Upload
kamala
View
41
Download
3
Embed Size (px)
DESCRIPTION
Module 1 Introduction to Bioinformatics. What is Life made of?. Life begins with Cell. A cell is a smallest structural unit of an organism that is capable of independent functioning All cells have some common features. All Life depends on 3 critical molecules. DNAs RNAs Proteins. - PowerPoint PPT Presentation
Citation preview
Sevas Educational SocietyAll Rights Reserved, 2008
Module 1
Introduction to Bioinformatics
Sevas Educational SocietyAll Rights Reserved, 2008
What is Life made of?
Sevas Educational SocietyAll Rights Reserved, 2008
Life begins with Cell
• A cell is a smallest structural unit of an organism that is capable of independent functioning
• All cells have some common features
Sevas Educational SocietyAll Rights Reserved, 2008
All Life depends on 3 critical molecules
• DNAs• RNAs• Proteins
Sevas Educational SocietyAll Rights Reserved, 2008
DNA: The Code of Life
• Adenine (A), Guanine (G), Thymine (T), and Cytosine (C) which pair A-T and C-G to form DNA and these molecules are called as nucleic acids.
See Next Slide for More about DNA….
Sevas Educational SocietyAll Rights Reserved, 2008
DNA: The Basis of Life
• Deoxyribonucleic Acid (DNA)– Double stranded with two strands A-T, C-G
• DNA is a polymer– Sugar-Phosphate-Base– Bases held together by Hydrogen bonding to the
opposite strand
Sevas Educational SocietyAll Rights Reserved, 2008
DNA, continued• DNA has a double
helix structure which composed of – sugar molecule– phosphate group– and a base (A,C,G,T)
A - Adenine
C - Cytosine
G - Guanine
T - Thymine
Sevas Educational SocietyAll Rights Reserved, 2008
DNA: The basis of Life
DNA is Present in Chromosome
The figure shows how DNA is packed in chromosome….
Sevas Educational SocietyAll Rights Reserved, 2008
Central Dogma of BiologyThe information for making proteins is stored in DNA. There is a process (transcription and translation) by which DNA is converted to protein.
DNA
RNA
Protein
Transcription (the process of formation of RNA from DNA)
Translation (the process of formation of protein from RNA)
Sevas Educational SocietyAll Rights Reserved, 2008
RNA• RNA is similar to DNA chemically. It is usually only a
single strand. DNA and RNA are similar in structure with one difference. DNA consists of Adenine (A), Guanine (G), Thymine (T), and Cytosine (C) and RNA consists of Uracil (U), adenine (A), Guanine (G) & Cytosine (C).
Only difference is T(hyamine) is replaced by U(racil) and it is single strand & DNA is double strand.
Sevas Educational SocietyAll Rights Reserved, 2008
Several types of RNA exists as mRNA, tRNA & rRNA and each has its own significance.
Definition of a GeneThe important part of DNA, which is responsible for “RNA and protein” formation is called “Gene” and Gene consists of two parts
1. Exons:
2. Introns:
Sevas Educational SocietyAll Rights Reserved, 2008
Formation of RNA from a gene (gene is always present in DNA)
The process of breaking all introns to form mRNA is called “splicing” & the most important region in mRNA which is reponsible for protein formation is called “Open Reading Frame”.
Sevas Educational SocietyAll Rights Reserved, 2008
Protein:
Complex organic molecules made up of amino acid subunits.
Protein is formed from 20 different kinds of amino acids. Each has a 1 and 3 letter abbreviation.
Protein is also called as “polypeptide”
Sevas Educational SocietyAll Rights Reserved, 2008
Combination of two or more amino acids can be called as proteins or poly peptides.
Sevas Educational SocietyAll Rights Reserved, 2008
RNA Protein: TranslationmRNA (messenger RNA) passes through ribosome (A small organ in a cell) and three nucleic acids present in mRNA will produce one amino acid and those three nucleic acids are called codons. In the figure you can see UUC, GGA etc…. are coding for group of amino acids.
Codon table is provided in the next slide which tells which codon codes for which proteins.
Sevas Educational SocietyAll Rights Reserved, 2008
RNA Protein: TranslationProtein is formed from RNA and three molecules in RNA, called as codons, are responsible for producing one amino acid present in a protein. As the codon number increases the formation of bigger proteins takes place.
UUA ----- Leucine
CGA ---- Arginine
UAG --- Stop Codon or
no amino acid
UGG -- Tryptophan.
RNA codon ----- Amino Acid
Sevas Educational SocietyAll Rights Reserved, 2008
For more explanation (How protein is formed from mRNA)
mRNA
tRNA enters into ribosome by carriing one amino acid (in this case it is carrying valine)
As the amino acids number increases the formation of protein takes place.
(In the figure you can observe a protein consisting eight amino acids)
Sevas Educational SocietyAll Rights Reserved, 2008
Proteins are represented by single letter alphabets... (by using the table present in 14th slide)
Write down the name of corresponding amino acids
AGASPFMKLKKAGAKAHLKMSHFWYVHSIL
Example: A – alanine
G - Glycine
Sevas Educational SocietyAll Rights Reserved, 2008
DNA consists of four nucleotides Adenine, guanine, cytosine and thymine (and they are represented by single letter alphabets.
