Upload
others
View
1
Download
0
Embed Size (px)
Citation preview
Mapping the Interactome of Saccharomyces cerevisiae ABC
Transporters Pdr12p and Ste6p
by
Dunja Damjanovic
A thesis submitted in conformity with the requirements
for the degree of Master of Science
Graduate Department of Molecular Genetics
University of Toronto
copy Copyright by Dunja Damjanovic 2010
ii
Mapping the Interactome of Saccharomyces cerevisiae ABC Transporters Pdr12p
and Ste6p
Dunja Damjanovic
Master of Science
Department of Molecular Genetics
University of Toronto
2010
ABSTRACT
The ATP binding cassette (ABC) transporters represent the largest family of
transmembrane proteins and play important roles in human inherited disease such as the
multi-organ disease cystic fibrosis and cholesterol transport disorder Tangierrsquos disease
These proteins are also implicated in conferring multidrug resistance rendering many
cancer therapies ineffective as well as contributing to the pathogenicity of some
organisms The yeast ABC proteins Pdr12p a weak acid efflux pump and Ste6p the a-
factor exporter were screened for interacting partners using the integrated membrane
yeast two-hybrid (iMYTH) system to gain further insight into their biological function
Two interactors were identified for Ste6p however the Pdr12p screen identified 13 novel
interactions most notable of which are three other ABC transporters Pdr5p Pdr10p and
Pdr11p Subsequent functional analysis of double deletion mutants supports a genetic
interaction between Pdr12p and Pdr10p as the pdr12Δ pdr10Δ strain showed resistance to
increasing concentrations of weak organic acids
iii
ACKNOWLEDGMENTS
I wish to express my appreciation and gratitude to my supervisor Dr Igor Stagljar
for giving me the opportunity to work for him and learn from him I will always be
grateful for his advice which he gave freely for always listening to my concerns of
which there were many and most of all for pushing me beyond my limits and teaching
me never to give up
I would like to give my sincerest thanks to my committee members Drs Brenda
Andrews and Leah Cowen for their guidance throughout the years Their suggestions
and criticisms pushed me to continuously strive to improve and made me challenge
myself I am a wiser person for it
During my time here I have had the pleasure of meeting many great people and
have been fortunate enough to work alongside most of them on a daily basis A big thank
you goes out to all my lab mates both past and present for making our lab a fun and
interesting environment to work in For giving me guidance with new experiments
always listening and providing insights on overcoming a roadblock Dr Jamie Snider
has been a great teacher support and a person I relied heavily on for a second opinion
His willingness to answer my many questions provide me with great feedback and help
me out when I was unsure of how to proceed is much appreciated Though he challenged
every one of my results it was always with good intentions and has made my science
just that much better Dr Saranya Kittanakom whose smiling face always welcomed my
woes has been an invaluable help during my co-IP experiments Her knowledge and
advice gave me hope that one day it would all work Dawn Edmonds has been a fountain
of information over the years Her patience in teaching me to dissect tetrads and ordering
things for me on short notice is greatly appreciated I would also like to thank Dr Susan
Michaelis for her quick e-mail responses and advice on Ste6p
I would not be where I am today without the support both financial and
emotional of my parents and brother Mom and Dad thank you for always believing in
me for showing me that hard work pays off and for handling my being away from home
so well though I think Srdjan took it a little too well Your guidance throughout my life
has made me the person I am today and I will always appreciate that you always stood
behind everything I did and still wish to do
To my two best friends Dijana and Vanja I know that you often didnrsquot
understand what I did but I thank you for willing to try Most importantly I appreciate
you both listening to the ups and downs I encountered daily and for taking my mind off
such things and making me laugh whenever we were together or on the phone
Finally I want to give a big thanks to Tanja Durbic and Dr Katarina Vukojevic
for making my last few months fun and amusing for the random medical advice and the
many entertaining outings
Dunja Damjanovic
iv
Family that dear octopus from whose tentacles we
never quite escape nor in our inmost hearts ever quite wish to
ndash Dodie Smith
To my wonderful parents Miladin and
Gordana Damjanovic and my
brother Srdjan
v
TABLE OF CONTENTS
ABSTRACT ii
ACKNOWLEDGMENTS iii
LIST OF TABLES viii
LIST OF FIGURES ix
APPENDICES x
ABBREVIATIONS xi
INTRODUCTION 1
11 ABC Transporter Proteins 2
12 Yeast as a Model Organism 3
13 ABC Transporter Proteins in Saccharomyces cerevisiae 4
14 ABCG (PDR5) Subfamily 6
15 ABCB (MDR) Subfamily 8
16 The Other Yeast Subfamilies 9
17 Yeast Pdr12p 10
171 Protein and Function 10
172 Role in Food Spoilage 10
173 Known Interactions 12
18 Yeast Ste6p 13
181 Protein and Function 13
182 Mating MAPK Pathway 13
183 Known Interactions 15
19 Studying Protein-Protein Interactions (PPIs) 16
191 The Importance of PPIs 16
192 Yeast two-hybrid Technologies and their Limitations 16
193 Analysis of Membrane Protein Interactions 18
110 Ubiquitin and the MYTH Technology 19
1101 Ubiquitin and its Role in Protein Degradation 19
1102 Reconstitution of Split Ubiquitin 20
1103 The MYTH Technology 21
111 Thesis Rationale 24
MATERIALS AND METHODS 25
21 Yeast Strains Media and Growth Conditions 26
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins 26
vi
23 Construction of the Prey Random Genomic DNA and cDNA Libraries 26
24 Verifying Proper Localization of CYT-tagged Bait Proteins 26
25 NubGNubI Test 27
26 Verification of C(Y)T-tagged Bait Functionality 28
261 Generation of Deletion Mutants 28
262 Verifying Deletion Mutants 28
263 Verifying Pdr12-C(Y)T Function 29
264 Verifying Ste6-C(Y)T Function 29
27 The iMYTH Assay 30
271 Large Scale Transformation 30
272 Patching and Recovering Putative Interactors 31
273 Amplification and Recovery of Prey Plasmid DNA 31
274 Prey Identification 32
275 Bait Dependency Test 32
28 Generation of Double Deletion Mutants 33
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p 34
291 Gap Repair Method 34
292 Gateway Cloning 35
210 Functional Assays for Pdr12p 36
2101 Spot Assays 36
2102 Liquid Panelling Assay 37
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p 37
2104 Western Blot Analysis 38
211 Extending Ste6p Duration at the Plasma Membrane 39
RESULTS 40
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated 41
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly 41
33 Tagged Bait Strains Pass NubGNubI Test 42
34 Functional Analysis of Bait Proteins 43
341 Pdr12-CT Grows in the Presence of Sorbic Acid 43
342 Ste6-CT is Able to Mate 44
35 iMYTH Screening Results 45
351 Large Scale Library Transformation 45
352 Bait Dependency Test 46
vii
353 Pdr12p Interactome 47
354 Ste6p Interactome 50
36 Generation of Double Deletion mutants with pdr12Δnat 50
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids 53
371 Spot Assays 53
372 TECAN Liquid Growth Assay 54
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants 58
381 Spot Assays 58
382 TECAN Liquid Growth Assay 60
39 Increasing Ste6p Duration at the Plasma Membrane 61
391 Treatment with α-factor 61
3102 Deletion of SAC6 63
DISCUSSION 65
41 GO Analysis 66
42 Protein Interactions of Interest 66
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p 66
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p 68
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p 69
424 Vps9p is a Novel Interactor of Ste6p 70
43 Poor Detection of Ste6p Interactions 71
44 Putative Role for Pdr10p in the Weak Acid Response 72
45 Lack of Expression of Prey Proteins 74
46 iMYTH as a System for the Detection of PPIs 75
FUTURE DIRECTIONS AND CONCLUSIONS 77
51 Concluding Remarks and Future Directions 78
REFERENCES 84
APPENDIX 91
viii
LIST OF TABLES
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
Table 2 Summary of Double Deletion Strains
Table 3 Yeast strains used in this study
Table 4 Plasmids used in this study
Table 5 Primers used in this study
Table 6 PCR Reactions
Table 7 PCR Programs
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Table 10 Description of Pdr12p Interactors
Table 11 Description of Ste6p Interactors
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
ii
Mapping the Interactome of Saccharomyces cerevisiae ABC Transporters Pdr12p
and Ste6p
Dunja Damjanovic
Master of Science
Department of Molecular Genetics
University of Toronto
2010
ABSTRACT
The ATP binding cassette (ABC) transporters represent the largest family of
transmembrane proteins and play important roles in human inherited disease such as the
multi-organ disease cystic fibrosis and cholesterol transport disorder Tangierrsquos disease
These proteins are also implicated in conferring multidrug resistance rendering many
cancer therapies ineffective as well as contributing to the pathogenicity of some
organisms The yeast ABC proteins Pdr12p a weak acid efflux pump and Ste6p the a-
factor exporter were screened for interacting partners using the integrated membrane
yeast two-hybrid (iMYTH) system to gain further insight into their biological function
Two interactors were identified for Ste6p however the Pdr12p screen identified 13 novel
interactions most notable of which are three other ABC transporters Pdr5p Pdr10p and
Pdr11p Subsequent functional analysis of double deletion mutants supports a genetic
interaction between Pdr12p and Pdr10p as the pdr12Δ pdr10Δ strain showed resistance to
increasing concentrations of weak organic acids
iii
ACKNOWLEDGMENTS
I wish to express my appreciation and gratitude to my supervisor Dr Igor Stagljar
for giving me the opportunity to work for him and learn from him I will always be
grateful for his advice which he gave freely for always listening to my concerns of
which there were many and most of all for pushing me beyond my limits and teaching
me never to give up
I would like to give my sincerest thanks to my committee members Drs Brenda
Andrews and Leah Cowen for their guidance throughout the years Their suggestions
and criticisms pushed me to continuously strive to improve and made me challenge
myself I am a wiser person for it
During my time here I have had the pleasure of meeting many great people and
have been fortunate enough to work alongside most of them on a daily basis A big thank
you goes out to all my lab mates both past and present for making our lab a fun and
interesting environment to work in For giving me guidance with new experiments
always listening and providing insights on overcoming a roadblock Dr Jamie Snider
has been a great teacher support and a person I relied heavily on for a second opinion
His willingness to answer my many questions provide me with great feedback and help
me out when I was unsure of how to proceed is much appreciated Though he challenged
every one of my results it was always with good intentions and has made my science
just that much better Dr Saranya Kittanakom whose smiling face always welcomed my
woes has been an invaluable help during my co-IP experiments Her knowledge and
advice gave me hope that one day it would all work Dawn Edmonds has been a fountain
of information over the years Her patience in teaching me to dissect tetrads and ordering
things for me on short notice is greatly appreciated I would also like to thank Dr Susan
Michaelis for her quick e-mail responses and advice on Ste6p
I would not be where I am today without the support both financial and
emotional of my parents and brother Mom and Dad thank you for always believing in
me for showing me that hard work pays off and for handling my being away from home
so well though I think Srdjan took it a little too well Your guidance throughout my life
has made me the person I am today and I will always appreciate that you always stood
behind everything I did and still wish to do
To my two best friends Dijana and Vanja I know that you often didnrsquot
understand what I did but I thank you for willing to try Most importantly I appreciate
you both listening to the ups and downs I encountered daily and for taking my mind off
such things and making me laugh whenever we were together or on the phone
Finally I want to give a big thanks to Tanja Durbic and Dr Katarina Vukojevic
for making my last few months fun and amusing for the random medical advice and the
many entertaining outings
Dunja Damjanovic
iv
Family that dear octopus from whose tentacles we
never quite escape nor in our inmost hearts ever quite wish to
ndash Dodie Smith
To my wonderful parents Miladin and
Gordana Damjanovic and my
brother Srdjan
v
TABLE OF CONTENTS
ABSTRACT ii
ACKNOWLEDGMENTS iii
LIST OF TABLES viii
LIST OF FIGURES ix
APPENDICES x
ABBREVIATIONS xi
INTRODUCTION 1
11 ABC Transporter Proteins 2
12 Yeast as a Model Organism 3
13 ABC Transporter Proteins in Saccharomyces cerevisiae 4
14 ABCG (PDR5) Subfamily 6
15 ABCB (MDR) Subfamily 8
16 The Other Yeast Subfamilies 9
17 Yeast Pdr12p 10
171 Protein and Function 10
172 Role in Food Spoilage 10
173 Known Interactions 12
18 Yeast Ste6p 13
181 Protein and Function 13
182 Mating MAPK Pathway 13
183 Known Interactions 15
19 Studying Protein-Protein Interactions (PPIs) 16
191 The Importance of PPIs 16
192 Yeast two-hybrid Technologies and their Limitations 16
193 Analysis of Membrane Protein Interactions 18
110 Ubiquitin and the MYTH Technology 19
1101 Ubiquitin and its Role in Protein Degradation 19
1102 Reconstitution of Split Ubiquitin 20
1103 The MYTH Technology 21
111 Thesis Rationale 24
MATERIALS AND METHODS 25
21 Yeast Strains Media and Growth Conditions 26
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins 26
vi
23 Construction of the Prey Random Genomic DNA and cDNA Libraries 26
24 Verifying Proper Localization of CYT-tagged Bait Proteins 26
25 NubGNubI Test 27
26 Verification of C(Y)T-tagged Bait Functionality 28
261 Generation of Deletion Mutants 28
262 Verifying Deletion Mutants 28
263 Verifying Pdr12-C(Y)T Function 29
264 Verifying Ste6-C(Y)T Function 29
27 The iMYTH Assay 30
271 Large Scale Transformation 30
272 Patching and Recovering Putative Interactors 31
273 Amplification and Recovery of Prey Plasmid DNA 31
274 Prey Identification 32
275 Bait Dependency Test 32
28 Generation of Double Deletion Mutants 33
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p 34
291 Gap Repair Method 34
292 Gateway Cloning 35
210 Functional Assays for Pdr12p 36
2101 Spot Assays 36
2102 Liquid Panelling Assay 37
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p 37
2104 Western Blot Analysis 38
211 Extending Ste6p Duration at the Plasma Membrane 39
RESULTS 40
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated 41
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly 41
33 Tagged Bait Strains Pass NubGNubI Test 42
34 Functional Analysis of Bait Proteins 43
341 Pdr12-CT Grows in the Presence of Sorbic Acid 43
342 Ste6-CT is Able to Mate 44
35 iMYTH Screening Results 45
351 Large Scale Library Transformation 45
352 Bait Dependency Test 46
vii
353 Pdr12p Interactome 47
354 Ste6p Interactome 50
36 Generation of Double Deletion mutants with pdr12Δnat 50
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids 53
371 Spot Assays 53
372 TECAN Liquid Growth Assay 54
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants 58
381 Spot Assays 58
382 TECAN Liquid Growth Assay 60
39 Increasing Ste6p Duration at the Plasma Membrane 61
391 Treatment with α-factor 61
3102 Deletion of SAC6 63
DISCUSSION 65
41 GO Analysis 66
42 Protein Interactions of Interest 66
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p 66
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p 68
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p 69
424 Vps9p is a Novel Interactor of Ste6p 70
43 Poor Detection of Ste6p Interactions 71
44 Putative Role for Pdr10p in the Weak Acid Response 72
45 Lack of Expression of Prey Proteins 74
46 iMYTH as a System for the Detection of PPIs 75
FUTURE DIRECTIONS AND CONCLUSIONS 77
51 Concluding Remarks and Future Directions 78
REFERENCES 84
APPENDIX 91
viii
LIST OF TABLES
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
Table 2 Summary of Double Deletion Strains
Table 3 Yeast strains used in this study
Table 4 Plasmids used in this study
Table 5 Primers used in this study
Table 6 PCR Reactions
Table 7 PCR Programs
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Table 10 Description of Pdr12p Interactors
Table 11 Description of Ste6p Interactors
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
iii
ACKNOWLEDGMENTS
I wish to express my appreciation and gratitude to my supervisor Dr Igor Stagljar
for giving me the opportunity to work for him and learn from him I will always be
grateful for his advice which he gave freely for always listening to my concerns of
which there were many and most of all for pushing me beyond my limits and teaching
me never to give up
I would like to give my sincerest thanks to my committee members Drs Brenda
Andrews and Leah Cowen for their guidance throughout the years Their suggestions
and criticisms pushed me to continuously strive to improve and made me challenge
myself I am a wiser person for it
During my time here I have had the pleasure of meeting many great people and
have been fortunate enough to work alongside most of them on a daily basis A big thank
you goes out to all my lab mates both past and present for making our lab a fun and
interesting environment to work in For giving me guidance with new experiments
always listening and providing insights on overcoming a roadblock Dr Jamie Snider
has been a great teacher support and a person I relied heavily on for a second opinion
His willingness to answer my many questions provide me with great feedback and help
me out when I was unsure of how to proceed is much appreciated Though he challenged
every one of my results it was always with good intentions and has made my science
just that much better Dr Saranya Kittanakom whose smiling face always welcomed my
woes has been an invaluable help during my co-IP experiments Her knowledge and
advice gave me hope that one day it would all work Dawn Edmonds has been a fountain
of information over the years Her patience in teaching me to dissect tetrads and ordering
things for me on short notice is greatly appreciated I would also like to thank Dr Susan
Michaelis for her quick e-mail responses and advice on Ste6p
I would not be where I am today without the support both financial and
emotional of my parents and brother Mom and Dad thank you for always believing in
me for showing me that hard work pays off and for handling my being away from home
so well though I think Srdjan took it a little too well Your guidance throughout my life
has made me the person I am today and I will always appreciate that you always stood
behind everything I did and still wish to do
