

D

D

9 Imagine you are Tom or Holly. Write a diaryfor Saturday 17th.

. Read the Clifton Hill story again and useinformation from the story in your diary.

. Write about the events in the order theyhappened.

1 Complete the song with the phrases in thebox.

Whenthe world leaves you feeling blue,Youcan 1 , i willbe there foryou.When it seems all your 2

Are a million miles away, i will reassure you.We've got to all 3 ,Good friends there for each other.

Never forget thatI've got you and you've got me, so...Reach for the stars! Climb every mountain higherReach for the stars! Followyour heart' s desire.Reach for the stars!

And when that rainbow's shining over you,That's when your dreamswillall 4

Don't believe in all that you've been told.Thesky's the limit can5

he future holds.no voli can't be.

2 Listen and check your answers.S

3 Match the words with the definitions.

1 blue a make you feel better2 reassure li go after something3 ream c try to toueh something4 follow d sad or unhappy

4 What does the song mean? Choose thecorrect alternative.

a It's important to have good friends.b You ean do anytliing with your life.c Climbing motintains is good for you.

Vnit 16 Amazingstüries iiLi

T

i.

Revision (Units 15& 16)

GrammarFirst conclitional

1 Choose the correct alternatives.

If you lfollow/m ,followsqmesimplerules,you 2have/'1Ihavea longedife.

Stresscan darnageyourhealth. Ifyou leel stressed alotof the time,you 3have/'Uhavebad health when.you'reolder. Relax ..,it's easy,to do. (Ifyo.I.J4'11relaxlrelax more,you willbehappier. Andgo to bed earlY becaüse yourbody needs rest.You5'llbe/are init you don't rest.

Do sornesport.lf you6play/'lIplaysporteveryweek, youm be strongeraridfitter.

Dietis very important.Eat'Iot$of vegetables. Ifyou 7only eat!'1Ieal rneat,youwon'tgeta lotof importantminerals;

Finally,have furi! Ifyol.lspendrnore time Viiithfriends, you 8'11be/areahappierperson,andhappy people Uvelonger.

Zero conditional

2 Match the parts of the sentences.

lIfyou look through a telescope 000

lIfyou mix blue and yellow 000

3 If you want to be a good footballer 000

4 Youhave to work hard 000

S If you eat a lot of sweets o..

6 Jogging is a bad idea...

a if the weather's coldo

li if you want to be good at English.c you get green.d you get toothache.e the moon looks really big.f you have to practise a loto

IIEI RevisIon (UnIts 15&16)

Past modals

3 Complete the text. Use had to, didn't have to,could or couldn't.

Past continuous and past simple

4 Complete the text. Use the past continuousor the past simple.

VocabularyKeeping fit

1 Match the words with the statements.

Now closeyour eyesand relax.

doyoqa

1 My brother's got a black beIt in karate.

2 C (ome on! The water's really warm.

3 I/ve got a new pair of running shoes.

4 He'sgot a good bike, but he's not very fil.

5 i lifted sixty kilos yesterday, and i ran fortwenty minutes on the running maehine.

6 C One, two three, and jump!

7 i alwaystakemy dog with me to the park.

Illnesses

2 Write the illnesses.

1-0~ ",

~

1

~ 'h

3 4

1\

5 6

L@..:q9/J.:;:~,,~'

". . .,

7 8

Nouns and adjectives

3 Match the definitions with a noun oradjective from the box.

1 (adi) pretty, attractive2 (noun) when you do something well3 (adi) risky4 (noun) a choice5 (adi) relaxing6 (noun) when people try to win something7 (adi) not risky

Incredible events

4 Complete the sentences with the expressionsin the box. Use the past simple.

1 My friend Justin yesterday. iwas watching a news programme when i sawhim.

2 Gloria Fax after her first

album Believe in me. Millions of peoplebought her CD.