Adenine ------- AGuanine ------- GCytosine ------- CThymine ------- T
Write down the names of nucleotides present in DNA
“AAAGAGACGTACGACGAGCGC”
Like: Adenine-Adenine-Adenine-Guanine-………..
Sevas Educational SocietyAll Rights Reserved, 2008
We all know that three Nucleotides codes for single amino acid then for example like "UUU" codon produces "Phenylalanine Amino Acid“.
By using the above table find the protein sequence of the following RNA starting from first "A" only.
AAGAGARGACGUGCGACGACGUCGAGUCAAAAACGUCGA
Clue: AAG ---- See the corresponding amino acid in the above table
it is “Lys” or “K”…. Like wise select three codons and
get amino acids
Sevas Educational SocietyAll Rights Reserved, 2008
Bioinformatics is generally defined as the analysis, prediction, and modeling of biological data with the help of computers
Bioinformatics:
What is biological data and how to put protein into computer?
Biological data is nothing but protein and nucleic acid sequences represented by alphabets.
Example: Protein Sequence
(consists twenty amino acids)
AAGHWTILKWGRSH
DNA sequence (Consists four nuclic acids)
AAGAGTCGCGAGAGGACG
Sevas Educational SocietyAll Rights Reserved, 2008
What is Computational Biology?
This branch of biology involves the use of techniques including applied mathematics, informatics, statistics, computer science, artificial intelligence, chemistry, and biochemistry to solve biological problems usually at the molecular level.
Sevas Educational SocietyAll Rights Reserved, 2008
Bioinformatics is multidisciplinary
Genomics
Molecular evolution
BiophysicsMolecular
biology
Biomedicine
Ethical, legal, and social
implications
Bioinformatics
Mathematics/computer science
Sevas Educational SocietyAll Rights Reserved, 2008
CGCCAGCTGGACGGGCACACCATGAGGCTGCTGACCCTCCTGGGCCTTCTGTGTGGCTCGGTGGCCACCCCCTTAGGCCCGAAGTGGCCTGAACCTGTGTTCGGGCGCCTGGCATCCCCCGGCTTTCCAGGGGAGTATGCCAATGACCAGGAGCGGCGCTGGACCCTGACTGCACCCCCCGGCTACCGCCTGCGCCTCTACTTCACCCACTTCGACCTGGAGCTCTCCCACCTCTGCGAGTACGACTTCGTCAAG
From chromosomes to sequence data
Large scale DNA sequencing
Sevas Educational SocietyAll Rights Reserved, 2008
Genome: In biology the genome of an organism is its whole hereditary information and is encoded in the DNA (or, for some viruses, RNA). Genomes can be represented as base pairs (AT or CG) of nucleic acids.
Human Genome consists of 3 Billion Base Pairs.
etc…….
Genomics is the study of an organism's entire genome. The field includes intensive efforts to determine the entire DNA sequence of organisms.
Some Terminology……..
Sevas Educational SocietyAll Rights Reserved, 2008
Genomics generates a vast amount of DNA sequence data. Sophisticated algorithms are used to predict gene regions. Only ~3% of the vertebrate genome codes for proteins.
Genome sequencing and analysis (genomics)
Genbank hold sequences from over 800 organisms. There are currently 113 complete genomes.
The completion of a "working draft" of the human genome was announced in June 2001.
•Estimates of 38 - 120,000 genes (40, 000)
Sevas Educational SocietyAll Rights Reserved, 2008
ORGANISM CHROMOSOMES GENOME SIZE GENES
Homo sapiens (Humans)
23 3,200,000,000 ~ 30,000
Mus musculus(Mouse)
20 2,600,000,000 ~30,000
Drosophila melanogaster
(Fruit Fly)
4 180,000,000 ~18,000
Saccharomyces cerevisiae (Yeast)
16 14,000,000 ~6,000
Zea mays (Corn) 10 2,400,000,000 ???
Genome Size as in base pairs….
Sevas Educational SocietyAll Rights Reserved, 2008
1. Draw the figure present in sixth slide?
2. Draw the table giving proteins (14th slide)
3. Search what is tRNA in google.com
4. Literature Collection: Type www.google.com in the web site. Type NCBI home page in the google Go to home page of NCBI Click on pubmed in the search space and type any key word you are
interested in to look for, for eg., lung cancer, human genome project, polymerase, immunoglobins etc.
Window will display your result Click on each of the result to read abstract or full text of your interest.
5. Go to www.answers.com and type transcription and see the explanation.
6. Go to google.com and type “ppt introduction to bioinformatics” and collect more than five powerpoint presentation.
(if you add ppt to any keywork you will get PowerPoint presentations)
Sevas Educational SocietyAll Rights Reserved, 2008
Reference:
1. http://en.wikipedia.org/wiki/Bioinformatics
2. PowerPoint Slides from internet
http://www.bioalgorithms.info/presentations.old/Ch03_Molecular_Biology_Primer.ppt