To my two best friends Dijana and Vanja I know that you often didnrsquot
understand what I did but I thank you for willing to try Most importantly I appreciate
you both listening to the ups and downs I encountered daily and for taking my mind off
such things and making me laugh whenever we were together or on the phone
Finally I want to give a big thanks to Tanja Durbic and Dr Katarina Vukojevic
for making my last few months fun and amusing for the random medical advice and the
many entertaining outings
Dunja Damjanovic
iv
Family that dear octopus from whose tentacles we
never quite escape nor in our inmost hearts ever quite wish to
ndash Dodie Smith
To my wonderful parents Miladin and
Gordana Damjanovic and my
brother Srdjan
v
TABLE OF CONTENTS
ABSTRACT ii
ACKNOWLEDGMENTS iii
LIST OF TABLES viii
LIST OF FIGURES ix
APPENDICES x
ABBREVIATIONS xi
INTRODUCTION 1
11 ABC Transporter Proteins 2
12 Yeast as a Model Organism 3
13 ABC Transporter Proteins in Saccharomyces cerevisiae 4
14 ABCG (PDR5) Subfamily 6
15 ABCB (MDR) Subfamily 8
16 The Other Yeast Subfamilies 9
17 Yeast Pdr12p 10
171 Protein and Function 10
172 Role in Food Spoilage 10
173 Known Interactions 12
18 Yeast Ste6p 13
181 Protein and Function 13
182 Mating MAPK Pathway 13
183 Known Interactions 15
19 Studying Protein-Protein Interactions (PPIs) 16
191 The Importance of PPIs 16
192 Yeast two-hybrid Technologies and their Limitations 16
193 Analysis of Membrane Protein Interactions 18
110 Ubiquitin and the MYTH Technology 19
1101 Ubiquitin and its Role in Protein Degradation 19
1102 Reconstitution of Split Ubiquitin 20
1103 The MYTH Technology 21
111 Thesis Rationale 24
MATERIALS AND METHODS 25
21 Yeast Strains Media and Growth Conditions 26
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins 26
vi
23 Construction of the Prey Random Genomic DNA and cDNA Libraries 26
24 Verifying Proper Localization of CYT-tagged Bait Proteins 26
25 NubGNubI Test 27
26 Verification of C(Y)T-tagged Bait Functionality 28
261 Generation of Deletion Mutants 28
262 Verifying Deletion Mutants 28
263 Verifying Pdr12-C(Y)T Function 29
264 Verifying Ste6-C(Y)T Function 29
27 The iMYTH Assay 30
271 Large Scale Transformation 30
272 Patching and Recovering Putative Interactors 31
273 Amplification and Recovery of Prey Plasmid DNA 31
274 Prey Identification 32
275 Bait Dependency Test 32
28 Generation of Double Deletion Mutants 33
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p 34
291 Gap Repair Method 34
292 Gateway Cloning 35
210 Functional Assays for Pdr12p 36
2101 Spot Assays 36
2102 Liquid Panelling Assay 37
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p 37
2104 Western Blot Analysis 38
211 Extending Ste6p Duration at the Plasma Membrane 39
RESULTS 40
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated 41
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly 41
33 Tagged Bait Strains Pass NubGNubI Test 42
34 Functional Analysis of Bait Proteins 43
341 Pdr12-CT Grows in the Presence of Sorbic Acid 43
342 Ste6-CT is Able to Mate 44
35 iMYTH Screening Results 45
351 Large Scale Library Transformation 45
352 Bait Dependency Test 46
vii
353 Pdr12p Interactome 47
354 Ste6p Interactome 50
36 Generation of Double Deletion mutants with pdr12Δnat 50
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids 53
371 Spot Assays 53
372 TECAN Liquid Growth Assay 54
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants 58
381 Spot Assays 58
382 TECAN Liquid Growth Assay 60
39 Increasing Ste6p Duration at the Plasma Membrane 61
391 Treatment with α-factor 61
3102 Deletion of SAC6 63
DISCUSSION 65
41 GO Analysis 66
42 Protein Interactions of Interest 66
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p 66
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p 68
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p 69
424 Vps9p is a Novel Interactor of Ste6p 70
43 Poor Detection of Ste6p Interactions 71
44 Putative Role for Pdr10p in the Weak Acid Response 72
45 Lack of Expression of Prey Proteins 74
46 iMYTH as a System for the Detection of PPIs 75
FUTURE DIRECTIONS AND CONCLUSIONS 77
51 Concluding Remarks and Future Directions 78
REFERENCES 84
APPENDIX 91
viii
LIST OF TABLES
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
Table 2 Summary of Double Deletion Strains
Table 3 Yeast strains used in this study
Table 4 Plasmids used in this study
Table 5 Primers used in this study
Table 6 PCR Reactions
Table 7 PCR Programs
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Table 10 Description of Pdr12p Interactors
Table 11 Description of Ste6p Interactors
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
iv
Family that dear octopus from whose tentacles we
never quite escape nor in our inmost hearts ever quite wish to
ndash Dodie Smith
To my wonderful parents Miladin and
Gordana Damjanovic and my
brother Srdjan
v
TABLE OF CONTENTS
ABSTRACT ii
ACKNOWLEDGMENTS iii
LIST OF TABLES viii
LIST OF FIGURES ix
APPENDICES x
ABBREVIATIONS xi
INTRODUCTION 1
11 ABC Transporter Proteins 2
12 Yeast as a Model Organism 3
13 ABC Transporter Proteins in Saccharomyces cerevisiae 4
14 ABCG (PDR5) Subfamily 6
15 ABCB (MDR) Subfamily 8
16 The Other Yeast Subfamilies 9
17 Yeast Pdr12p 10
171 Protein and Function 10
172 Role in Food Spoilage 10
173 Known Interactions 12
18 Yeast Ste6p 13
181 Protein and Function 13
182 Mating MAPK Pathway 13
183 Known Interactions 15
19 Studying Protein-Protein Interactions (PPIs) 16
191 The Importance of PPIs 16
192 Yeast two-hybrid Technologies and their Limitations 16
193 Analysis of Membrane Protein Interactions 18
110 Ubiquitin and the MYTH Technology 19
1101 Ubiquitin and its Role in Protein Degradation 19
1102 Reconstitution of Split Ubiquitin 20
1103 The MYTH Technology 21
111 Thesis Rationale 24
MATERIALS AND METHODS 25
21 Yeast Strains Media and Growth Conditions 26
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins 26
vi
23 Construction of the Prey Random Genomic DNA and cDNA Libraries 26
24 Verifying Proper Localization of CYT-tagged Bait Proteins 26
25 NubGNubI Test 27
26 Verification of C(Y)T-tagged Bait Functionality 28
261 Generation of Deletion Mutants 28
262 Verifying Deletion Mutants 28
263 Verifying Pdr12-C(Y)T Function 29
264 Verifying Ste6-C(Y)T Function 29
27 The iMYTH Assay 30
271 Large Scale Transformation 30
272 Patching and Recovering Putative Interactors 31
273 Amplification and Recovery of Prey Plasmid DNA 31
274 Prey Identification 32
275 Bait Dependency Test 32
28 Generation of Double Deletion Mutants 33
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p 34
291 Gap Repair Method 34
292 Gateway Cloning 35
210 Functional Assays for Pdr12p 36
2101 Spot Assays 36
2102 Liquid Panelling Assay 37
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p 37
2104 Western Blot Analysis 38
211 Extending Ste6p Duration at the Plasma Membrane 39
RESULTS 40
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated 41
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly 41
33 Tagged Bait Strains Pass NubGNubI Test 42
34 Functional Analysis of Bait Proteins 43
341 Pdr12-CT Grows in the Presence of Sorbic Acid 43
342 Ste6-CT is Able to Mate 44
35 iMYTH Screening Results 45
351 Large Scale Library Transformation 45
352 Bait Dependency Test 46
vii
353 Pdr12p Interactome 47
354 Ste6p Interactome 50
36 Generation of Double Deletion mutants with pdr12Δnat 50
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids 53
371 Spot Assays 53
372 TECAN Liquid Growth Assay 54
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants 58
381 Spot Assays 58
382 TECAN Liquid Growth Assay 60
39 Increasing Ste6p Duration at the Plasma Membrane 61
391 Treatment with α-factor 61
3102 Deletion of SAC6 63
DISCUSSION 65
41 GO Analysis 66
42 Protein Interactions of Interest 66
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p 66
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p 68
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p 69
424 Vps9p is a Novel Interactor of Ste6p 70
43 Poor Detection of Ste6p Interactions 71
44 Putative Role for Pdr10p in the Weak Acid Response 72
45 Lack of Expression of Prey Proteins 74
46 iMYTH as a System for the Detection of PPIs 75
FUTURE DIRECTIONS AND CONCLUSIONS 77
51 Concluding Remarks and Future Directions 78
REFERENCES 84
APPENDIX 91
viii
LIST OF TABLES
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
Table 2 Summary of Double Deletion Strains
Table 3 Yeast strains used in this study
Table 4 Plasmids used in this study
Table 5 Primers used in this study
Table 6 PCR Reactions
Table 7 PCR Programs
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Table 10 Description of Pdr12p Interactors
Table 11 Description of Ste6p Interactors
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
v
TABLE OF CONTENTS
ABSTRACT ii
ACKNOWLEDGMENTS iii
LIST OF TABLES viii
LIST OF FIGURES ix
APPENDICES x
ABBREVIATIONS xi
INTRODUCTION 1
11 ABC Transporter Proteins 2
12 Yeast as a Model Organism 3
13 ABC Transporter Proteins in Saccharomyces cerevisiae 4
14 ABCG (PDR5) Subfamily 6
15 ABCB (MDR) Subfamily 8
16 The Other Yeast Subfamilies 9
17 Yeast Pdr12p 10
171 Protein and Function 10
172 Role in Food Spoilage 10
173 Known Interactions 12
18 Yeast Ste6p 13
181 Protein and Function 13
182 Mating MAPK Pathway 13
183 Known Interactions 15
19 Studying Protein-Protein Interactions (PPIs) 16
191 The Importance of PPIs 16
192 Yeast two-hybrid Technologies and their Limitations 16
193 Analysis of Membrane Protein Interactions 18
110 Ubiquitin and the MYTH Technology 19
1101 Ubiquitin and its Role in Protein Degradation 19
1102 Reconstitution of Split Ubiquitin 20
1103 The MYTH Technology 21
111 Thesis Rationale 24
MATERIALS AND METHODS 25
21 Yeast Strains Media and Growth Conditions 26
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins 26
vi
23 Construction of the Prey Random Genomic DNA and cDNA Libraries 26
24 Verifying Proper Localization of CYT-tagged Bait Proteins 26
25 NubGNubI Test 27
26 Verification of C(Y)T-tagged Bait Functionality 28
261 Generation of Deletion Mutants 28
262 Verifying Deletion Mutants 28
263 Verifying Pdr12-C(Y)T Function 29
264 Verifying Ste6-C(Y)T Function 29
27 The iMYTH Assay 30
271 Large Scale Transformation 30
272 Patching and Recovering Putative Interactors 31
273 Amplification and Recovery of Prey Plasmid DNA 31
274 Prey Identification 32
275 Bait Dependency Test 32
28 Generation of Double Deletion Mutants 33
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p 34
291 Gap Repair Method 34
292 Gateway Cloning 35
210 Functional Assays for Pdr12p 36
2101 Spot Assays 36
2102 Liquid Panelling Assay 37
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p 37
2104 Western Blot Analysis 38
211 Extending Ste6p Duration at the Plasma Membrane 39
RESULTS 40
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated 41
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly 41
33 Tagged Bait Strains Pass NubGNubI Test 42
34 Functional Analysis of Bait Proteins 43
341 Pdr12-CT Grows in the Presence of Sorbic Acid 43
342 Ste6-CT is Able to Mate 44
35 iMYTH Screening Results 45
351 Large Scale Library Transformation 45
352 Bait Dependency Test 46
vii
353 Pdr12p Interactome 47
354 Ste6p Interactome 50
36 Generation of Double Deletion mutants with pdr12Δnat 50
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids 53
371 Spot Assays 53
372 TECAN Liquid Growth Assay 54
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants 58
381 Spot Assays 58
382 TECAN Liquid Growth Assay 60
39 Increasing Ste6p Duration at the Plasma Membrane 61
391 Treatment with α-factor 61
3102 Deletion of SAC6 63
DISCUSSION 65
41 GO Analysis 66
42 Protein Interactions of Interest 66
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p 66
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p 68
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p 69
424 Vps9p is a Novel Interactor of Ste6p 70
43 Poor Detection of Ste6p Interactions 71
44 Putative Role for Pdr10p in the Weak Acid Response 72
45 Lack of Expression of Prey Proteins 74
46 iMYTH as a System for the Detection of PPIs 75
FUTURE DIRECTIONS AND CONCLUSIONS 77
51 Concluding Remarks and Future Directions 78
REFERENCES 84
APPENDIX 91
viii
LIST OF TABLES
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
Table 2 Summary of Double Deletion Strains
Table 3 Yeast strains used in this study
Table 4 Plasmids used in this study
Table 5 Primers used in this study
Table 6 PCR Reactions
Table 7 PCR Programs
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Table 10 Description of Pdr12p Interactors
Table 11 Description of Ste6p Interactors
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
vi
23 Construction of the Prey Random Genomic DNA and cDNA Libraries 26
24 Verifying Proper Localization of CYT-tagged Bait Proteins 26
25 NubGNubI Test 27
26 Verification of C(Y)T-tagged Bait Functionality 28
261 Generation of Deletion Mutants 28
262 Verifying Deletion Mutants 28
263 Verifying Pdr12-C(Y)T Function 29
264 Verifying Ste6-C(Y)T Function 29
27 The iMYTH Assay 30
271 Large Scale Transformation 30
272 Patching and Recovering Putative Interactors 31
273 Amplification and Recovery of Prey Plasmid DNA 31
274 Prey Identification 32
275 Bait Dependency Test 32
28 Generation of Double Deletion Mutants 33
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p 34
291 Gap Repair Method 34
292 Gateway Cloning 35
210 Functional Assays for Pdr12p 36
2101 Spot Assays 36
2102 Liquid Panelling Assay 37
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p 37
2104 Western Blot Analysis 38
211 Extending Ste6p Duration at the Plasma Membrane 39
RESULTS 40
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated 41
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly 41
33 Tagged Bait Strains Pass NubGNubI Test 42
34 Functional Analysis of Bait Proteins 43
341 Pdr12-CT Grows in the Presence of Sorbic Acid 43
342 Ste6-CT is Able to Mate 44
35 iMYTH Screening Results 45
351 Large Scale Library Transformation 45
352 Bait Dependency Test 46
vii
353 Pdr12p Interactome 47
354 Ste6p Interactome 50
36 Generation of Double Deletion mutants with pdr12Δnat 50
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids 53
371 Spot Assays 53
372 TECAN Liquid Growth Assay 54
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants 58
381 Spot Assays 58
382 TECAN Liquid Growth Assay 60
39 Increasing Ste6p Duration at the Plasma Membrane 61
391 Treatment with α-factor 61
3102 Deletion of SAC6 63
DISCUSSION 65
41 GO Analysis 66
42 Protein Interactions of Interest 66
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p 66
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p 68
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p 69
424 Vps9p is a Novel Interactor of Ste6p 70
43 Poor Detection of Ste6p Interactions 71
44 Putative Role for Pdr10p in the Weak Acid Response 72
45 Lack of Expression of Prey Proteins 74
46 iMYTH as a System for the Detection of PPIs 75
FUTURE DIRECTIONS AND CONCLUSIONS 77
51 Concluding Remarks and Future Directions 78
REFERENCES 84
APPENDIX 91
viii
LIST OF TABLES
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
Table 2 Summary of Double Deletion Strains
Table 3 Yeast strains used in this study
Table 4 Plasmids used in this study
Table 5 Primers used in this study
Table 6 PCR Reactions
Table 7 PCR Programs
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Table 10 Description of Pdr12p Interactors
Table 11 Description of Ste6p Interactors
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
vii
353 Pdr12p Interactome 47
354 Ste6p Interactome 50
36 Generation of Double Deletion mutants with pdr12Δnat 50
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids 53
371 Spot Assays 53
372 TECAN Liquid Growth Assay 54
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants 58
381 Spot Assays 58
382 TECAN Liquid Growth Assay 60
39 Increasing Ste6p Duration at the Plasma Membrane 61
391 Treatment with α-factor 61
3102 Deletion of SAC6 63
DISCUSSION 65
41 GO Analysis 66
42 Protein Interactions of Interest 66
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p 66
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p 68
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p 69
424 Vps9p is a Novel Interactor of Ste6p 70
43 Poor Detection of Ste6p Interactions 71
44 Putative Role for Pdr10p in the Weak Acid Response 72
45 Lack of Expression of Prey Proteins 74
46 iMYTH as a System for the Detection of PPIs 75
FUTURE DIRECTIONS AND CONCLUSIONS 77
51 Concluding Remarks and Future Directions 78
REFERENCES 84
APPENDIX 91
viii
LIST OF TABLES
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
Table 2 Summary of Double Deletion Strains
Table 3 Yeast strains used in this study
Table 4 Plasmids used in this study
Table 5 Primers used in this study
Table 6 PCR Reactions
Table 7 PCR Programs
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Table 10 Description of Pdr12p Interactors
Table 11 Description of Ste6p Interactors
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
viii
LIST OF TABLES
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
Table 2 Summary of Double Deletion Strains
Table 3 Yeast strains used in this study
Table 4 Plasmids used in this study
Table 5 Primers used in this study
Table 6 PCR Reactions
Table 7 PCR Programs
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Table 10 Description of Pdr12p Interactors
Table 11 Description of Ste6p Interactors
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
ix
LIST OF FIGURES
Figure 1 ABC transporter structure
Figure 2 Phylogenetic tree of yeast ABC proteins
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway
Figure 5 Schematic of the iMYTH system
Figure 6 CYT-tagged bait protein localization
Figure 7 NubGNubI test for integrated bait strains
Figure 8 CT tag does not interfere with Pdr12p function
Figure 9 Evaluating Ste6-CT function with a mating assay
Figure 10 An example of a bait dependency test
Figure 11 Pdr12p Interactome
Figure 12 Ste6p Interactome
Figure 13 Weak acid stress assay
Figure 14 Sorbic acid liquid growth assay
Figure 15 Benzoic acid liquid growth assay
Figure 16 Drug sensitivity assay
Figure 17 Haloperidol liquid growth assay
Figure 18 Ste6-CYT treatment with α-factor
Figure 19 Ste6-CYT sac6Δnat localization
Figure 20 Pdr12p Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test
Figure 22 Sorbic and benzoic acid liquid growth assay replicate
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM
x
APPENDICES
Appendix I Yeast Strains Media Recipes and Reagents
Appendix II PCR Protocols and Primer Sequences
Appendix III Sequences of Pdr12p Identified Interactors
Appendix IV Pdr12-CT Bait Dependency Test
Appendix V Sequences of Ste6p Identified Interactors
Appendix VI Ste6-CT Bait Dependency Test
Appendix VII Definitions of Pdr12 and Ste6p iMYTH Identified Interactors
Appendix VIII Weak Acid Liquid Growth Assay Replicate
xi
ABBREVIATIONS
ABC ndash ATPndashbinding cassette
AD ndash Activation domain
ATP ndash Adenosinetriphosphate
Cub ndash C-terminal half of ubiquitin
CYT tag ndash Cub-YFP-TF tag
DBD ndash DNA binding domain
DUBsUBPs ndash Deubiquitinating enzyme(s)Ubiquitin-specific protease(s)