3 Ben in an athleticscompetition. He won a gold cup.

4 Jill and Stephanie when theystayed in their aunt's old house. They werevery seared.

5 The Walker family last year,and now they're rich! They bought fomhouses!

Extreme adjectives

5 Complete the dialogues. Use extreme adjectives.

1 A Do you wanttoli.ave lunch?B Yesip1e<\se.I'm lSA ShallWe go to arestamant?B No. Wb.ydon't you cook? You cook reaiiy

food.

2 I've got same

Revision(Units15&16) ug

Unit 1be

Positive

Grammar referenee

Unit 2have got

We use have got to talk about possessions.

PositiveI'm a student.She'sfifteen years old.

Negative

I've got apet.He's got a skateboar;d.

He isn't a pop star.Wearen't American.

Negative

She hasn't got a brother.We haven't got a computer.

Questions and shol:'t answers

Are you fr;om Manchester?Yes, i am.

Questions and short answers

Have you gol a Gameboy?Yes, rha.ve.Is she sixteen years old?

No, she isn't.

We use full forms (I am, Youare) in formalwriting.We use short forms (I'm, You're)in speakingand in informal writing.We always use full forms for affirmative shortanswers.

We usually use short forms for negative shortanswers.

Numbers

1 one2 two

3 th ree4 four5 five6 six

7 seven8 eight9 nine

10 ten

imi

11 eleven12 twelve

13 thirteen14 foudeen15 fifteen16 sixteen

17 seventeen

18 eighteen19 nineteen

20 twenty

Has he got two sisters?No, he hasn't.

We always use full forms for affirmative shortanswers.

We usually use short form s for negative shortanswers.

alan

21 twenty-one22 twenty-two30 thirty

40 forty50 fifty60 sixty70 seventy

80 eighty90 ninety

100 a hundred

We use alan with singular nouns.We use an with words that start with a, e, i, o,and often with u. We use a with words thatstart with all other letters.

. Anna's got a stereo in her bedraom.

. I've got an orange and a sandwich for mylunch.

Plural nouns

We use plural nouns to talk about more thanone thing.Some nouns have got irregular plurals.

Spelling rules

Singular Plural

Regular sistercarwatchbody

sisterscarswatc.hesbodies

Irregular childmanwoman

childrenmenwomen

Possessive 's

We use 'sto talk about relationships andpossessions.. Tom is Kate's father.. Sarah is David's neighbom.. This is Lisa's computer.

Possessive acljectives

Personal pronoul1s Pqssessiveadjectives

youhesheitwethey

myyourhisheritsourtheir

this, that, these and those

We use this (singular) and these (plmal) forthings near us.We use that (singular) and those (plmal) forthings in the distance.

. A What's this?B lt' s a pizza.

. A What's that?B lt's a computer.

. A What are these?B They're CDs.

. A What are those?B They're dogs.

-'

"

~

Adjectives

We use adjectives before a noun or after theverb be.

. l've got an expensive watch.

. It's new.

Unit 3there is/there are

We use thereis with singular countable nouns.We use therearewith plmal countable nouns.

Positive

There's a greatCOshop in mytown.There are a lot of cafesnear here.

Negative

Thel'eisl1't a sWimi11il1gpool at oor~chool.There arel1.'tal1ysupermarkets near our house.

Questionsand sl1Ol'tanswers

Is there a dhema nearhere?

Yes,thel'e ls.

Are there any theatres in your town?No,there aren't.

We always use full forms for affirmative shortanswers.We usually use short forms for negatiye shortanswers.

some and any

We use samein positive sentences.. Om town has got some reallygood shops.We use any in negatiye sentences.. There aren't any museums in our town.We use any in questions.. Are there any zoos here?We use a and an with singular nouns.. There's a zoo in our town.. There isn't an aquarium.We use sameand anywith plmal nouns. There are some cafesnear om schooL.. Are there any parks in yom town?

Grammarreference..

Telling the time

uarterpast

. A What's the time?B It's twenty-fiveto two.

. A What's the time?B It' s ten to twelve.

Wh- questions

. A What's your favourite film?B Lord of the Rings.