ER ndash Endoplasmic reticulum
FeS ndash Iron-sulfur
iMYTH ndash Integrated membrane yeast two-hybrid
Kan ndash Kanamycin
MSDTMD ndash Membrane spanning domainTransmembrane domain
MAPK mitogen activated protein kinase
Nat ndash Nourseothricin acetyl transferase
NBD ndash Nucleotide binding domain
Nub ndash N-terminal half of ubiquitin
NubI ndash Wildtype N-terminal half of ubiquitin
NubG ndash Mutant N-terminal half of ubiquitin
ORFs ndash Open reading frame(s)
PCR ndash Polymerase chain reaction
PDR ndash Pleiotropic drug resistance
PM ndash Plasma membrane
PPIs ndash Protein-protein interaction(s)
PURE ndash Phosphorylation ubiquitination recognition and endocytosis
RRS ndash Ras recruitment system
TF ndash Transcription factor
tMYTH ndash Traditional membrane yeast two-hybrid
WARE ndash Weak acid response element
WT ndash Wildtype
Y2H ndash Yeast two-hybrid
YFP ndash Yellow fluorescent protein
CHAPTER 1
INTRODUCTION
2
11 ABC Transporter Proteins
Survival at the cellular level is dependent on the ability of the cell to regulate the
selective passage of molecules and ions across its membranes not only for the acquisition
of nutrients and the excretion of waste products but for various regulatory and signalling
functions as well (1 2) Movement across the cellular membranes for the mentioned
processes is mediated by specialized proteins called transporters ATP-binding cassette
(ABC) transporters represent a large evolutionarily conserved family of integral
membrane proteins (1) currently estimated to consist of more than 3000 members (3)
These proteins are central to many physiological processes (4) and use the binding and
hydrolysis of ATP to power the translocation of a diverse assortment of substrates against
their concentration gradients across cellular membranes (1)
ABC transporters are ubiquitous in all organisms from bacteria to man and exist
as both exporters which can be found in both prokaryotes and eukaryotes and importers
which are exclusive to prokaryotic organisms (1) These proteins share a conserved
architecture known as the ABC core consisting of two homologous halves each
containing a membrane spanning domain (MSD) which is involved in substrate
specificity and a nucleotide-binding domain (NBD) which together form a ldquofull-lengthrdquo
functional transporter (1 2 4 5) (Fig 1) The NBD binds ATP and couples its
hydrolysis to substrate transport which is critical for ABC protein function (5) This
domain also has several conserved regions including the Walker A and B motifs and the
ABC signature motif LSGGQ (1 5)
3
Figure 1 ABC transporter structure Shown here is a standard arrangement for a full-length transporter
protein which consists of two hydrophobic MSDs and two NBDs The MSDs typically but not always
span the membrane six times while the NBD are responsible for ATP binding and hydrolysis and are
located in the cytoplasm
ABC transporters play an important role in many human diseases and
physiological processes (4) such as maintaining the blood-brain barrier which prevents
access of cytotoxic drugs to the brain and mediating cellular resistance to
chemotherapeutic drugs (5) Loss-of-function mutations in the genes encoding ABC
transporter proteins are implicated in a variety of human inherited diseases such as cystic
fibrosis Tangierrsquos disease and Stargardtrsquos muscular dystrophy among others (4 5) The
overexpression of ABC proteins leads to multidrug resistance in pathogenic
microorganisms as well as mammalian cells as is seen in the human MDR1 protein
which is able to expel almost all known anticancer drugs conferring resistance to tumor
cells (4 5) as a result hindering treatment and cancer therapy
Given their prevalence in all life forms ABC transporter proteins are of particular
interest to the scientific community both for their implications in human health and their
potential as therapeutic targets in treating cancer and preventing multidrug resistance
12 Yeast as a Model Organism
Over the years Saccharomyces cerevisiae being a simple eukaryote that can easily be
manipulated has emerged as an important tool for the study of eukaryotic cell function
The biochemical biological and genetic tractability of yeast make it an ideal model
4
system for studying protein interaction networks and function as well as for defining
cellular pathways (5) Yeast is also a very practical organism to work with as it is
inexpensive to maintain grows quickly and is safe when handled properly The genome
of yeast is fully sequenced which has facilitated the construction of the yeast deletion
collection providing yet another resource for the analysis of phenotypes and genetic
interactions under a variety of conditions In addition to a versatile and straightforward
transformation system (6) a number of powerful genetic and molecular approaches that
use yeast have been developed some of which can readily be automated facilitating
high-throughput studies (7) Finally many genes implicated in human diseases and
multidrug resistance have homologues in yeast It is also important to note that yeast and
human genomes share high homology which allows conclusions from the study of yeast
to provide insight into the physiological and biochemical mechanisms of human
homologues (8)
13 ABC Transporter Proteins in Saccharomyces cerevisiae
With the completion of the yeast genome sequence project in 1996 Saccharomyces
cerevisiae became the first organism for which the complete inventory of ABC
transporter proteins was available (5) It is estimated that close to 30 of the yeast
proteome consists of membrane proteins 10 of which are believed to be responsible for
the transport of small molecules through the plasma membrane (PM) (9) The yeast
genome encodes 30 ABC transporter proteins originally identified from BLAST searches
for homologues of the NBD1 of STE6 Of these proteins 22 are predicted to be true
ABC transporters while the remaining eight are believed to have regulatory roles as
opposed to transport functions due to the fact that they do not have any predicted
membrane spans (5 10) Based on phylogenetic analysis the 22 yeast ABC transporters
5
have been divided into six subfamilies (Fig 2) which have recently been renamed
following the mammalian nomenclature replacing the yeast subfamily names of MDR
MRPCFTR ALDP RLI YEF3 and PDR5 with ABCB to ABCG respectively (5)
Figure 2 Phylogenetic tree of yeast ABC proteins Members of the same subfamily are indicated by
grouping under the same coloured arc Subfamily names are indicated outside of the arc in the
corresponding colour following mammalian nomenclature For each subfamily a mammalian member
was used in the analysis as a point of reference These are indicated by an ldquohrdquo before their name The
asterisk indicates yeast proteins that are not closely homologous to any of the mammalian transporter
subfamilies The ABCA subfamily is absent in yeast Based on Paumi et al (5)
The majority of yeast ABC proteins localize to the plasma membrane where they
are responsible for the efflux of many substrates however these proteins are also found
within the membranes of intracellular organelles (5) As can be seen in Fig 3 the
peroxisome mitochondria and vacuole of a yeast cell all have several ABC proteins
6
within their membranes however no ABC proteins localize to the nucleus or
endoplasmic reticulum (ER) (5)
Fungal ABC proteins are involved in a variety of cellular functions from clinical
drug resistance development and translation elongation to cellular detoxification and
stress response (11) In addition to having a wide substrate specificity with respect to
drug transport ABC proteins also mediate the translocation of ions heavy metals amino
acids carbohydrates and even whole proteins across cellular membranes (11)
Figure 3 Subcellular localization of Saccharomyces cerevisiae ABC transporters The 22 yeast ABC
proteins are found in the membranes of organelles of the cell and the PM With the exception of Ste6p
(ABCB) and Yor1p (ABCC) all of the ABC proteins found within the PM belong to the ABCG subfamily
Pxa1p and Pxa2p belong to the ABCD subfamily the mitochondrial transporters are ABCB members
while the vacuolar transporters make up the rest of the ABCC subfamily P designates peroxisome V the
vacuole M the mitochondria N the nucleus and ER the endoplasmic reticulum Transporters belonging to
the same subfamily are indicated by colour Two cylinders indicates a full-length transporter while one
cylinder indicates a half-sized transporter Based on Jungwirth and Kuchler (3) and Paumi et al (5)
14 ABCG (PDR5) Subfamily
In addition to being divided into subfamilies eukaryotic ABC proteins have also been
subdivided into either full or half length transporters (12) The mammalian ABCG or
White subfamily consists of five unique half transporters named ABCG1 ABCG2
7
ABCG4 ABCG5 and ABCG8 These proteins have a peculiar domain organization with
the NBD at the N-terminus followed by the MSD (12-14) In order to become fully
functional transporters they form homodimers (ABCG1 ABCG2 and ABCG4) or
obligate heterodimers (ABCG5 and ABCG8) (12 14) With the exception of ABCG2 all
members of this family play a significant role in the transport of sterols (12) especially
the efflux of cholesterol (14) The altered expression andor activity of both ABCG2 and
the heterodimer ABCG5ABCG8 has clinical relevance Altered ABCG2 results in
resistance to chemotherapy while changes in the heterodimer result in sitosterolemia
which is characterized by an accumulation phyto- and shellfish sterols (12 14)
Previously known as the PDR5 subfamily the Saccharomyces cerevisiae ABCG
subfamily with its 10 members is the largest and best characterized of all the yeast ABC
subfamilies to which Pdr12p belongs With the exception of Adp1p all protein members
are classified as full length transporters and are involved in a variety of functions
including metal ion resistance (15) and efflux of weak organic acids (16) All members
of this subfamily reside in the PM (Fig 3) Perhaps some of the most extensively studied
and best characterized members of this family include Pdr5p and Snq2p (17 18) Both
proteins mediate multidrug resistance through ATP-dependent efflux (15) and are able to
recognize numerous structurally and functionally unrelated compounds (18) In addition
to sharing high homology with one another (15) these proteins have largely overlapping
substrate specificity (18 19)
Pleiotropic drug resistance (PDR) in yeast is homologous to multidrug resistance
(MDR) observed in parasites bacteria fungal pathogens and mammalian tumor cells (3
11 20) Resistance to multiple cytotoxic compounds is an acquired trait (21) with the
8
major determinants mediating this resistance being ABC transporter proteins (17) PDR
results from the overexpression of membrane proteins that mediate drug efflux from the
cell which can occur through mutations in genes encoding the proteins or their
transcriptional regulators (3 22) With a large number of these proteins in the PM which
constitute the first line of defence against harmful compounds (23) yeast can quickly
counteract substrate toxicity through the PDR network of proteins (3) This acquired
resistance poses major challenges for cancer therapy and the treatment of infectious
diseases as well as the development of effective therapeutics (22 23)
Several proteins in this family are responsible for mediating acquired multidrug
resistance (15 18) while on the other end of the spectrum Pdr12p another member of
this family that acts as a weak acid anion pump has important implications for the food
industry specifically the preservation of food products and beverages (19 24)
15 ABCB (MDR) Subfamily
This subfamily of yeast proteins only comprises of four members three of which reside
in the inner mitochondrial membrane and are considered half length transporters (5)
while Ste6p is localized to the PM (Fig 3) (19) and is a full length transporter protein (5)
Ste6p is required for mating of yeast cells as it is responsible for the transport of the
mating pheromone a-factor out of the cell (11) Atm1p acts as a homodimer (25) and
exports iron-sulfur (FeS) clusters from the mitochondria and as such plays an essential
role in the generation of cytosolic FeS proteins (26) Mdl1p is responsible for the export
of mitochondrial peptides generated by proteolysis (27) is a suppressor of Atm1p and
also has a role in the regulation of cellular resistance to oxidative stress (28) While
Mdl2p is highly similar to Mdl1p at the sequence level it does not play a role in the
export of peptides and its function remains unknown (29)
9
16 The Other Yeast Subfamilies
The second largest yeast subfamily of ABC transporters with six members is the ABCC
subfamily All six of these proteins have the typical structural organization and share
significant homology with the human multidrug resistance-associated protein 1 (MRP1)
and the cystic fibrosis chloride channel protein (CFTR) (11) both of which have clinical
importance These proteins function as vacuolar detoxification pumps and mediate both
multidrug and heavy metal resistance (11 30) With the exception of Yor1p which
localizes to the PM (3) all other proteins of this subfamily are found in the vacuolar
membrane (Fig 3) (3 11 31) One of the most extensively studied members of this
subfamily is Ycf1p the yeast cadmium factor which mediates vacuolar detoxification of
heavy metals and xenobiotics by transporting them as glutathione-S conjugates (11 32)
Ycf1p is also responsible for the accumulation of red pigment in ade2 mutant cells (3
32) The other well characterized protein from this subfamily is Yor1p whose deletion
mutants though viable are hypersensitive to oligomycin and reveromycin A (11) as well
as other xenobiotics (11 33)
The ABCD subfamily is comprised of two half-sized transporters Pax1p and
Pax2p located in the peroxisomal membrane (Fig3) (3 11) Both proteins have one
MSD that spans the membrane six times and a single NBD In addition Pax1pPax2p
are orthologues of the human Pmp70 and ALDp-like peroxisomal transporters associated
with the fatal neurodegenerative disease adrenoleukodystrophy (3 11)
The ABCE and ABCF subfamilies in yeast have one and six members
respectively all of which lack MSDs and have not been studied with the exception of
two members of the ABCF subfamily Yef3p and Gcn20p (11) Yef3p is believed to
function as an elongation factor and is encoded by the only essential ABC gene In
10
addition its overexpression causes hypersensitivity to the translational inhibitors
paromomycin and hygromycin B Though as of yet unconfirmed a possible role for
Gcn20p could be the regulation of amino acid utilization (11)
There are also two proteins Caf16p and Ydr061Cp that have not yet been
classified as their sequences are more distantly related to the other ABC transporter
proteins (11) and are not close homologues of any mammalian subfamily member (5)
Though they do have a NBD with degenerate ABC signature motifs these proteins still
lack predicted membrane spanning regions (11)
17 Yeast Pdr12p
171 Protein and Function
The yeast PDR12 gene encodes a 1511 amino acid long 171 kDa ABC transporter
protein that resides in the PM (Fig3) (3) The protein is a full length transporter with
(NBD-MSD6)2 topology arranged in the reverse conformation The promoter region of
Pdr12p contains a cis-acting weak acid response element (WARE) required for the
binding of the transcription factor War1p (34) In the presence of weak organic acids
such as sorbic and benzoic acid Pdr12p becomes strongly induced causing an increase
of the protein to accumulate at the PM (24) The induction of PDR12 is rapid mainly
regulated at the level of transcription and is specific for weak acid stress (34) This
protein is the first ABC transporter to be assigned the function of a weak acid anion pump
(16) and is essential for the adaptation and growth of cells in the presence of weak acid
stress (35) as is the phosphorylation activation and DNA binding of War1p (36)
172 Role in Food Spoilage
Weak acids have a long history as additives in food and have primarily been used to
prolong the shelf life and preserve food quality through the inhibition of spoilage micro-
11
organisms (36 37) The most commonly used compounds in the food industry include
sulphites used in wine making (36) as well as the naturally occurring short-chain (C1-
C7) weak organic acids such as sorbate benzoate acetic and propionic acids used in
various foods and beverages (34) With respect to yeast weak acid preservatives
characteristically cause an extended lag phase and cell stasis as opposed to cell death
(24 36)
In solution weak acid preservatives exist in a pH-dependent equilibrium between
the undissociated and the dissociated states (35) They have optimal inhibitory activity at
lower pH values as this favours the undissociated uncharged state of the molecule
which is freely permeable across the PM (35) Once the acid molecule enters the cell it
encounters the higher cytoplasmic pH and dissociates into anions and protons which
being charged particles cannot cross the PM resulting in their accumulation within the
cell (34-36) The mechanism of growth inhibition by weak acid preservatives is not yet
fully understood however it is proposed that the accumulation of protons leads to
cytoplasmic acidification which in turn inhibits a number of important metabolic
processes including active transport glycolysis and signal transduction (36)
The ability of microbes to survive and grow in foods that contain preservatives is
largely due to their ability to adapt to stress (16) Yeasts that are major spoilage
organisms include Zygosaccharomyces as well as some isolates of Saccharomyces
cerevisiae (16) whose ability to grow in the presence of the maximum permitted levels
of preservatives causes severe economic losses and poses potential health hazards (37)
The ability of Saccharomyces cerevisiae to grow in the presence of sorbic and benzoic
acids involves the induction on the efflux pump Pdr12p whose active efflux of acid
12
anions from the cell results in adaptation of weak acid induced stress (16 20) Through
this function Pdr12p is able to neutralize the intracellular environment rendering any
inhibitory activity of the weak acid preservative futile allowing normal metabolic
processes to continue unhindered
As Pdr12p is implicated in the spoilage of food insight into the function of this
protein and how it renders yeast resistant to preservatives has important implications for
the food industry By identifying interacting partners the exact mechanism mediating
this weak acid resistance could be elucidated and with a greater understanding of this
process new methods with the ability to obstruct the cells resistance to food preservatives
can be developed avoiding economic losses and potential health risks associated with
spoiled food products
173 Known Interactions
According to the Saccharomyces Genome Database (SGD) Pdr12p has a total of 48
known physical interactions the majority of which were identified by a genome-wide in