. A What time is the football match?B It's at twelve o'clock.

. A When's Kate's birthday?B It's in March.

. A Where's the library?B It's near the supermarket.

. A Who's your favourite actor?B Tom Cruise.

. A Whose pen it this?B It's Lisa's.

Unit 4Imperatives

We use imperatives to give instructions orwarnings.We use the infinitive for positive imperatives.. Stop at the red light!. Be quiet!

We use don't + infinitive for negatiyeimperatives.. Don't sit on my chair!. Don't be horrible!

IEII Grammar referenee

Ordinal numbers

1st first2nd second

3rd third4th fourthsth fifth6th sixth7th seventh8th eighthgth ninth10th tenth11th eleventh12th twelfth

1:3tO thirteenth-i4fh fourteenth1sthfifteenth16th sixteenth17ih seventeenth18th eighteenth19fh nineteenth20th twentieth

21st twenty-first22nd twenty-second3dfh thirtieth31St thirty-first

can

We use canlcan'tto talk about abilities.The form canlcan'tis the same for all persons.. i can ride a motorbike.

. David can't speak Italian.

. A Can they use the Internet?B Yes, they can.

i..

~

Unit 5Present simple (I/you/we/they)

We use the present simple to talk about habits,routines, likes and dislikes.

Positive il

i like AmericanmUsiç.We have breakfast at seven o'clock. r

Negative

You don.'t go to school by bus.They don'. getupeady at the weekend.

Questions and sb()" ans",el's

Do you like football?Yes, i do.

Dotheyeat in the sçhoolcanteel1?No, they dön'f.

.

.

Unit 6Present simple (he/she/it)

Positive

~ He plays chess and volleyball.it rains a lot in the winter.

. Negative

Hedoesn't go to schoolon Saturdays.Shedoesn't like swÜnrnirrgorsailing.

Questions and short answers

Does he live TnManchester?Yes,he does.

Does she !ike pop mLl..sic?No, she doesn't.

Spelling rules

Infinitive he/she/;t form

eatwant

eatswants

gowash

goeswashes

crystudy

criesstudies

Adverbs of frequency

We use adverbs of frequency to talk about howoften we do things.100% always

80%

sometImes

50%

30%

10%

never

We use adverbs of frequency before the mainverb, but after the verb be.

. We sometimes go to the park after schooL.

. My best friend is never Iate.

Expressions of frequency

We can alsa use expressions of frequency totalk about how often we do things.

oncetwicethreetimes

adaya week

a year

every

mominganemooneveningdaymonth

We use expressions of frequency at the end of aelause or sentence.

. My brother plays football once a week.

. We visit our cousins three times a year.

. Wllistens to the radio every moming, andshe watches TV every evening.

Unit 790in9 to

We can use goingto to talk about future plans.. I'm going to phone my friend tornanow.. Ben is going to do his homework this

evening.We can alsa use goingto to make predictionsabout the future.

. Look! It's going to rain!

. The bus isn't going to stop.

Positive

1'111going. to play football this aftemoon.We're goingto go shopping on Saturday.

Negative

Youarel1't goil1gto watch TVthis evening.i-ieiSI1'tgoil1gtophone her tomorrow.

Questions arrd short al1swers

Are yoii going to go sWirnming after school?Yes, i am.

Is she goil1lfto sel1dyou an email?Yes, she is.

Grammarreferenee..

would like to

We use would like to to talk about things wewant to do.

. I'd like to go to the cinema tonight.

. Neil wouldn't like to be a doctoro

. Would you like to watch TV?We can alsa use want in informal speech.. Wewant to go shopping tomorrow.

Asking for and giving permission

We use can and may to ask for permission todo things.

Asking permission

Can i use the computer?May i go out on Saturday night?

Giving permission

Yes,you can.Yes,of course.SUre.

No problem.

Refusing permission

No, you can't.

Sorry, no.

Unit 8have to

We use have to when something is necessary.We use don't have to when something isn'tnecessary.