vivo screen using the protein-fragment complementation assay (PCA) (38) Some of the
more notable interactions include Gpa2p the α-subunit of a G-protein and Hsp30p a
stress induced protein of the plasma membrane that negatively regulates the H(+)-
ATPase Pma1p In addition Pdr12p was shown to interact with proteins of the major
facilitator superfamily such as the sugar transporters Hxt1p and Hxt5p as well as the
multi-drug transporters Qdr2p and Qdr3p Most interestingly the PCA screen also
identified Snq2p and Yor1p as interactors of Pdr12p both of which are major drug
pumps belonging to the ABC superfamily the latter of which is also similar to the human
CFTR (38)
13
18 Yeast Ste6p
181 Protein and Function
The first ABC transporter gene discovered in Saccharomyces cerevisiae was STE6 which
was subsequently shown to encode Ste6p a 1209 residue full length transporter protein
localized to the PM with forward (MSD6-NBD)2 topology (3 19) Perhaps one of the
best characterized yeast ABC transporters Ste6p is the exporter of the mating pheromone
a-factor (11) and is a close homologue of the human P-glycoprotein with which it shares
approximately 60 homology (39 40)
Despite its site of function being the PM Ste6p resides only briefly at the cell
surface with a half life estimated to be 15-20 minutes (41 42) Due to rapid and
constitutive endocytosis after which Ste6p is ultimately delivered to the vacuole for
degradation (11 43) the protein does not accumulate at the PM (42) It was shown that
Ste6p follows a complex trafficking pattern for the internalization of PM proteins that
involves phosphorylation ubiquitination recognition and endocytosis appropriately
named the PURE pathway (41) Likewise it was shown that ubiquitination is a critical
signal for the internalization of Ste6p (41 42) and as would be expected any mutations
that affect the ubiquitination process or any other step in the pathway result in the
stabilization of Ste6p at the plasma membrane (41 43)
182 Mating MAPK Pathway
Saccharomyces cerevisiae cells produce and respond to peptide hormones whose role is
to induce physiological processes that lead to the conjugation of two haploid cells
resulting in the formation of a diploid cell (44) Biologically active α-factor is produced
by MATα cells from specific proteolytic processing events that occur during transit of its
precursor molecule through the yeast secretory pathway which is its mode of release
14
from the cell (44) Unlike α-factor mature a-factor is a post-translationally modified
peptide processed and released from MATa cells (44) via the ATPase activity of Ste6p
(39) The STE6 gene product is essential for mating between yeast cells to occur and not
surprisingly its deletion results in a sterile phenotype (44 45)
Figure 4 Saccharomyces cerevisiae mating MAPK signalling pathway Proteins are shown as labelled
shapes black arrows indicate translocation or protein activation while T-bars indicate inhibition Protein
association is indicated by the double-headed black arrow The binding of a-factor pheromone by receptor
Ste2p causes dissociation of the heterotrimeric G-protein (1) into G subunit and the G dimer Upon
the dissociation of the G protein Ste4p recruits the MAPK scaffold Ste5p to the membrane (2) Ste5p
recruitment activates the MAPK cascade in which Ste20p Ste11p Ste7p and the MAP kinase Fus3p
phosphorylate one another in sequential order Phosphorylated Fus3p (3) translocates to the nucleus and
phosphorylates Dig1p and Ste12p eliminating Dig1p repression of Ste12p (4) Ste12p is then free to
activate transcription of pheromone-responsive genes Based on Elion (46)
The receptor-G-protein-coupled mitogen-activated protein kinase (MAPK)
pathway mediates the response of a cell to the presence of a pheromone (Fig 4) (46)
15
The binding of a-factor to its receptor Ste2p on the surface of a MATα cell induces
several cellular responses including the arrest of the cell cycle in G1 phase The binding
also causes the heterotrimeric G-protein to dissociate into a Gα subunit Gpa1 and the
Gβγ dimer Ste4-Ste18 Ste4p then helps to recruit the MAPK scaffolding protein Ste5p
to the membrane which activates the MAPK cascade a series of sequentially activated
protein kinases This ultimately leads to the transcriptional activation of pheromone-
responsive genes that allow individual cells to synchronize their cell cycles elongate and
form a projection toward their mating partner and finally fuse with one another to yield a
diploid cell (46 47)
183 Known Interactions
Although Ste6p is involved in mating there are only 13 listed interactions on the SGD 7
of which are genetic interactions involving proteins of the 20S and 26S proteosome (48)
The remaining 6 physical interactions do not include proteins involved in mating and
have been detected using different methods Two of the proteins Ste6p interacts with are
Lsm4p and Lsm5p (49) which are believed to form heteroheptameric complexes and
thought to be involved in mRNA decay andor tRNA and rRNA processing Other
interactions include Sec72p (50) and the ER-associated protein Ssm4p (51) Perhaps one
of the more intriguing interactions is the one Ste6p has with itself It was shown that
STE6 half-molecules interact physically assembling in vivo to form a functional
transporter protein (52) The same was also demonstrated for a STE6 half-molecule and
full-length STE6 (52) however two full length Ste6p proteins were not shown to interact
Though the function of Ste6p is known the mechanisms behind it are not well
understood Given that only 6 proteins have been identified that physical interact with
Ste6p by identifying novel interacting partners of Ste6p further insight can be gained
16
into the mechanisms of transport and its internalization which could be applied to better
understand its homologue the human P-glycoprotein In addition novel roles for this
protein could be identified
19 Studying Protein-Protein Interactions (PPIs)
191 The Importance of PPIs
Protein-protein interactions (PPIs) are an essential aspect in every biological process as
they regulate many cellular functions including cell signalling metabolism regulation
and the formation of macromolecular structures (38 53 54) These interactions can also
confer specificity to the interactions occurring between an enzyme and its substrate and
are often involved in the channelling of substrates through the formation of multi-protein
complexes (54) Membrane proteins also play important roles in biological processes as
they control membrane permeability to countless structurally and functionally unrelated
compounds and are also involved in sensing chemical and physical stimuli from the
external environment such as hormones and pathogens (54) In addition membrane
proteins are of substantial therapeutic and diagnostic importance as it is estimated that
50 of currently known drug targets are membrane ion channel or receptor proteins (7
53) Insight into the function of a specific protein can be gained by examining the
proteins it can bind to and with the sequencing of entire genomes of representative
model organisms many genetic and biochemical methods have evolved to address the
technological challenges faced when investigating PPIs with the yeast two-hybrid (Y2H)
being the most popular
192 Yeast two-hybrid Technologies and their Limitations
First published in 1989 as an approach to detecting PPIs (55) the Y2H assay is one of the
most successfully and widely used methods for investigating PPIs in vivo (56 57) The
17
basic idea behind all two-hybrid methods is to split a protein into two halves that do not
function independently of one another but do so when brought together again In the
Y2H assay a protein of interest called the bait is fused to the DNA binding domain
(DBD) of a transcription factor (TF) while another protein called the prey is fused to
the activation domain (AD) of the same transcription factor (53 57 58) Both fusion
proteins are co-expressed in yeast where their interaction leads to the reconstitution of a
functional TF which activates reporter genes typically HIS3 LEU2 and lacZ allowing
for detection by growth on selective medium and a colour signal respectively (53 57
58)
Two-hybrid technologies are best suited for measuring direct interactions between
pairs of proteins (38) and since the Y2H is a genetic assay it is a system well suited for
high-throughput applications (58) Two of the best known adaptations of the Y2H
system for large-scale use are the matrix or array approach and the library screening
approach both of which have been successfully used for the generation of genome-wide
protein interaction maps in yeast (58) In the matrix approach yeast open reading frames
(ORFs) are amplified using the polymerase chain reaction (PCR) are cloned as both
fusions of the DBD and the AD and introduced into reporter strains of opposing mating
type A reporter strain expressing a DBD fusion is mated to all the different AD fusions
comprising the array and positive interactions are identified by the ability of diploid cell
to grow on selective medium The library screening approach uses complex libraries of
AD fusions containing both full length and fragmented ORFs which are divided into
pools used to mate with a strain expressing a DBD fusion bait protein Similarly diploid
strains containing an interacting pair are selected by their ability to grow on selective
18
medium (58) Both techniques have been used to study all 6000 ORFs to generate a
glimpse into the yeast interactome (59 60) and the Y2H technique has even been
adapted for the use in mammalian systems (61)
Though an effective rapid and easy to use system one that has been successfully
employed in the detection of more than 50 of interactions described in literature (58)
the Y2H assay is not without limitations Many naturally occurring PPIs cannot be
detected with this method due to the requirement of the system for the interacting
proteins to be located in the nucleus in order to activate the reporter genes (7) Therefore
any interaction between proteins outside of the nucleus cannot be detected Membrane
proteins in particular present a significant challenge for the Y2H methodology
Transmembrane proteins are anchored in the membrane and therefore form aggregates
outside of the membrane due to their highly hydrophobic and insoluble nature Using
soluble domains is an option but can affect the detection of certain interactions and as
such is not an ideal solution In addition membrane proteins can have post-translational
modifications or oligomerize through interactions involving their MSD neither of which
are favourable for the nuclear-based Y2H assay (7 57) Another serious challenge for
the Y2H assay is the frequent and high occurrence of false negatives and positives the
latter of which can range anywhere from 25-45 for a large-scale screen (53)
193 Analysis of Membrane Protein Interactions
To overcome the limitations of the Y2H system several genetic screening methods have
been developed to address the problem of investigating interactions involving membrane
proteins while retaining the advantages of the original Y2H assay These include the Ras
recruitment system (RRS) and the reverse RRS both of which are based on the Ras
pathway in yeast the G-protein fusion technology where the inactivation of the G-
19
protein signalling pathway serves as the readout (7 58) and the rUra3 based split-
ubiquitin system (58) Genetic assays that are based on the complementation of proteins
or protein fragments and allow for the monitoring of membrane protein interactions in
real time in organisms other than yeast have also been developed (7) These include the
β-galactosidase complementation assay dihydrofolate reductase (DHFR) assay and the β-
lactamase assay (7) Though all of these technologies are suitable for the study of
transmembrane proteins they still have limitations In the case of the RRS and reverse
RRS systems membrane proteins cannot be used as bait or prey respectively (7 58)
limiting the identification of interactions to only those that occur between membrane and
cytosolic proteins Though successfully used to demonstrate an interaction between two
defined interaction partners syntaxin 1 and Sec1 the G-protein based system has yet to
be used in large-scale library screening (7 58)
110 Ubiquitin and the MYTH Technology
Based on the ability of ubiquitin to reconstitute when split into two moieties the
membrane yeast two-hybrid (MYTH) system (62) was developed to overcome the
limitations of the traditional Y2H assay (55) specifically the inability of the assay to
investigate interactions involving membrane proteins and as such is a powerful tool for
the study of ABC transporter interacting partners
1101 Ubiquitin and its Role in Protein Degradation
Ubiquitin is a small highly evolutionarily conserved polypeptide comprised of 76
amino acid residues that is found in every living organism and serves as a signal for the
degradation of proteins (63) Degradation of a protein via the ubiquitin-mediated
proteosome pathway occurs in two steps the first of which tags the target substrate with
multiple ubiquitin molecules by covalent bond formation which is followed by the
20
degradation of the tagged protein by the 26S proteosome a large multicatalytic protease
Conjugation of ubiquitin to the substrate is a three step process that starts with the
activation of ubiquitin in an ATP driven reaction by the ubiquitin-activating enzyme E1
which generates a first thiol ester intermediate The ubiquitin-conjugating enzyme E2
transfers the activated ubiquitin moiety via an additional thiol ester intermediate from
E1 to E3 a member of the ubiquitin-protein ligase family The E3 catalyzes the covalent
attachment of ubiquitin to the substrate by forming an isopeptide bond between the
molecule and an internal Lys residue of the substrate A polyubiquitin chain is
synthesized by successively adding activated ubiquitin molecules to the internal Lys
residue of the previously conjugated ubiquitin and is recognized the 26S proteosome
complex On the other hand cell surface proteins such as G-protein coupled receptors
pheromone receptors and membrane proteins are mono ubiquitinated which results in
their internalization rather than degradation These proteins are ultimately shuttled to the
vacuole for degradation (63)
Degradation of cellular proteins is a highly complex and tightly regulated process
that plays important roles in a variety of pathways during cell life and death as well as
health and disease (63) The selective degradation of many eukaryotic proteins is carried
out by ubiquitin-mediated proteolysis (64) which as a system is key for maintaining
cellular quality control defence mechanisms and homeostasis (63 65) To name a few
ubiquitin-mediated proteolysis is involved in the process of cell cycle regulation and
division DNA repair and response to stress (63 64)
1102 Reconstitution of Split Ubiquitin
In 1994 it was discovered that when ubiquitin was split into a C-terminal moiety
termed Cub and an N-terminal moiety called Nub the two would spontaneously
21
reconstitute if expressed within the same cell to form a ubiquitin molecule that is
recognized by ubiquitin-specific proteases (UBPs) (66) In the same study it was also
shown that reconstitution of the two halves of ubiquitin would also occur when they were
expressed as fusions of proteins and that by mutating a single residue of Nub the
reconstitution of the molecule was abolished However if the proteins fused to the Cub
and Nub moieties interact in vivo ubiquitin can once again become reconstituted and its
subsequent cleavage by UBPs can be restored (66)
This discovery made it possible to study PPIs within a living cell and as a
function of time It also allows for the detection and analysis of larger protein
complexes weak and transient interaction and the study of interactions occurring
between membrane proteins and as such is an integral part of the MYTH system
1103 The MYTH Technology
In the traditional MYTH (tMYTH) system a membrane protein of interest the
bait is fused at its C-terminus to the C-terminal half of ubiquitin Cub the yellow
fluorescent protein (YFP) and a hybrid TF consisting of the E coli DNA binding protein
LexA and the AD of VP16 from the herpes simplex virus collectively known as the CYT
tag (Fig 5) (5 62) The other protein of interest the prey which can be either cytosolic
or membrane bound is fused at its N or C terminus to the N-terminal half of ubiquitin
harbouring an Ile13Gly mutation designated NubG that serves to counteract the natural
affinity Cub and wildtype Nub have for one another These prey protein can either be
specifically selected or consist of entire cDNA or genomic DNA libraries Both bait and
prey proteins are carried on a plasmid and are co-expressed in a Saccharomyces
cerevisiae host cell If the bait and prey proteins interact Cub and NubG are brought into
close proximity and can overcome the counteracting activity of the glycine mutation (Fig
22
5) This results in the reconstitution of a pseudoubiquitin molecule whose subsequent
recognition by cytosolic deubiqutinating enzymes (DUBs) effectively releases the TF
which can freely enter the nucleus and activate the transcription of reporter genes
allowing for growth on selective medium and subsequent verification using an X-gal (5-
bromo-4-chloro-3-indolyl-β-D-galactopyranoside) screen (5)
Though a powerful genetic approach the tMYTH assay was not well suited for
the study of all membrane proteins Overexpression of some membrane proteins could
occur due to the exogenous expression of the bait proteins which would result in self-
activation of the reporter system in the absence of an interaction (32) To overcome this
integrated MYTH (iMYTH) was developed (32) where the bait tag was integrated into
the yeast chromosome providing an endogenous level of expression thereby avoiding
the potential risk of self-activation
Figure 5 Schematic of the iMYTH system (A) A membrane protein of interest the bait shown in blue
is fused to Cub YFP and the TF LexA-VP16 The prey protein shown in pink is fused to NubG The
reporter genes in the nucleus are in the off state (B) If the bait and prey proteins interact pseudoubiquitin
is reconstituted and cleaved at its C-terminal end by DUBs which releases the TF into the nucleus where it
binds to the LexA operator sites (lexA ops) and activates the reporter genes HIS3 ADE2 and lacZ Based
on Paumi et al (5) Iyer et al (67) and Stagljar et al (62)
23
Since its development variations of the MYTH assay have been successfully used
to find interacting partners of the yeast Ycf1p transporter in a large-scale library screen
(32 68) to characterize the interaction between the yeast endoplasmic reticulum (ER)
proteins Msn1p and Rer1p (7) to find novel interactors of the mammalian ErbB3
receptor from human cDNA libraries (69) and even to investigate interactions between
plant sucrose transporters (70) In addition MYTH has been used to find interactors of
Tmem176B and Tmem176A both of which are involved in the maintenance and