Positive

i have to do the cooking.She has to do her homewotkthis evening.

Negative

Wedon't have to dean the floor.He doesn'thave to go to school on Saturday.

IIDI Grammar referenee

Questions and short answers

Do you have to do the ironing?Yes, i do.

Does she have to go shopping?No, she doesn't.

We can alsa use needn't to say that somethingisn't necessary.The form needn't is the same for all persons.

. You needn't dean the floor taday becauseit's Sunday.

. Mark needn't babysit tonight now, so we cango out.

Making suggestions

Makingsuggestion.s

How about going shopping?Let's play basketbali'Whydon't we watch a DVD?Shall we phone David?

Respondingto suggdtions

OK.

All right.Good idea!

Ican't.I'd rather watch TV.

must and can

We use must when something is necessary.We use mustn't and can't when something isforbidden.

We use can to give permission.

. You must do your homework.

. We mustn't forget to phone Tim.

. Sarah can't go out this evening.

. You can use the computer tomorrow.

The forms must, mustn't, can and can't are thesame for all persons.

~

mustn't and don't have to

We use mustn't to talk about rules.

We use don't have to when you can choose todo something.

. You mustn't talk in the library.

. We don't have to go to school on Saturdays.

lbe allowed to

-~

We can also use be allawed to to showpermission.

. Rob is allowed to go out everyevening.

. We're not allowed to wateh 1v in themoming.

'. Unit 9Present continuous

We use the present eontinuous for aetions thatare happening now.

;tPositive

I'mwearing a new -r-shi;rt.She's dancingfo IT\us.i.c.

-1

Negative

''A We aren't watchingfheparade.He isn't decorating the house.

A" Questions and short answers

'"'i

Are you eating chocol.i:\(es?Yes, i am.

Is she buying flowers?No, sheisn't.

-::,

-..

We always use full form s for affirmative shortanswers.We usually use short forms for negative shortanswers.

Spelling rules"

Infinitive -ing form

4.wearsing

wearingsinging

<!

getput

gettingputting

A.havewrite

havingwriting

liedie

Iyingdying

.-i

Adverbs

Adjeetives deseribe nouns.Adverbs deseribe verbs.

Spelling rules

Adjective Adverb

Regular quickpolitecareful

quicklypolitelycarefully

happypretty

happilyprettily

Irregular wellfasthard

goodfasthard

Unit 10Countable and uncountable nouns

Countable nouns are things we can count.They have singular and plural forms.Uneountable nouns are things we ean't count.Theyare always singular.

Countable nouns Uncountablenouns

Singular Plural

appleorangeonion

pizzasandwich

milkcheesebutter

sugarbeef

applesorangesonions

pizzassandwiches

alan, some and any

We use alan with singular eountable nouns.. Do you want a sandwich?. Joe eats an apple everyday.We use sameand anywith countable anduneountable nouns.

. Let'sbuy some potatoes.

. We haven't got any sugar.

Grammarreferenee..

How much? / How many?

We use howmanywith cauntable nouns.. How many CDs have you got?We use howmuchwith uncountable nouns.

. How much milk do you want in your caffee?

Present simple and present continuous

We use the present simple for routines andhabits.

. Usa gets up at seven o'clock every moming.

. i usually play football on Saturdays.

We use the present continuous for actions thatare happening now.. Nick is making sandwiches in the kitchen.. My sister is doing her homework.We don't usually use be, like and want in thepresent continuous.

. My sister is at school now. (NOT My sister.ts~ at schooL.)

. John likes chocalate ice-cream. (NOT Johnis Iileing chocalate ice-cream.)

. i want to watch TV. (NOT rm V,'8.RtiREtowatch TV.)

Unit II

be (past simple)

We use the past simple to talk about thingsthat happened in the past.

Positive

i was at school yesterday.Youwere at Lucy'shouse last night.

Negative

Hewas...'t at homelast Saturday.They we.ren't at thepartV.

Questionsand shortanswers

Were you at the cinema last night?Yes, i was.

Wasshe at schoollast week?No,she wasn't.

.. Grammar referenee

there was/there were

We use there was with singular cauntablenouns and uncountable nouns.We use there were with plural cauntable nouns.

"

Positive

There was a goodtheatre here when i was young.There werea lot of cafes near here.

Negative

There Wasn't an airportin our town in 1990.There weren't anypayphones.

Questions and shorta"swers

Wastherea hotelnear here?Yes, there Was..

Were there any mobile phones?No, there weren't.

Past simple (regular verlis)

Positive ~

i visited the famous palacelastyear.She arrivedatschoofat nine o'clock.We studied a lof beforeth.e exam.

Spelling rules

Infinitive past simple

askvisit

askedvisited

stopplan

stoppedplanned

lovearrive

lovedarrived

.'>

crystudy

criedstudied

Possessive pronouns

We use possessive pronouns to show whosomething belongs to.We use possessive adjectives with nouns.We use possessive pronouns without nouns. y

Possessive adJ~ctives pos$essivepronouns

1 l1's my hat.They're yourbooks.It'shis computer.They're her trousers.It's our dog.It's their car.

~

'.used to

l1's mine.

They're yours.It's his.

They're hers.It's ours.It's theirs.

We use used to to talk about things that weretrue in the past, but aren't true now.

. My cousins used to liye in Manchester, butnow they liye in London.

1

"1.

" Unit 12

Past simple (irregular verbs)

A lot of verbs are irregular in the past simple.There are no rules, so we have to leam theirregular form for each one.

~t

-:\Inlinitive Past simple

i

beginbreak

buycatchcomedriveeatfind

4

~ givegohaveleavemakemeetringrunsayseesleepspeakswimtelithinkunderstand

-l,

-i

~

wearwrite

beganbrokeboughtcaughtcamedroveatefoundgayewenthadleftmademetrangransaidsawsleptspokeswamtoldthoughtunderstoodworewrote

The past simple positive form is the same forall persons.

. The police found the knife behind a tree.

. The bmglar left fingerprints on the safe.

. i spoke to the detective about the erime.

Past simple (negative and questions)

Negative

You didn't phone the police.He didn't steal the painting.

Questions and. $hort answers

Didyou senefheran email?Yes,i did.

Did they escapein acar?No, they didh't.

Unit 13Comparatives

We use comparative adjectives to compare twopeople or things.

Spelling rules

Grammarreferenee..

AdJectives Comparatives

Regula.. long longeradjectives rich richer

(1 syllab'e)big biggerslim slimmer

nice nicerIate later

Regular la:zy lazier

adjectives happy happier(2 orl110re

interestingsyUables) more

interestingcareful more

careful

Irregular good better

adjectives bad worsefar farther

as ... as

We can alsa use as + adjective + as to comparetwo people or things.

+ Katie is as fdendly as her sister.+ Mark isn't as attractive as Richard.

+ Tennis isn't as exciting as football.

Superlatives

We use superlative adjectivesto compare threeor more people or things.

Unit 14

will (predictions)

We use will to make predictions about thefuture.

+ i think you'll get married and have lots ofchildren!

+ Turkey will win the next World Cup.

We can alsa use will to make promises.

+ 1'11help you with your homework.+ We won't forget to phone you.

Positive

1'11win theprize.

She'll be veryhappv.

ILESI Grammar reference

---

Negative

He won't live in a different country.They won't get married.

.

Questions and short answers

Wiiishe become a journalist?Yes,she will.

Wiii they be rich and tamous?No, they won't. ~

We always use full forms for affirmative shortanswers.

We usually use short forms for negative shortanswers.

too and enou9h

We use too and enough when we aren't happywith a situation.

We usually use toowith positive verbs.We use too before the adjective.

+ I'm too short to play basketbali.+ My brother is too shy to talk to Anna.

We usually use enough with negatiye verbs.We use enough after the adjective.