maturation of dendritic cells (71) to elucidate binding partners of the human papilloma
virus (HPV) E5 protein and better understand the virus phogenicity (72) and to identify
small GTPases that modulate the surface expression of P-glycoprotein (73) among others
(74-76)
The iMYTH system has several advantages over the traditional Y2H assay the
first being that it is specifically designed for but not limited to the investigation of
interactions between full-length membrane proteins In addition unlike the Y2H system
iMYTH does not require the interaction to occur in the nucleus which allows for the
protein under investigation to undergo post-translational modifications and have proper
localization This system is well suited for the study of many types of integral membrane
proteins irrespective of their localization as long as the Cub-TF and NubG moieties
fused to their respective proteins are located in the cytoplasm and therefore accessible to
DUBs (7 67) This requirement is a disadvantage of the system as it cannot be used to
study transmembrane proteins whose N and C termini are both located outside of the
cytosol or to study proteins which reside within the inner mitochondrial membrane as
DUBs are exclusively found in the cytosol (69)
24
111 Thesis Rationale
Protein-protein interactions play an important role in numerous events that occur within a
cell Nearly one third of a given organismrsquos genome encodes membrane proteins which
due to their hydrophobic nature have proved difficult to study using conventional
methods and as a result interactions involving these proteins are severely
underrepresented in genome-wide screens Considering the implications ABC transporter
proteins have for a diverse set of human diseases and multidrug resistance understanding
their mechanism of action and function is of great importance One of the first steps
towards these goals is the elucidation of complete protein interaction maps or
interactomes which can be effectively done using the iMYTH system The goal of this
work is to generate an interactome for each of the two yeast ABC transporter proteins
Pdr12p and Ste6p using the iMYTH assay As a weak acid anion pump conferring
resistance to food preservatives Pdr12p has implications for food spoilage preservation
and while Ste6p is a mating pheromone transporter it is also a homologue of human P-
glycoprotein which has been implicated in many cancers The identification of novel
protein interactors will allow further characterization of the function of Pdr12p and
Ste6p and identify unknown protein regulators Any knowledge gained from the
interactome of these proteins may lead to the better understanding of their human
homologues and identification of novel drug targets
25
CHAPTER 2
MATERIALS AND METHODS
26
21 Yeast Strains Media and Growth Conditions
Yeast strains used in this study and their relevant genotypes can be found in Appendix I
The media and solutions used for iMYTH screening and throughout this study were
prepared as previously described (67 77) and can also be found in Appendix I
22 Generation of Endogenously CT- and CYT-tagged Bait Proteins
Full length C-terminally tagged Pdr12p and Ste6p baits were generated as previously
described in detail (32) Briefly it involved the PCR amplification of a fragment from
the pCYT-L3 plasmid containing the Cub-YFP-TF (CYT) cassette and the KanMX
resistance marker gene or the L2 plasmid containing the Cub-TF (CT) module This
PCR product was then transformed into the L40 yeast reporter strain and through
homologous recombination integrated into the chromosome resulting in bait strains with
tagged PDR12 and STE6 genes Colony PCR and sequencing were used to verify the
correct orientation of the tag (32)
23 Construction of the Prey Random Genomic DNA and cDNA Libraries
The yeast cDNA library was purchased from a commercial source (Dualsystems Biotech
Switzerland) and prepared as previously described (67) The genomic DNA library was
prepared in house (32) The prey plasmids of both libraries carry the TRP1 marker
24 Verifying Proper Localization of CYT-tagged Bait Proteins
To examine the localization of CYT-tagged Pdr12 and Ste6 proteins the YFP which is
part of the tag was utilized Freshly grown cells were washed prior to being resuspended
in 100 μL of ddH2O Two microlitres of resuspended cells were spotted on a glass slide
and covered with a cover slip Prior to viewing with the YFP filter a drop of cedar wood
immersion oil was spotted on the coverslip The fluorescence was viewed at 503 nm
wavelength with a fluorescence microscope
27
25 NubGNubI Test
This test was performed in order to verify the correct expression and lack of self-
activation of the CT-tagged bait proteins Two unrelated proteins Ost1p an ER
membrane protein and Fur4p a plasma membrane protein are fused to either NubG or
NubI and are used as control plasmids for this test (see Appendix I) The plasmids
pOst1-NubG and pFur4-NubG are used as negative controls while pOst1-NubI and
pFur4-NubI are used as positive controls An overnight culture of Pdr12-CT and Ste6-
CT was grown and the next day was used to inoculate a 10 mL culture at a starting
OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were pelleted
washed and resuspended in 1 mL of sterile ddH2O For each transformation 100 microL of
resuspended cells 1 microL of positive or negative control plasmid and 300 microL of
Transformation Master Mix (see Appendix I) were combined and mixed The mixture
was then incubated at 30degC with shaking for 30 minutes after which it was heat
shocked at 42degC for 40 minutes The mixture was then pelleted and the cells
resuspended in 09 NaCl and plated on SD-W plates to select for the presence of the
plasmid Plates were incubated at 30degC for 2-3 days After growth a single colony from
each transformation plate was picked and resuspended in 150 microL of sterile ddH2O
(undiluted sample) Four serial 10-fold dilutions were prepared from the undiluted
sample and 5 microL of each dilution was spotted on SD-W plates to verify that the
transformation was successful and on SD-WH to select for the activation of the reporter
gene system Plates were again grown at 30degC for 2-3 days and results were then
assessed
28
26 Verification of C(Y)T-tagged Bait Functionality
261 Generation of Deletion Mutants
Deletion mutants of Pdr12p and Ste6p were generated via homologous recombination
First the Kanamycin resistance (KanMX) and Nourseothricin resistance (Nat) cassettes
from the L2 and p4339 plasmids respectively were PCR amplified using primers
complimentary to the cassettes with over-hang sequence complimentary to the regions
flanking each gene Refer to Appendix II for primer sequences and PCR protocols This
PCR product was then transformed into the L40 yeast strain as follows A 5 mL
overnight culture of L40 was grown and was used the next day to inoculate a 10 mL
culture at a starting OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they
were pelleted washed and resuspended in 1 mL of sterile ddH2O Per reaction 100 microL
of resuspended cells 20 microL of PCR amplified cassette and 300 microL of Transformation
Master Mix (see Appendix I) were combined and mixed well Reactions were then
incubated at 30degC with shaking for 30 minutes after which they were heat shocked at
42degC for 40 minutes The mixture was then pelleted and the cells were resuspended in 4
mL of YPAD and left at 30degC with shaking overnight The cultures were then pelleted
and the cells were resuspended in 09 NaCl and plated on YPAD-Nat or YPAD-G418
plates to select for the presence of the appropriate cassette Plates were incubated at 30degC
for 2-3 days
262 Verifying Deletion Mutants
Deletion mutants were verified by growth on medium containing the appropriate
antibiotic and via PCR on purified genomic DNA A phenolchloroformisoamyl
alcohol-based method was used to extract the genomic DNA as follows A 2 mL
overnight culture of each deletion mutant was grown Cells were pelleted and
29
resuspended in 200 microL of lysis buffer (2 Triton X-100 1 SDS 100 mM NaCl 10
mM Tris-Cl pH=80 1 mM EDTA ddH2O) To this 200 microL each of 05 mm glass beads
and phenolchloroformisoamyl alcohol (25241) were added and the reaction was
vigorously vortexed for 5 minutes The mixture was pelleted and the top layer
transferred to a new tube To this 100 microL of chloroform was added and the mixture was
vortexed for 30 seconds Again 150 microL of the top layer was transferred to a new tube
and 375 microL of 100 EtOH was added The reaction was incubated at -20degC for 30
minutes to allow DNA to precipitate This was then spun down at 14000 rpm for 5
minutes and the pellet was washed in 400 microL of 70 EtOH which was kept at -20degC
Once again this was spun down aspirated and allowed to dry at RT for 5 minutes The
DNA pellet was resuspended in 50 microL of elution buffer For PCR 1microL of this genomic
DNA and primers complimentary to the region outside of the bait genes were used along
with and internal primer for the Nat cassette Refer to Appendix II for primer sequences
and the TaqPfu PCR protocol
263 Verifying Pdr12-C(Y)T Function
To test whether the C(Y)T tag interfered with Pdr12p function as an efflux pump a
Sorbic Acid Stress Assay was performed Colonies of WT PDR12-C(Y)T pdr12Δkan
and pdr12Δnat cells were resuspended in 100 microL of sterile ddH2O (undiluted sample)
From this 3 10-fold serial dilutions were made and 3 microL of each dilution as well as the
undiluted sample were spotted out on YPAD medium and YPAD plates containing 3
mM Sorbic Acid Plates were incubated at 30degC for 2-3 days
264 Verifying Ste6-C(Y)T Function
In order to verify that the C(Y)T tag did not impair the ability of Ste6p to export the
mating pheromone a-factor out of the cell a Mating Assay was performed First a streak
30
of each of the reporter strains BY157 [MATa] and BY158 [MATα] was made vertically
on YPAD medium Intersecting each of these two streaks horizontally were the query
strains BY4743 (aα) BY4741 (a) BY4742 (α) STE6-C(Y)T and ste6Δnat The plate
was incubated at 30degC overnight The next day a thin layer of the intersection of the
reporter and query strains was replica plated on an SD Minimal medium plate and
incubated at 30degC overnight
27 The iMYTH Assay
271 Large Scale Transformation
A detailed protocol on how to perform the iMYTH assay has previously been published
(32 77) Both of the strains expressing the bait proteins Pdr12-CT and Ste6-CT were
transformed with each of the yeast cDNA and genomic DNA libraries using the standard
lithium acetate method (6) Briefly A 50 mL overnight culture of a bait strain was grown
and the next day used to inoculate a 200 mL culture at an OD600 = 015 Once cells
reached mid-log phase (OD600 = 06) they were divided into four 50 mL Falcon tubes
(per 200 mL of culture) pelleted washed in 40 mL of cold sterile ddH2O pelleted again
and resuspended in 1 mL of LiOacTE mix (1 M LiOAc 10X TE pH 75 sterile ddH2O)
This was then transferred to an eppendorf tube pelleted and resuspended in 600 microL of
LiOAcTE mix To each Falcon tube 10 microL of the appropriate library 600 microL of the
resuspended bait cells and 25 mL of Transformation Master Mix (see Appendix I) was
added This was vortexed and incubated in a 30degC waterbath for 45 minutes and mixed
every 15 minutes After incubation to each tube 160 microL of DMSO was added The
reactions were then mixed and heat shocked at 42degC for 20 minutes Cell were then
pelleted resuspended in 3 mL of 2X YPAD and pooled into one Falcon tube The cells
were allowed to recover in the 30degC shacking incubator for 90 minutes Cells were then
31
pelleted resuspended in 49 mL of 09 NaCl solution and plated onto SD-W medium
The plates were incubated at 30degC for 2-5 days
272 Patching and Recovering Putative Interactors
Colony patching was done using the QPix 2 XT robot (Genetix) First colonies of
transformed cells were picked and resuspended in 80 microL of liquid SD-W medium in a
384-well plate format These plates were then incubated at 30degC for 2 days following
which the robot patched the cells onto SD-WH + X-gal plates After two days at 30degC
blue colonies were picked and plated onto SD-W plates and were again grown for 2 days
at 30degC Colonies were then handpicked and placed into a sterile 96-well block
containing 125 mL of liquid SD-W in each well covered with a breathable foil and
grown for 2 days at 30degC with shaking Cells were then pelleted and resuspended in
Lysis Buffer (see Appendix I) and the plates were once again covered with breathable
foil and incubated for 2 hours at 37degC Prey plasmids containing putative interactor
proteins were then recovered from yeast using the Nucleospin Multi-96 Plus Plasmid
miniprep kit following the standard protocol (Macherey-Nagel Germany)
273 Amplification and Recovery of Prey Plasmid DNA
Highly competent XL10 Gold E coli cells were prepared according to the Inoue method
(78) and were used to amplify the prey plasmids obtained from yeast This protocol was
done in a 96-well format E coli cells stored in a 96-well PCR plate were thawed on
ice and to each well containing 100 microL of cells 10 microL of yeast miniprep DNA was
added The reactions were then incubated on ice for 20 minutes heat shocked for 45
seconds at 42degC and incubated on ice for 2 more minutes The reactions were then
transferred to a tube containing 900 microL of LB medium and allowed to recover at 37degC for
an hour Cells were then pelleted half of the supernatant was removed and the cells
32
were resuspended in the remaining half of the LB medium The cells were then plated
onto LB-Amp plates and grown overnight at 37degC The following day single colonies
from each transformation reaction were picked and placed into a sterile 96-well block
containing 12 mL of TB liquid medium (see Appendix I) plus 100 microgmL Ampicillin in
each well The block was incubated for two days at 37degC with shaking Cells were then
pelleted and the prey plasmids were recovered from the E coli using the Nucleospin
Multi-96 Plus Plasmid miniprep kit (Macherey-Nagel Germany) DNA was eluted in a
final volume of 75 microL
274 Prey Identification
Potential interactors were sequenced and identified via a BLAST search using sequence
data from the Saccharomyces Genome Database (SGD) The best hits in frame with the
tag were identified and accepted it if their expect value was no greater than 001
Ubiquitin components of the ribosome and short unidentifiable peptide sequences were
then removed as were any hits encoded in the mitochondria In addition functional
description and localization were used to assess the likelihood of potential candidates
being putative interactors
275 Bait Dependency Test
The bait dependency test was done in order to verify the specificity of the potential
interaction Recovered prey plasmids identified from the iMYTH screens were re-
transformed back into their respective bait strains from which they were originally
identified In parallel these same prey plasmids were transformed into a strain
containing an unrelated artificial bait a protein consisting of the human CD4
transmembrane domain fused to Cub and a MATα signal sequence to direct it to the
membrane The plasmids pOst1-NubG and pFur4-NubG were used as negative controls
33
while pOst1-NubI and pFur4-NubI were used as positive controls (see Appendix I)
Transformations were done in a 96-well plate format using the standard lithium acetate
method (6) A 5 mL overnight culture of each of the Pdr12-CT and Ste6-CT bait strains
as well as the artificial bait strain was grown and the next day used to inoculate a 75 mL
culture at an OD600 = 015 Once cells reached mid-log phase (OD600 = 06) they were
pelleted washed in 40 mL of cold sterile ddH2O pelleted again and resuspended in 375
mL of sterile ddH2O To each well 1microL of prey plasmid 40 microL of the appropriate
resuspended bait cells and 120 microL of transformation master mix (50 PEG 1M LiOAc
2 mgml ssDNA) was added This was mixed using a pipette The plate was then
incubated for 30 minutes at 30degC with shaking The cells were heat shocked at 42degC for
40 minutes pelleted and the supernatant was removed Cells were resuspended in 50 microL
of 09 NaCl and plated onto SD-W plates to select for the presence of the prey plasmid
Plates were incubated at 30degC for 2-4 days Three colonies for each transformation
reaction were picked and resuspended in 100 microL of sterile ddH2O 3 microL of resuspended
cells were plated onto SD-W plates to verify retention of the prey plasmid and ensure
comparable growth between spots and onto SD-WH + X-gal to select for the interaction
of bait and prey
28 Generation of Double Deletion Mutants
Double deletion mutants of Pdr12p and the identified interactors of this protein were
generated through mating and tetrad dissection Single deletions of the genes encoding
the Pdr12p interactors were obtained in the BY4741 [MATa] strain from the yeast
deletion collection (79) where the gene of interest is replaced with the KanMX cassette
These strains were then mated with the DDN1242 (pdr12Δnat) strain generated in this
study (as described in section 261) by intersecting the streaks of each strain on YPAD
34
plates After an overnight incubation at 30degC the intersecting cells were streaked out
onto YPAD + Nat + G418 plates to obtain single colonies with both Kanamycin and
Nourseothricin resistance which would be found in cells that have successfully mated
These plates were incubated at 30degC overnight and the next day a thin layer of cells from
a single colony was streaked out onto Sporulation medium plates These were left for 7-
10 days at RT to form tetrads Following sporulation a small amount of cells was picked
up with a sterile toothpick and placed in a tube containing 50 microL of zymolyase solution
(50 microgml zymolyase 1M sorbitol) to digest the spore ascus of the tetrads The cells
were incubated for 5 minutes at 30˚C after which cells were placed on ice and 800 microL of
sterile ddH2O was added to stop the reaction 20 microL of the cells were spread across a
YPAD plate and the tetrads were dissected with a dissecting microscope These plates
were incubated at 30˚C for 2-4 days After growth each one of the colonies was plated
onto a YPAD + G418 as well as a YPAD + Nat plate to determine which had both of the
drug selection markers Those that were verified as having both resistance cassettes were
genomic prepped (as described in section 262) and verified via PCR The double
deletion strains pdr12Δnat pdr5Δkan pdr12Δnat pdr10Δkan and pdr12Δnat
pdr11Δkan were also verified via sequencing Refer to Appendix II for primer
sequences and the Phusion Master Mix PCR protocol
29 Generating Full-length tagged Pdr5p Pdr10p and Pdr11p
291 Gap Repair Method
To generate full-length versions of the three other ABC transporters identified in the
Pdr12p screen gap repair cloning of the genes into the prey plasmid pPR3N was
performed First the genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified with
primers that have homology to the plasmid but will result in the exclusion of the NubG
35