+ lt isn't warm enough to go swimming.+ Your marks aren't high enough to pass the

exam.

'"

Adverbs of probability

We use definitelyto talk about something thatis certain.

-1

+ I'll definitely go to America this year.

We use probablyto talk about something that isvery likely.

+ Tom will probably learn to drive when he'sIS.

We use maybe and perhaps to talk aboutsomething that is possible.

+ Maybe I'll study geography at university.+ Perhaps I'll have children when I'm older.

We use maybe and perhaps before will.We use definitely and probablyafter will.

.'

~

1'-

y

Adjectives Superlatives

Regular long the longestadjectives rich the richest

(1 syllable)the biggestbig

slim the slimmest

nice the nicestIate the latest

Regular lazy the laziest

adjectives happy the happiest(z or more

interestingsyllables) the most

interestingcaretul the most

caretul

Irregular good the best

adjectives bad the worsttar the tarthest

Unit 1S-\ First conditional

-i..

We use the first conditional to talk aboutthings that are possible in the future.We use the present simple in the if elause, andwill + infinitive in the main elause.

[if elause] [main elause]. If IilI practises every day, she'll get into the

team.~1

~~

The if elause can come at the beginning or theend of a sentence. When it comes at thebeginning, we use a comma.

. If I'm tired tonight, I'll go to bed early.When it comes at the end, we don't use acomma.

. I'll go to bed early ifI'm tired tonight.

't

'1 Zero conclItional

~.~

We use the zero conditional to talk about factsand things that are always true.We use the present simple in the main elauseand in the if elause.

[if elause] [main elause]. If people eat a lot of sugar, they get

toothache.

'"1

-i Past modals

Present moda Is Past modals

i- cancan'thave todon't have to

couldcouldn'thad todidn't have to~i

'<

-t

. Sam couldn't carry the bag because it wastoo heavy.

. They could swim when they were four yearsold.

. We had to arriye at the sports centre beforeeight o' elock.

. My dad gaye me his old football boots, so ididn't have to buy any new ones.

The forms could, couldn't, had to, and didn't haveto are the same for all persons.

~

1

'i.

i

i

Unit 16Past continuous

Positive

i was listening to music.We were waiting for a friend.

Negatiye

He wasn't reading a book.They weren't listening to me.

Questions aiidstio..t answers

Were you doingyourhomework?Yes, J ~as.

Was she wearing a red jacket?

No, she wasn't.

Spelling rules

Look at page 155.

Past continuous and past simple

We use the past simple for a completed actionin the past.

. We saw a famous pop star yesterday.

. My sister won a competition last week.

We use the past continuous for a longer actionin progress at a time in the past.

. i saw something strange while i was walkingto schooL.

. it was raining when she came out of thehouse.

We don't usually use be, love, like, believe,understand, want, know and think in continuoustenses.

Time expressions

We usually use as,just as and whilewith thepast continuous.. As they were walking to schooL,they saw

Sam and PauL.

. Just as i was going to bed, my friend phoned.

. While we were having dinner, we talkedabout the holidays.

We usually use when with the past simple.

. When i got home, everybody was asleep.

Grammarreferenee ~

OXFORDUNIVERSITY PRESS

Great Clarendon Street, Oxford OX26DP

Oxford University Press is a department of the University of Oxford.lt furthers the University's objective of excellence in research, scholarship,and educatian by publishing worldwide inOxford NewYork

Auckland Cape Town Dar es Salaam Hong Kong KarachiKuala Lumpur Madrid Melbourne Mexico City NairobiNew Delhi Shanghai Taipei TorontoWith offices in

Argentina Austria Brazil Chile Czech Republic France GreeceGuatemala Hungary Italy Japan Poland Portugal SingapareSouth Korea Switzerland Thailand Turkey Ukraine Vietnam

OXFORDand OXFORDENGLISHare registered trade marks ofOxford University Press in the UK and in certain other countries

@Oxford University Press 2006

The moral rights of the author have been asserted

Database right Oxford University Press (maker)

First published 20062010 2009 2008 2007 2006

10 9 8 7 6 5 4 3 2 1

No unauthorized photocopying

All rights reserved. No part of this publication may be reproduced,stored in a retrieval system, or transmitted, in any form or by any means,without the prior permission in writing of Oxford University Press,or as expressly permitted by law, or under terms agreed with the appropriatereprographics rights organization. Enquiries concerning reproductionoutside the scope of the above should be sent to the ELTRights Department,Oxford University Press, at the address above

You must not circulate this book in any other binding or coverand you must impose this same condition on any acquirer

Any websites referred to in this publication are in the public domain andtheir addresses are provided by Oxford University Press for information only.Oxford University Press disclaims any responsibility for the content

ISBN-13: 978 0194300810ISBN-io: 0194300811

Printed and bound in Spain by Graficas Estella, SA

ACKNOWLEDGEMENTS

The authors and publisher aregrateftil to those who havegiven permission to reproducethefollowing extracts and adaptations of copyright material: P49 'Alright' Words andMusicby Daniel Goffey,Gareth Coombesand Michael Quinn @ EMIMusicPublishing Limited, London WC2H OQY.Reproduced by permission ofInternational Music Publications Limited. All Rights Reserved.P85 'Celebration' Words and Music by Ronald Bell, James Taylor, Robert Bell,George Brown, Robert Mickens, Earl Toon, Claydes Smith, Dennis Thomasand Eumir Deadata @Copyright 1980 Longitude Music Company, USA. EMIMusic Publishing (WP) Limited. All Rights Reserved. International CopyrightSecured.

P121 'The Best' Composed by Mike Chapman and Holly Knight. Published byMike Chapman Publishing EnterprisesjZomba Music Publishers LimitedjiQMusic Limited. Reproduced by permission of BMG Music Publishing Limitedand iQMusic Limited. All Rights Reserved.P147 'Reach' Words and Music by Cathy Dennis and AndrewTodd @1999 EMIMusic Publishing Limited (50%)and BMG Music Publishing Limited (50%)EMIMusic Publishing Limited, London WC2H OQY.Reproduced by permission ofInternational Music Publications Limited and BMG Music Publishing Limited.All Rights Reserved.

We would !ike to thank the followingfor their kind permission to reproduce photographs:

Action Plus, pp 52 (Tim Duncan), 53 (female tennis player), (footballers), 54(child on climbing wall), 124 (spanish fans), 138 (mountain biking), 139(teenage footballer); Alamy Images, pp 36 (rickshaw), 45 (Japanese schoolchildren), 56 (teenage giri), 81 (Hospital ward); The Anthony Blake PhotoLibrary Ltd, p 93 (cafe exterior); Gareth Boden, p 95 (food); Steve Betts, p 100(modern woman &victorian woman); Bubbles Photolibrary, p 72 (teenagerssinging); Burns GraphicsjMr John Plowright, Repton SchooL. pp 11 (studentson grass), 44 (schoollibrary); Camera Press Ltd, p 17 (Catherine ZetaJones &Michael Douglas); 71 (Science museum); Capital Pictures, pp 18 (David &Victoria Beckham), 116 (Ben Ameck & Matt Daman), 120 (Madonna); Corbis,pp 10 (teenage girl & keyboard), 12 (teacher in classroom), 13 (teenage boystudying), 21 (teenage girl & computer), 30 (teenage giri), 36 (elephant &tourists), 75 (teenager & glasses), 81 (NewYear, USA), 127 (catwalk model),129 (teenage girl & present), 143 (street artist); Educatian Photos, pp 6 (schoolexterior), 44 (school exterior), 71 (female teacher), 74 (coach & student), 137(boy &basketball); Getty Images, pp 62 (tv interview), 84 (Rio Carnival), 85(Rio daneer), 101 (Istanbul), 102 (NewYork - histarical & modern); Ideas inBluejGido Braase, p 57 (Yasemin Dalkilic - diver); Ilhan Aksit Archives, p 103