module when recombined Refer to Appendix II for primer sequences and the Phusion
Master Mix PCR protocol For the digest of pPR3N 15 microL of plasmid 1 microl of the SfiI
enzyme (Fermentas) 5 microL of Buffer G and 29 microL of ddH2O were combined and
incubated at 50˚C for 3 hours The PCR product and digested plasmid were then
transformed into yeast as follows (80) A 5 mL overnight culture was grown to
saturation For each reaction 250 microL of cells were pelleted and the supernatant was
removed To each tube 80 microL of 50 PEG 10 microL of each of 1M DTT and 2M LiOAc
50 microL of ssDNA 25 microL of the PCR product and 5 microL of digested plasmid were added
This was briefly vortexed to mix and incubated at 45˚C for 30 minutes The reactions
were the vortexed for 1 minute at 10000 rpm the supernatant was removed and the cells
were resuspended in 100 microL of sterile ddH2O The entire volume was plated onto SD-W
plates and grown at 30˚C for 2-3 days A 5 mL overnight culture was grown and
plasmids were extracted using the EZ-10 Spin Column Plasmid DNA Kit (BioBasic) after
the yeast cells were vigorously vortexed with 200 microL of 05 mm glass beads for 10
minutes
292 Gateway Cloning
The genes encoding Pdr5p Pdr10p and Pdr11p were PCR amplified from yeast genomic
DNA using primers that would introduce flanking attB1 and attB2 sites These fragments
were then cloned into the pDONR223 plasmid (Invitrogen see Appendix I) using the BP
Clonase reaction (Invitrogen) following the procedure outlined by the manufacturer
This was then transformed into library efficiency DH5α competent E coli cells as
follows E coli cells were first thawed on ice then 100 microL of cells and 10 microL of the BP
reaction mix were combined The reactions were then incubated on ice for 20 minutes
heat shocked for 45 seconds at 42degC and incubated on ice for 2 more minutes The
36
reactions were then transferred to a tube containing 900 microL of SOC medium and allowed
to recover at 37degC for an hour Cells were then pelleted half of the supernatant was
removed and the cells were resuspended in the remaining half of the LB medium The
cells were then plated onto LB-Spectinomycin plates (see Appendix I) and grown
overnight at 37degC 5 mL overnight cultures of individual colonies were grown up at
37degC in LB-Spectinomycin medium and the plasmids were recovered using the the EZ-
10 Spin Column Plasmid DNA Kit (BioBasic) and standard protocol Each entry clone
was first verified by digestion with BsrGI (Frementas) and then sequenced to verify that
they contained the error free full-length sequence of the gene Once confirmed the LR
Clonase reaction (Invitrogen) was done to sub-clone the entry clones into the pYES-
DEST52 destination vector (see Appendix I) as described by the manufacturer This was
then transformed into E coli as described above and verified by digestion with BsrGI
Finally the pYES-DEST52 vector containing the full-length gene sequence was
transformed into the Pdr12-CYT yeast strain as described in section 291 (80)
210 Functional Assays for Pdr12p
2101 Spot Assays
Spot assays were done on WT single and double deletion strains to determine if any of
the identified interactors of Pdr12p had a role in acid anion efflux Single colonies were
resuspended in 100 microL of sterile ddH2O (undiluted sample) from which up to five 10-
fold serial dilutions were made Three microlitres of the last four dilutions were spotted
onto YPAD plates as well as YPAD plates containing either benzoic or sorbic acid at
concentrations ranging from 1 to 10 mM or the drugs artesunate bortezomib and
rapamycin at various working concentrations Plates were allowed to dry and were then
incubated at 30˚C for up to 7 days but were monitored daily
37
2102 Liquid Panelling Assay
Growth in liquid medium containing either sorbic or benzoic acid was monitored with the
GENios microplate reader (TECAN Switzerland) to evaluate the effect these compounds
had on the double deletion mutants A 96-well plate was divided into two allowing for
two replicates on the same plate Eight query strains consisting of WT single and
double deletions were placed in rows A-H while various concentrations of the sorbic or
benzoic acids were placed in columns 1 through 12 The first column only contained
YPAD Cells were inoculated in all wells at an initial OD600 = 006 and the plates were
then sealed with PE foil and placed in the reader for 200 reads (2 days) at 30˚C The
same approach was taken for the drug haloperidol The data was then graphed using
Microsoft Excel Refer to Appendix I for acid media preparation
2103 Co-Immunoprecipitating Interacting Proteins of Pdr12p
Yeast co-immunoprecipitations were done by modifying a previously published method
(81) as follows A 5 mL overnight culture of the bait strain transformed with the
appropriate prey-expressing plasmid was grown and the next day used to inoculate a
200 mL culture at OD600 = 0001 Cells were grown overnight to be at mid-log phase
(OD600 = 05-06) spun down and resuspended in 150 microL of ice-cold lysis buffer (50 mM
HEPES pH=75 100 mM NaCl 10 (vv) glycerol 1mM EDTA 100 mM PMSF 1 M
DTT 500 mM NaF 100 mM Na-o-vanadate 20 mgmL TLCK 10 mgmL aprotinin and
1 mgmL each of pepstatin A and leupeptin) and kept on ice To this 300 microL of cold 05
mm glass beads was added and the cells were lysed via vortex at 4˚C for 10 minutes
Using a 25G ⅝ needle a hole was made in the bottom of the tube and the lysate was
quickly spun into a new tube To this 300 microL of lysis buffer and 60 microL of detergent
(C12E8 or Triton-X 100) (1 final) was added The lysate was incubated at 4˚C on a
38
nutator for 2 hours After the incubation the samples were clarified by spinning for 15
minutes at 0˚C and 5000 x g 50 microL of the extract was saved as the total cell lysate
(TCL) fraction to which 50 microL of 2X SDS loading buffer was added The remaining
extract was immunoprecipitated with 8 microL of either anti-VP16 (Sigma Oakville ON) or
anti-HA (Santa Cruz Biotechnology Santa Cruz CA) antibody via a 2 hour incubation
on the nutator at 4˚C The samples were then clarified by spinning for 10 min at 0˚C and
5000 x g and transferred to a tube containing 30 microL of Protein G Sepharose beads pre-
washed in lysis buffer This was incubated for an hour on the nutator at 4˚C The beads
were then washed 5 times in 500 microl of lysis buffer by rotating 5 minutes on the nutator at
4˚C and spinning for 1 minute at 4˚C and 5000 x g The beads were then resuspended in
30 microL of 2X SDS loading buffer All samples were stored at -20˚C until ready for SDS-
PAGE analysis
2104 Western Blot Analysis
Proteins were resolved by SDS-PAGE on 8 gels for the bait and 15 gels for the prey
which were run at 110 V for 90 minutes (Bio Rad Mini-PROTEAN Tetra System) This
was transferred to a PVDF membrane which was activated in 100 methanol and rinsed
in ddH2O The transfer apparatus (Bio Rad Criterion Blotter) was run at 300 mA for 90
minutes The membranes were then blocked in 5 milk in 1X TBST (see Appendix I)
for 2 hours at RT washed 3 times for 5 minutes each in 1X TBST and incubated
overnight at 4˚C with rocking in primary antibody (11000) in 1 milk in 1X TBST
Pdr12-CT was detected with an anti-LexA (Santa Cruz Biotechnology Santa Cruz) (see
Appendix I) antibody and the various preys were detected with an anti-HA (Roche) anti
V5 (Invitrogen) or anti-His (Cell Signalling) antibody (see Appendix I) The following
morning membranes were washed 10 times for 5 minutes each in 1X TBST then
39
incubated with secondary antibody (14000) in 01 milk in 1X TBST for 1 hour at RT
with rocking For the bait and full-length prey anti-mouse IgG linked to horseradish
peroxide (GE Healthcare UK) was used as the secondary and anti-rat IgG linked to
horseradish peroxide (Cell Signalling) was used for the truncated preys (see Appendix I)
Membranes were again washed 10 times for 5 minutes each in 1X TBST then incubated
in 5 mL of SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) for 5
minutes with rocking The membrane was then placed between overhead sheets in a
cassette and the films HyBlot CL (Denville Scientific) and AmershamHyperfilm (GE
Healthcare) were developed at various time intervals The strains L40 Pdr12-CT not
transformed with the prey and lysis buffer with the antibody were used as controls
211 Extending Ste6p Duration at the Plasma Membrane
In an attempt to find better screening conditions for Ste6p the yeast mating pheromone
α-factor was used in an effort to accumulate and maintain the protein at the plasma
membrane A 5 mL overnight culture of WT Ste6-CYT and DDS0640 (sac6Δnat)
strain cells was grown in YPAD The next day it was used to inoculate another 5 mL
culture at an OD600 = 015 The cells were grown to an OD600 = 03-04 at which time
various concentrations of α factor were added to the medium and incubated at 30˚C for 1
hour All strains also had an untreated control Cells were pelleted washed with ddH2O
pelleted again and resuspended in 100 microL of ddH2O Two microlitres of resuspended
cells were spotted on a glass slide and covered with a cover slip Prior to viewing with
the YFP filter a drop of cedar wood immersion oil was spotted on the coverslip The
fluorescence was viewed at 503 nm for YFP using a fluorescence microscope
40
CHAPTER 3
RESULTS
41
31 Endogenously CT and CYT-tagged Bait Proteins Successfully Generated Saccharomyces cerevisiae L40 iMYTH reporter strains expressing endogenously CT and
CYT tagged ABC transporter baits were constructed prior to my start in the lab The CT
and CYT cassettes were amplified from the L2 and L3 plasmids respectively and
integrated downstream of and in frame with the PDR12 and STE6 genes via homologous
recombination PCR of genomic DNA and sequencing were used to verify the correct
tagging of the PDR12 and STE6 ORFs
32 CYT-tagged Integrated Bait Proteins Strains Localize Correctly
To verify that the tagged bait proteins localized properly within the cell CYT-tagged
baits were visualized via the yellow fluorescent protein (YFP) within the CYT tag using
fluorescence microscopy prior to my start in the lab Both Pdr12p and Ste6p are
reported to be localized to the plasma membrane (16 41) As can be seen in Fig 6A the
signal from the YFP of Pdr12-CYT is localized to the plasma membrane of the cell
indicating that the CYT tag does not impair the proper localization of this protein In the
case of Ste6-CYT the signal is diffuse throughout the vacuole (Fig 6B) most likely due
to the short half life this protein has at the plasma membrane and its rapid recycling
within the cell (41 43) However this does not indicate that the tagged protein is
improperly localized Both bait proteins appear to localize to their reported compartment
in the presence of the CYT tag and were further validated for functionality and
suitability in iMYTH screening (see below)
42
Figure 6 CYT-tagged bait protein localization The left of each panel is the YFP channel and the right
is the overlay with DIC A) Pdr12-CYT localizes to the plasma membrane B) Ste6-CYT signal is diffuse
within the vacuole which is consistent with previous reports of its rapid endocytosis Scale bar is 4 microm
Snider et al (unpublished data)
33 Tagged Bait Strains Pass NubGNubI Test
The purpose of this test it to verify the proper expression of the integrated bait proteins
once their proper sequence has been confirmed as well as to verify that they are not self-
activating which would result in false positives during iMYTH screening The
NubGNubI test was done prior to my start in the lab by transforming the bait proteins
with control plasmids Fur4-NubI and Fur4-NubG (refer to Appendix I Table 3 for
details) The results of this test indicated that both Pdr12-CT and Ste6-CT are expressed
and not self activating (Fig 7) This is evident by the ability of transformed bait strains
to grow on medium selective for interaction of bait and prey constructs (SD-WH) only in
the presence of the positive control plasmid Fur4-NubI which harbours the WT N-
terminus of ubiquitin which spontaneously interacts with the C-terminus of ubiquitin In
the presence of the Fur4-NubG plasmid which contains the mutated version of N-
terminal ubiquitin and as should not interact with the bait proteins there is no growth on
the selective medium Therefore based on the results obtained both integrated CT-
tagged Pdr12p and Ste6p were deemed suitable for use in iMYTH screening
43
Figure 7 NubGNubI test for integrated bait strains Control prey plasmids used to transform the CT-
tagged integrated bait strains are listed on the left Serial dilutions of transformed colonies were spotted on
to medium selective only for the presence of plasmid (SD-W) to indicate that the transformation was
successful and onto medium selective for interaction (SD-WH) to evaluate the interaction between the bait
and prey A) Pdr12-CT only interacts with Fur4-NubI on selective medium B) Ste6-CT only interacts
with Fur4-NubI on selective medium Growth of strains transformed with NubI controls but not NubG
controls indicates that the bait is being expressed and is not self activating Snider et al (unpublished
data)
34 Functional Analysis of Bait Proteins
341 Pdr12-CT Grows in the Presence of Sorbic Acid
In order to verify that the CT tag did not interfere with the function of Pdr12p as an efflux
pump spot assays on medium containing the commonly used food preservative sorbic
acid were done In the presence of sorbic acid both the WT and Pdr12-CT bait strains
have the same fitness while the deletion mutant strains DDK1240 (pdr12Δkan) and
DDN1240 (pdr12Δnat) are severely impaired in their ability to grow in the presence of
this weak acid (Fig 8) Therefore the CT tag does not affect the function of Pdr12p as
an acid anion efflux pump This assay also served to functionally verify the deletion
strains as the inability to grow on medium containing sorbic acid indicates the successful
deletion of PDR12
44
Figure 8 CT tag does not interfere with Pdr12p function Strains spotted out on to YPAD and YPAD
+ 3 mM sorbic acid medium are listed on the left and the dilution factors are shown above Two individual
colonies for DDK1240 (pdr12Δkan) and DDN1240 (pdr12Δnat) strains were used Pdr12-CT is able to
grow as well as the WT strain on the plate containing the weak acid while the deletion mutants are
compromised in their growth
342 Ste6-CT is Able to Mate
Since Ste6p is involved in the export of the mating pheromone a-factor and therefore
important in the mating of yeast cells a mating assay was performed to investigate what
effect if any the CT tag had on the process After mating on rich medium the cells were
plated onto SD minimal medium (see Appendix I) to examine growth as only cells that
have successfully mated would have the ability to grow on low nutrient medium This is
due to the stress induced by the lack of nutrients in the medium which favours the
formation of haploid spores that are well adapted for survival in unfavourable conditions
for prolonged periods of time and can only be produced by cells that have mated Both
mating control strains BY4741 and BY4742 successfully mated with the opposite
mating type of the reporter strains BY157 [MATa] and BY158 [MATα] as evidenced by
the presence of growth (Fig 9) Ste6-CT strain was also able to mate with the α reporter
strain while the ste6Δnat deletion strain was unable to grow like the diploid control
Therefore STE6 was successfully deleted as determined by the inability of the strain to
45
grow on minimal medium and the CT tag does not impair the export of a-factor out of
the cell as evidenced by growth indicative of mating
Figure 9 Evaluating Ste6-CT function with a mating assay Shown is the replica plate with the mated
intersection plated on SD minimal medium Reporter mating strains a and α were streaked in two columns
while the query strains listed on the left including the diploid and mating controls were streaked
horizontally The diploid by definition cannot mate while BY4741 and BY4742 are used as positive
mating controls Ste6-CT is able to mate while the ste6Δnat deletion strain as expected is not
35 iMYTH Screening Results
351 Large Scale Library Transformation
Both Pdr12-CT and Ste6-CT tagged integrated bait strains were transformed with NubG-
X cDNA (Dualsystems Biotech) and genomic DNA libraries to identify novel interactors
for each Screening was performed until sufficient coverage of each library was
obtained which was considered to be at least two million transformants given that the
complexity of each library is approximately one million clones After multiple rounds of
robotic based screening and selection putative interactors of interest were recovered and
identified via sequencing prior to being used in the bait dependency test The screening
results for Pdr12-CT and Ste6-CT are summarized in Table 1 below The putative
interactors used in the bait dependency test exclude redundant hits ubiquitin components
of the ribosome mitochondrially encoded proteins as well as short unidentifiable
peptides
46
Table 1 iMYTH Screening Results for Pdr12p and Ste6p
352 Bait Dependency Test
In order to determine which of the putative interactions identified through the large-scale
screen are specific the bait dependency test is performed All potential interactors and
control plasmids were transformed back into their respective bait strains as well as a
strain expressing an artificial bait protein This artificial bait is a synthetic construct
consisting of the human CD4 transmembrane domain fused to Cub and a MATα signal
sequence to direct it to the membrane It is used as the control as it is unrelated to the
bait proteins and is therefore useful for identifying preys which are spurious interactors
possibly binding to components of the CT tag itself or non-specifically to other parts of
the bait Three individual transformant colonies were then selected and plated onto non-
selective and selective media and evaluated for the presence of an interaction As can be
seen in Fig 10 A when transformed with the control plasmids carrying the NubI
constructs Pdr12-CT Ste6-CT and the artificial bait grow on both medium selective for
the presence of the prey plasmid (SD-W) and medium selective for interaction (SD-WH)
However when the NubG version is used growth is seen only on medium selective for
the presence of the prey plasmid as expected Any potential interactor that allows
growth on medium selective for interaction when transformed into the artificial bait
strain is scored as a false positive (Fig 10 B) Thus only interactors that allow growth
47
on medium selective for an interaction when transformed into the original bait strain are
counted as valid hits and used to generate the protein interactomes
Figure 10 An example of a bait dependency test Baits are listed along the top while control plasmids
and various preys are listed on the left side SD-WH + X-gal and SD-WH are media selective for an
interaction SM is used to denote either in panel B SD-W is selective for the presence of prey plasmid and
is used to verify the success of the transformation reaction and ensure comparable growth between spots