(Ataturk); Kobal Collection Ltd, pp 108 (catch me if you can film poster), 118(Jackie Chang, Stuntman), 119 (Richard Kiel); Moviestore Collection Ltd, p 8(Fred Flinstone); Popperfoto, pp 18 (David & Brooklyn Beckham), 98 (World

Cup 2002); PowerStockjSuperstock Ltd, pp 14 (middle-aged couple), 20 (oldcar, mobile phone, bicycle seats), 28 (London Eye), 49 (teenage students), 70(teenage girls talking), 92 (restaurant interior), 102 (Barcelona), 103(Disneyland), 138 (mountain climbing), 144 (teenage girl with frizzy hair,currency); Reuters, p 119 (Hakan Sukur); Rex Features Ltd, pp 28 (Rainforestcafe, Jo Lo), 31 (Ricky Martin), 36 (gondolas), 54 (swimming pool), 56 (SebClover), 91 (football stadium), 108 (Leonarda di Caprio &Tom Hanks), 124(tarot card reader), 136 (ice bathing); Science Photo Library Ltd, pp 20 (mobilephone), 136 (wornan having mud pack); Space Camp Turkey, p 46 (exterior &interior of Space Camp Turkey);

All otherphotographs from the OUProyalty free database

TIlustrationsby: MikeAdams, p 29 (ex 2); Gary AndrewsjAlliedArtists, pp 15 (ex7),123 (ex 8); Kathy Baxendale, pp 28 (ex 4),33 (ex 8), 35 (ex 1), 71 (ex 5), 99(ex 3), Steve BeaumontjApple Ageney, p 17 (ex 1); Steve Betts, p 29 (ex 1);France ChauletjPrivate View, p 109 (ex 8); David Eaton, p 51 (ex 8); MartinaFarrow, pp 16 (ex 2), 22 (ex 3),45 (ex 1), 59 (ex 4),77 (ex 4),87 (ex 7), 88 (ex 4),95 (ex 1),109 (ex 3),113 (ex 1),136 (ex 4); Roger Fereday, p 66 (ex 2); AndyFaley, pp 69 (ex 7), 94 (ex 1),135 (ex 4); Gordon Hendry, p 19 (ex 7); AndreLabrie, pp 27 (ex 2), 41 (ex 1), 48 (ex 1); NedJolliffe, p 127 (ex 4); Andy Parker,pp 110 (ex 4),145 (ex 3),148 (ex 4); Chris Pavely, pp 8 (ex 3),112 (ex 4),131 (ex1); Andy Peters, pp 7 (ex 9),16 (ex 4),25 (ex 7),35 (ex 3), 43 (ex 9),63 (ex 6), 79(ex 8) 80 (ex 2),83 (ex 1), 97 (ex 7),107 (ex 1),115 (ex 8),134 (ex 3 & ex 4);David Roach, p 121 (ex 8); Martin Shovel. pp 23 (ex 6), 27 (ex 1),34 (ex 2), 77(ex 2),131 (ex 2),149 (ex 2); HarryVenning, pp 12 (ex 1),30 (ex 7),37 (ex 8), 61(ex 7), 65 (ex 2),89 (ex 1),105 (ex 7),106 (ex 5),111 (ex 6),133 (ex 7),141 (ex8); AnthonyWilliams, pp 56 (ex 2),98 (ex 8),101 (ex 5),107 (ex 6),143 (ex 1),

i

"\

s leiifsBôôlc

...

to vocabulary development

practice of functional English

syllabus that developsin listening, speaking, reading and writing, with

speaking

t a motiyating Extratime section in every unit with songs,questionnaires, games, puzzles and quizzes

t a Revisionsection after every two units

Each revel of Ileach consists of:

t Student's Book

t Workbook. Teacher's Book

t Classcassettes

[!JD OXFORD ENGLISHISBN 0-19-430081-1

, "III IILi .

9 "7BO 1 94 3.,?OB1U