(A) Controls used for Pdr12-CT and Ste6-CT Both Pdr12-CT and Ste6-CT display absence of growth on
medium selective for an interaction when transformed with the NubG plasmids indicating they do not self
activate (B) Preys A B and C show false positive hits as in all cases there is growth on medium selective
for an interaction using the control artificial bait strain Preys D and E show an example of a validated hit
for each of Pdr12-CT and Ste6-CT respectively as in both cases there is only growth on medium selective
for an interaction when the prey is transformed into its respective bait
353 Pdr12p Interactome
After the completion of the bait dependency test using all 81 putative interactors detected
in the Pdr12-CT screen 13 were found to be specific These were partially categorized
by their localization according to their description on the Saccharomyces Genome
48
Database and according to gene ontology classification with respect to their biological
process (Fig 11) Notable interactions include three other members of the ABCG
subfamily Pdr5p residues 1150-1268 (EYRAVQSELDWMERELPKKGSITAAEDK
HEFSQSIIYQTKLVSIRLFQQYWRSPDYLWSKFILTIFNQLFIGFTFFKAGTSLQGL
QNQMLAVFMFTVIFNPILQQYLPSFVQQRDLYEA) Pdr10p residues 1206-1325
(REMQKELDWMERELPKRTEGSSNEEQKEFATSTLYQIKLVSYRLFHQYWRTPF
YLWSKFFSTIVSELFIGFTFFKANTSLQGLQNQMLAIFMFTVVFNPILQQYLPLFV
QQRELYEARER) and Pdr11p residues 326-517 (IQSPYYKHWKAITSKTVQECTRK
DVNPDDISPIFSIPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIP
LTTIGSFSRGSLTFFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLAT
NFFDCCSKFILVVIFTIILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTA)
Please see Appendix III for sequences of all protein found to interact with Pdr12p With
the exception of Gtt1p and Pdr5p whose fragments were found twice in the Pdr12p
screen all other interacting protein fragments were identified once
Pdr12p was also found to interact with fragments of two proteins involved in the
general stress response Sod1p and Zeo1p which are involved in oxidative stress and the
cell integrity pathway respectively and may have a role in the various processes evoked
in the presence of weak acid stress The interactions between Pdr12p and that of the
fragments of Pdr5p (38) and Pdr10p (82) have previously been reported indicating that
11 of the interactions identified with iMYTH are novel for this protein Of these four
proteins are of unknown function These proteins are also of interest as their roles and
function could be characterized in relation to their interaction with Pdr12p With the
exception of the interaction with Pdr5p the interaction data obtained in this study does
49
not overlap with that of the known interactors of Pdr12p identified by PCA by Tarrasov
et al (2008) This is not unusual between high-throughput large-scale studies as a small
overlap was found between two of the first comprehensive genome-wide analyses of PPIs
in yeast (59) A possible explanation for the low overlap observed is that iMYTH and
PCA are two very different techniques Since a library was used to screen for interactors
the entire genome may not have been covered and if it was it is possible that certain
valid interactions may have been excluded in the initial detection steps simply based on
size specifications fed to the robot In addition it should be noted that the interactions
detected with PCA also had low overlap with other genome-wide PPI screens (38)
Please refer to Appendix IV and VII for the results of the bait dependency tests on all
potential interactors and for a description of the proteins that interact with Pdr12p
respectively
Figure 11 Pdr12p Interactome Circles and diamonds represent proteins that interact with Pdr12p
Diamonds also indicate proteins found in the plasma membrane Each colour on the map corresponds to a
specific biological process based on gene ontology classification which can be found in the legend on the
left hand side
50
354 Ste6p Interactome
For Ste6p 16 potential interactors were subjected to the bait dependency test 14 of
which were identified as false positives The two remaining protein interactions with
fragments of Vps9p and a protein of unknown function Ygl081Wp are novel These
were also categorized by biological process according to gene ontology classification to
generate the interactome (Fig 12) Vps9p is a guanine nucleotide exchange factor that is
involved in the transport of vacuolar proteins (83) and may be involved in the shuttling
of Ste6p to and from the plasma membrane however further studies are needed to
investigate the exact nature of this interaction as well as the function of Ygl081Wp
Three independent fragments of Vps9p were present in the Ste6p screen while only one
fragment of Ygl081Wp was identified Please refer to Appendix V for the sequences of
Vps9p and Ygl081Wp Also see Appendix VI and VII for the bait dependency test
results using all potential interactors and for a description of the proteins that interact
with Ste6p respectively
Figure 12 Ste6p Interactome Circles represent proteins that interact with Ste6p Each colour on the
map corresponds to a specific biological process based on gene ontology classification which can be
found in the legend on the right hand side
36 Generation of Double Deletion mutants with pdr12Δnat
Analyzing the observed phenotype of a given double deletion mutant with or without the
presence of certain compounds allows for the study of genetic interactions If the
phenotype of a double deletion mutant has a combined effect not exhibited by either
mutation alone and which differs from that of the WT it suggests that the interacting
51
genes may have related functions Genetic interactions are generally identified as a result
of a second mutation enhancing or suppressing the original mutant phenotype With
respect to the present study if any of the proteins identified as interactors of Pdr12p are
involved in the weak acid stress response it is expected that the double deletion mutants
have phenotypes that differ from that of the pdr12Δ the respective single deletion and
WT strains More specifically if the double deletion mutant is shown to be more
sensitive or resistant to the presence of weak acids than is either single deletion mutant
and WT it may indicated that the interacting protein and Pdr12p have redundant
functions and compensate for one anotherrsquos absence Conversely if the double deletion
mutant phenotype is not worse than either of the single deletions it may indicate that the
two gene products are required for the same process and act in the same pathway or
complex
Double deletion mutants were generated by mating the DDN1242 (pdr12Δnat)
strain made in this study to a BY4741 strain containing a deleted ORF encoding for an
interacting protein which was either generated through PCR amplification and
homologous recombination or found within the yeast deletion collection (79) After
mating sporulation and tetrad dissection the potential double deletion mutants were
verified for the presence of the deletion cassette by growth on medium containing
antibiotics as well as with PCR Out of the possible 13 eight double deletion strains
were successfully generated (Table 2) One of the interacting proteins Tub2p is
essential and therefore could not be deleted while cassette amplification and integration
failure were reasons as to why Cos8p Ylr154C-Gp and Yml133Cp single deletion
mutants could not be generated It is possible that the primers used had secondary
52
structure that interfered with their binding to the DNA which would not yield an
amplified KanMX cassette with flanking regions of ORF homology Also the PCR
conditions and program may have been too stringent and therefore not ideal for the
amplification of resistance marker The ORF encoding Ylr154C-Gp is only 150 bp long
and though it was successfully amplified its small size most likely interfered with the
integration of the KanMX resistance cassette Though the mating and tetrad dissection
was repeated multiple times for the Pdr12p interactor Yck2p none of the spores could be
verified as double deletion mutants despite the fact that the PDR12 and YCK2 genes are
not linked It is possible that the tetrads dissected were not true tetrads but in fact four
cells clustered together and therefore would not have come from the same genetic
background which would explain the uncharacteristic segregation of resistance markers
These could have been the result of unintentional shaking during the digestion of the
ascus which would disrupt the original tetrad as without the ascus each individual spore
is easier to separate
Table 2 Summary of Double Deletion Strains
Deletion Strain Double Deletion Strain
Interactor Protein MATa MATα MATaα
Pdr10 pdr10Δkan pdr12Δnat pdr10Δkan pdr12Δnat
Pdr11 pdr11Δkan pdr12Δnat pdr11Δkan pdr12Δnat
Pdr5 pdr5Δkan pdr12Δnat pdr5Δkan pdr12Δnat
Gtt1 gtt1Δkan pdr12Δnat gtt1Δkan pdr12Δnat
Sod1 sod1Δkan pdr12Δnat sod1Δkan pdr12Δnat
Tma7 tma7Δkan pdr12Δnat tma7Δkan pdr12Δnat
Ybr056W ybr056wΔkan pdr12Δnat ybr056wΔkan pdr12Δnat
Zeo1 zeo1Δkan pdr12Δnat zeo1Δkan pdr12Δnat
Yck2 yck2Δkan pdr12Δnat Not a double deletion
Cos8 NA NA Cassette amplification failed
Tub2 NA NA Essential
Ylr154C-G NA NA Cassette integration failed
Yml133C NA NA Cassette amplification failed
53
37 pdr10Δkan pdr12Δnat Mutant Shows Resistance to Weak Acids
371 Spot Assays
All double deletion mutants generated were subjected to weak acid stress by growth on
solid medium containing increasing concentrations of the commonly used food
preservatives sorbic and benzoic acid in order to deduce if any of the interacting proteins
of Pdr12p also had a role in the cellular response to weak acid stress Out of eight
successfully generated double mutants only one showed an interesting phenotype The
pdr10Δkan pdr12Δnat mutant appears to confer resistance to weak acid stress as it is
able to grow on medium containing unusually high concentrations of the acids whereas
the WT and pdr12Δnat strains are significantly impaired in their ability to grow under
such conditions (Fig 13) The same phenotype is observed for the pdr10Δkan strain
which outgrows the WT These results imply that Pdr10p may have a role in the weak
acid stress response and given that Pdr12p and Pdr10p have been shown to interact
physically with iMYTH their physical interaction may be a mechanism by which they
mediate weak acid resistance Though it has recently been proposed that Pdr10p has a
role in the regulation of Pdr12p (82) the exact nature of this regulation is not clear and
detailed follow-up studies have yet to be performed
54
Figure 13 Weak acid stress assay Concentrations of acid are indicated along the bottom SA is sorbic
acid BA is benzoic acid and YPAD is rich medium Shown are increasing dilutions of cells with the strain
indicated by the legend in the top right hand corner WT indicates control strain As concentrations of both
SA and BA are increased the WT and pdr12Δnat strains lose their ability to grow However the
pdr10Δkan strain and the double deletion strain are able to grow on medium containing 7 mM of either
weak acid No growth is observed for any strain at 8 mM
372 TECAN Liquid Growth Assay
In order to further validate the spot assay results the GENios microplate reader (TECAN
Switzerland) was used to monitor the growth of control and double deletion strains in
YPAD liquid medium containing various concentrations of either sorbic or benzoic acid
Over the course of two days the robot measured and recorded the OD600 of the cells
every 15 minutes which was later graphed and analysed producing a growth curve for
each strain analysed This assay is generally more sensitive and produces numerical
reads as data which eliminates inconsistencies and bias that may occur when estimating
the relative amount of growth by eye As can be seen in Fig 14 as the concentration of
sorbic acid is increased the maximum OD600 the cells reach slowly decreases The
pdr12Δnat strain is unable to exit from the prolonged lag phase induced by the presence
of the weak acid when concentrations of 5 mM acid or greater are present in the medium
55
while the other strains though showing slightly increased lag phases are still able to
overcome the weak acid stress and grow at concentrations of 5 and 10 mM Though none
of the strains are able to overcome the 20 mM concentration of sorbic acid in the time
measured it is important to note that the strain with the shortest lag phase and highest
maximum OD600 throughout the experiment is the pdr10Δkan pdr12Δnat mutant In
addition the pdr10Δkan strain shows a mild resistance to the presence of sorbic acid in
the medium which is comparable to that of the WT strain This was rather unexpected as
the pdr10Δ strain outgrew the WT control in the presence of weak acids (Fig 13)
However with respect to the pdr10Δkan pdr12Δnat mutant the results are consistent
with the observations of the spot assays where the same double deletion mutant was able
to grow on medium containing sorbic acid where the WT strain was not and further
indicate a possible role for Pdr10p in the cellular response to weak acid stress This
result also further confirms a genetic interaction for these two proteins in addition to the
physical one elucidated by iMYTH however the mechanism of action and the role
Pdr10p may play in the weak acid response is still unclear and requires further
investigation
56
Figure 14 Sorbic acid liquid growth assay Concentrations of sorbic acid used are indicated in the top
left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is found in
the bottom most graph and shows the strains used The general trend observed is that the maximum OD600
obtained by each strain decreases as the concentration of sorbic acid increases which is not unexpected
The pdr12Δnat mutant strain is unable to grow past concentrations of 5 mM while all strains are trapped
in a prolonged lag phase at 20 mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at
every other concentration even the wildtype suggesting a role for Pdr10p in the weak acid response
When benzoic acid is used in the medium the same trends are observed (Fig 15)
The pdr12Δnat strain is once again in a prolonged lag phase by 5 mM and all strains
have reduced maximum OD600 values as the concentration of benzoic acid increases The
pdr10Δkan pdr12Δnat mutant once again has the highest tolerance for the presence of
this weak acid in the medium and therefore the highest cell density outgrowing the WT
strain In addition the pdr10Δkan strain once again exhibits a mild resistance to this
weak acid but still has growth comparable to that of the WT strain As observed with the
sorbic acid liquid assay no strain is able to overcome the high anion concentration
57
induced by 20 mM of benzoic acid In addition to being almost identical to the results
obtained with the sorbic acid liquid growth assay these results are also consistent with
those obtained from the spot assays with respect to the pdr10Δkan pdr12Δnat mutant
Given that the results of two very different techniques using two commonly employed
weak acid preservatives show that the pdr10Δkan pdr12Δnat mutant is able to grow at
unusually high weak acid concentrations Pdr10p likely plays some role in regulating the
weak acid stress response andor sensing cellular acid anion concentrations which may
affect the activity of Pdr12p andor other unidentified detoxification pumps
Figure 15 Benzoic acid liquid growth assay Concentrations of benzoic acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no benzoic acid The legend is
found in the bottom most graph and shows the strains used The maximum OD600 obtained by each strain
decreases as the concentration of benzoic acid increases as expected The pdr12Δnat mutant strain is
unable to grow past concentrations of 5 mM while all strains are trapped in a prolonged lag phase at 20
mM The pdr10Δkan pdr12Δnat mutant outgrows all other strains at every other concentration even the
wildtype suggesting a role for Pdr10p in the weak acid response
58
38 A Variety of Drugs Have no Affect on the Double Deletion Mutants
381 Spot Assays
Given that the iMYTH screen identified a fragment of Pdr5p as interacting with Pdr12p
a subset of drugs known to have an effect on pdr5Δ strains were chosen to test if Pdr12p
may also play a role in the transport of drugs out of the cell in addition to pumping out
weak acid anions All single and double deletion mutants generated were spotted onto
YPAD medium containing various concentrations of the drugs artesunate bortezomib
and rapamycin Artesunate is often used to treat Malaria in combination with other
drugs rapamycin is a serinethreonine kinase inhibitor used as an antibiotic and
immunosuppressant while bortezomib is a proteasome inhibitor used for treating
relapsed multiple myeloma and mantle cell lymphoma According to the Saccharomyces
Genome Database deletion mutants of PDR5 have reduced resistance to artesunate and
bortezomib but increased resistance to rapamycin Any variation in the previously
reported phenotypes was evaluated in the deletion mutants with an emphasis on the
pdr5Δkan pdr12Δnat and pdr10Δkan pdr12Δnat deletion strains When spotted
onto medium containing rapamycin the pdr5Δkan and pdr10Δkan strains appear to be
more sensitive than either the WT or the pdr12Δnat strains (Fig 16 B) The result for
both the strains is surprising given that the expected observation for the pdr5Δkan
strain was increased resistance and not sensitivity The fact that pdr10Δkan shows
sensitivity may imply a role in drug transport for this protein however further study is
needed to elucidate its function Neither the pdr5Δkan pdr12Δnat or pdr10Δkan
pdr12Δnat double deletion strains showed increased or decreased resistance to the drug
rapamycin Instead both deletion strains showed fitness comparable to the WT and the
pdr12Δnat strains indicating that the observed sensitivity of the pdr5Δ mutant is
59
dependent on the WT PDR12 gene When the drug artesunate is present in the medium
pdr5Δkan strain is sensitive as expected as is the pdr10Δkan strain (Fig 16 C) which
is consistent with what was observed for this strain in the presence of rapamycin further
indicating a possible role in drug transport for Pdr10p All other strains including the
double deletions are comparable in growth to WT in the presence of artesunate (Fig 16
C) Excluding the pdr5Δkan mutant which shows slight sensitivity no deviation from
WT is seen in any of the other strains when bortezomib is present in the medium (Fig 16
D) All results presented here were consistent between repetitions of this assay
Figure 16 Drug sensitivity assay The strains used in each row are indicated by the legend on the left
hand side WT indicates control strain Concentrations and drugs are indicated above each panel (A)
These vertically sectioned panels show the YPAD control plates for each of the rows The bottom panel
corresponds to the YPAD controls of panel D (B) The pdr5Δkan and pdr10Δkan deletion strains are
unexpectedly sensitive to various concentrations of rapamycin however the double delete in both cases
does not appear to be affected by the presence of the drug (C) When artesunate is present in the medium
as expected the pdr5Δkan is sensitive The results for the other strains are the same as observed in (B)
(D) Bortezomib has no effect on any of the strains tested
60
382 TECAN Liquid Growth Assay
According to the FitDB (84) the antipsychotic drug haloperidol has an effect on single
deletion mutants of PDR12 PDR5 PDR10 and PDR11 It was chosen for this reason to
test the effects if any it had on the double deletion mutants of these genes Drug
sensitivity of the double deletion strains and appropriate controls was assessed using the
GENios microplate reader (TECAN Switzerland) Strains were grown in YPAD liquid
medium containing increasing concentrations of the drug During the span of two days
the OD600 was automatically measured and recorded and this data was subsequently
graphed and analysed As can be seen in Fig 17 as the concentration of haloperidol
increases there is very little change in the growth curve of the strains when compared to
their growth in medium without the drug When concentrations of drug reach 500 uM
twice the concentration used in the FitDB screen the pdr5Δkan and pdr12Δnat strains
have a significantly increased lag time while all the other strains in addition to having a
slightly prolonged lag phase do not reach as high of an OD600 as seen with lower
concentrations of the drug However the double deletion strains of interest are
comparable in fitness to that of the wildtype strain
61
Figure 17 Haloperidol liquid panelling assay Concentrations of the drug haloperidol are indicated in
the top left hand corner of the graphs The legend indicating the strains is found along the top OD600
readings were taken every 15 minutes for a total of 200 reads or 50 hours The data was then plotted and
analysed Up to 250 uM there does not appear to be any effect of the drug on the growth of the strains
The double deletions remain unaffected at 500 uM while the pdr5Δkan and pdr12Δnat strains have a
prolonged lag phase
39 Increasing Ste6p Duration at the Plasma Membrane
391 Treatment with α-factor
Though the iMYTH screen for Ste6p had sufficient coverage for the library complexity a
relatively low number of potential interactors were identified which was further reduced
to only two actual hits after the bait dependency test Given that Ste6p has a very short
half-life it is possible that it does not exist at the plasma membrane in sufficient levels or
for sufficient duration under standard labarotory growth conditions to allow for the
detection of interactions with the iMYTH assay In order to improve the screening
results of Ste6p conditions that would prolong its stay at the PM and therefore the time
62
it has to interact with other proteins were sought after As the mating pheromone a-
factor exporter which becomes active during mating it was thought the presence of α-
factor might increase the duration and level of Ste6p at the membrane as this would
mimic mating conditions Cells of the Ste6-CYT and the WT strains were left untreated
or were treated with various concentrations of α-factor prior to viewing under the
fluorescence microscope As the concentration of α-factor increases the signal strength
of Ste6p also increases but becomes saturated at 050 microM of α-factor (Fig 18) Though
the signal is stronger implying more Ste6p is present it is completely vacuolar
indicating that it is still being rapidly recycled within the cell and still resides only
briefly at the membrane
Figure 18 Ste6-CYT treatment with α-factor Concentrations of α-factor used are indicated on the left
YFP is the yellow-fluorescent protein channel and Overlay is the YFP channel with DIC Cells were
treated with α-factor for half an hour before being viewed under the microscope As the concentration of α-
factor increases the signal strength of Ste6p increases saturating at 050 microM It is clear the protein is
found exclusively in the vacuole and not at the PM The L40 wildtype strain does not have a YFP tag and
therefore does not exhibit any fluorescence Scale bar is 4 microm
63
3102 Deletion of SAC6
Various methods have been employed to study the trafficking and degradation pathway
that Ste6p follows and this includes blocking the ubiquitination of the protein as well as
studying the effects endocytosis mutants have on Ste6p localization (43) Abolishing the
endocytosis step through the deletion of genes responsible for the process results in the
localization of Ste6p at the membrane When mutated both END4 and SAC6 result in
cells that have defective endocytosis (43) but unlike END4 SAC6 is a non-essential
gene and for this reason was chosen to be deleted in the Ste6-CYT strain This sac6Δ
mutant strain and the WT strain were either left untreated or treated with 050 microM α-
factor to investigate the localization of Ste6p There does not appear to be any difference
between treated and untreated deletion strain cells with respect to signal strength
however the signal does not appear to be clearly localized to one compartment (Fig 19)
In both the untreated and α-factor treated sac6Δ mutant cells there appears to be a subset
of cells exhibiting vacuolar signal and a subset exhibiting possible membrane signal
Unlike the uniform vacuolar signal obtained from treating the Ste6-CYT strain with α-
factor these results hint at an underlying issue such as tag cleavage or tag interference of
the endocytic pathway due to the deletion of SAC6 which may be impairing the proper
localization of this protein
64
Figure 19 Ste6-CYT sac6Δnat localization Strains are indicated on the left hand side while the
untreated and treated cells are shown along the top YFP is the yellow-fluorescent protein channel and
Overlay is the YFP channel with DIC Cells were treated with 050 microM α-factor for 30 minutes before
viewing under the microscope Signal strength between treated and untreated cells is comparable The
deletion mutants exhibit uneven localization as a population (bottom two rows) with cells displaying both
vacuolar (middle panels) and possible membrane (bottom panels) signal being observed Scale bar is 4 microm
65
CHAPTER 4
DISCUSSION
66
41 GO Analysis
Gene Ontology (GO) is used to analyze large data sets such as those obtained from high-
throughput studies for enrichment After the completion of the bait dependency test the
list of interactors obtained for Pdr12p was analyzed for possible enrichment of processes
functions andor common compartments While no significant enrichment was observed
it must be noted that the dataset is relatively small
42 Protein Interactions of Interest
421 iMYTH Identifies an Interaction Between Pdr12p and Pdr5p
The PDR5 gene encodes one of the best characterized ABC transporter proteins Pdr5p
This plasma membrane protein is a powerful pleiotropic drug pump whose
overexpression leads to resistance to cycloheximide and many other drugs (19) while
cells lacking the functional gene product exhibit hypersensitivity to many substrates (11)
This 160 kDa protein also shares similar mechanisms of substrate recognition and
transport with the human MDR1 P-glycoprotein (22) has a large pH tolerance (85) and is
one of the most abundant drug pumps in Saccharomyces cerevisiae (10) In addition to
being members of the same family Pdr5p and Pdr12p have the same reverse topology
consisting of two NBD and two MSD with the NBD preceding the MSD which differs
from the typical ABC transporter topology where the NBD follows the MSD
Mapping protein interaction networks allows for the understanding of the cellular
roles a protein may have as the biological function of a particular protein of interest may
be predicted through the function of an identified interacting partner(s) The
identification of the interaction between Pdr12p and a Pdr5p fragment raises some
interesting questions about the known functions of these two proteins Though Pdr5p has
been classified as a drug pump and numerous studies have demonstrated the broad range
67
of drug substrates it is able to identify and transport the protein may have a role in a
general stress response including weak acid induced stress or perhaps may be more
directly involved in the actual export of the acid anions from the cell as it has been show
with iMYTH to interact with the acid anion pump Pdr12p Conversely identified as a
weak acid anion pump Pdr12p may have an as of yet unknown function in drug
transport Four drugs previously reported to have an effect on Pdr5p were used to
investigate the possible drug transport role of Pdr12p by evaluating double deletion
mutants Though the results obtained here do not provide evidence of Pdr12p
involvement in drug transport (Fig 16 and Fig 17) it must be noted that the four
compounds used represent only a fraction of those known to be transported by Pdr5p In
addition Pdr12p only transports monocarboxylic acids with chain lengths of up to C7
(86) which could imply that any drug transport activity exhibited by this protein would
be more specific than that observed in Pdr5p Interestingly in a study presenting the first
three-dimensional reconstruction of Pdr5p it was reported that upon detergent removal
Pdr5p formed dimers possibly through an interaction between the first cytosolic loops of
two neighbouring Pdr5p molecules (22) This phenomenon has been proposed for other
ABC proteins as well (22) and though it may not be clear whether or not Pdr5p forms
dimers at this time the possibility of it doing so and perhaps forming heterodimers with
other proteins such as Pdr12p cannot be excluded However the biological significance
of this interaction and the means by which it occurs requires further investigation This
may include identifying specific regions of the proteins required for the interaction to
occur by using truncated or mutant forms of both bait and prey proteins as well as
68
biochemically measuring whether or not the rate of transport of certain substrates is
affected by the presence or lack thereof one of the interaction partners
422 iMYTH Identifies an Interaction Between Pdr12p and Pdr10p
Like Pdr12p Pdr10p is also a member of the ABCG subfamily of yeast ABC transporter
proteins and localizes to the membrane (11) This 1564 amino acid protein is a full-
length transporter regulated by Pdr1p and Pdr3p through cis-acting sites known as PDR
responsive elements (PDREs) (87) Since it is regulated by the same proteins as Pdr5p
and shares more than 65 primary sequence identity to Pdr5p (87) it is thought that
Pdr10p is also a drug pump however the substrates it transports and its actual function
within the cell remain largely unknown Deletion mutants of PDR10 were screened for
sensitivity with four drugs transported by Pdr5p Though the pdr10Δkan strain showed
increased sensitivity to rapamycin and artesunate when compared to WT (Fig 16) no
effect was caused by the drugs bortezomib or haloperidol both of which compromised
the growth of the pdr5Δkan strain (Fig 16 and Fig 17) There still remains a
possibility that Pdr10p is a drug pump like Pdr5p however data obtained in this study
also suggest a completely different role for the protein In addition to the potential role in
drug transport suggested by the drug sensitivity assays a potential role in response to
weak acid stress is also supported by the obtained data and may be the first
characterization of function for Pdr10p The involvement of Pdr10p in the weak acid
response is supported by the observation that cells deleted for both PDR12 and PDR10
exhibit an increased resistance as compared to the wildtype to weak acids such as
sorbic and benzoic (Fig 13 ndash Fig 15) substrates know to be transported by Pdr12p (11)
as well as the observation that Pdr10p is strongly induced by stress conditions (10) The
69
possible mechanisms of action in support of this interaction will be discussed in detail
below
423 iMYTH Identifies Pdr11p as a Novel Interactor of Pdr12p
Unesterified sterol is an essential component of all eukaryotic membranes as it affects
membrane fluidity as well as the activity and localization of many proteins (88) Under
conditions of aerobic growth sterol biosynthesis in yeast is compromised and therefore
sterol uptake is required for cell viability A close homolog of Pdr5p (19) Pdr11p has
been identified as an important mediator of sterol uptake (88) PDR11 encodes a 1411
amino acid full-length ABC transporter protein (11) believed to localize to the plasma
membrane Aside from the involvement in sterol uptake no other information about the
function or substrate specificity is available for Pdr11p The present study was unable to
provide further insight into the function of this protein Though both single and double
deletions of PDR11 were subjected to various conditions including weak acids (data not
shown) and the drug haloperidol (Fig 17) they did not exhibit a phenotype that varied at
all from the WT These results do not provide evidence of a possible role for Pdr11p in
weak acid anion or drug transport however it must be noted that numerous drugs exist
and only a small fraction of them have been examined in the present study and as such
firm conclusions cannot be drawn Given that Pdr12p was shown to interact with a
Pdr11p fragment Pdr12p may also be involved in the uptake of sterol from the external
environment and the two proteins may function together to carry out this process In
addition it is possible that both Pdr12p and Pdr11p have an unknown function that is not
related to either drug or weak acid transport It is clear that to resolve the mystery of
Pdr11p function and the nature of its interaction with Pdr12p further investigation is
needed
70
424 Vps9p is a Novel Interactor of Ste6p
Vps9p was identified through complementation studies of the vacuolar protein sorting
(vps) mutants that missort and secrete vacuolar hydrolases where it was shown to be a
guanine nucleotide exchange factor for the rab GTPase Vps21Rab5 (83 89) The
vacuole of Saccharomyces cerevisiae is an acidic organelle that contains large amounts of
degradative enzymes and is analogous to the lysosome found in animal cells (89)
Vesicle-mediated protein transport a process highly conserved from yeast to higher
eukaryotes and which involves complex cellular machinery plays an important role in
the localization of proteins to the yeast vacuole (83) However the underlying
mechanism involved in the transport of proteins to the vacuole and the vacuolar
membrane remains elusive (89) It has recently been shown that like several other
plasma membrane proteins Ste6p follows the general PURE pathway for its
internalization and that it is ultimately degraded in the vacuole however the trafficking
of the protein to the vacuole is poorly understood (41) It is possible that Ste6p has a
vacuolar targeting signal that is recognized by a vesicle receptor protein such as Pep12p
which would bind Ste6p and initiate its transport into the vacuole via a transport vesicle
Members of the rab GTPase family such as Vps21p are known to be found on transport
vesicles (89) and as such it is not unlikely that Vps9p may bind both the receptor
protein Pep12p bound to Ste6p and the GTPase Vps21p bridging their interaction
which could result in the fusion of the vesicle with Ste6p inside it The vesicle is then
brought to the vacuole where the protein is degraded It is clear that this process is highly
choreographed and may involve a large number of players many of which are still
unknown but the interaction between Ste6p and a fragment of Vps9p may be the starting
71
point in dissecting and gaining an understanding into one portion of a highly complex
signalling pathway
43 Poor Detection of Ste6p Interactions
Although sufficient coverage for the library complexity was obtained in the screens for
Ste6p upon evaluation of the sequenced prey proteins only a small number proved to
contain a potential protein of interest as opposed to a variety of spurious sequences such
as small peptides mitochondrially or ribosomally encoded proteins or empty prey
plasmids In an attempt to increase the number of potential interactors an additional set
of screens was performed However upon the completion of the bait dependency test
only two true interactors remained (Fig 12) It is unlikely that the poor detection of
interacting partners for this protein is due to the inability of the iMYTH assay to detect
these interactions rather it is the nature of Ste6p that complicates the detection of the
proteins it interacts with Ste6p resides only briefly at the membrane with an estimated
half life of 15 ndash 20 minutes and is rapidly recycled (41 43) which may lead to protein
levels at the PM that are too low for the detection of interactions using iMYTH In
addition as the mating pheromone a-factor transporter it is conceivable that Ste6p is
only expressed at higher levels during conditions that would require its localization at the
membrane such as mating between cells In order to find conditions that would stabilize
Ste6p at the membrane two options were explored First it was thought that the
presence of the mating pheromone α-factor would prolong Ste6p retention at the
membrane To this effect cells were treated with various concentrations of α-factor for a
period of time prior to viewing under the microscope Though a clear increase of signal
can be observed Ste6p remains localized to the vacuole indicating that its rate of
turnover was not affected by the presence of α-factor rather it served to induce the levels
72
of Ste6p present in the cell (Fig 18) It has been shown that any mutations that block the
efficient trafficking of Ste6p to the vacuole such as those that affect the secretory
pathway (sec1 sec6 and sec23) or endocytosis (end3 end4 and sac6) result in the
stabilization of Ste6p at the plasma membrane (43) Therefore a mutant with defective
endocytosis was generated to localize Ste6p to the membrane for an extended period of
time Deletion of the non-essential gene SAC6 in the Ste6-CYT strain did not produce
the expected results (Fig 19) YFP signal should only have been observed in the plasma
membrane of the cells viewed However there is still some vacuolar signal and though
there are cells that appear to have plasma membrane localization of Ste6p it could also
be vacuolar membrane localization as in this particular cell the vacuole is almost the
size of the whole cell If in fact the observed membrane localization is vacuolar
membrane it could be due to the ineffective or partial recycling of Ste6p in the sac6
deletion mutant where the disruption of the gene most likely affected parts of the
internalization and trafficking pathway It is also possible that the inconsistency of Ste6p
localization in the cells as a population is due to the cleavage of the CYT tag which
would explain the variant signal patterns observed Though the CYT tag has previously
been shown not to affect Ste6p function (Fig 9) and therefore its proper localization to
the plasma membrane it is possible that in the sac6 deletion strain the tag interferes with
the proper localization of the protein which could result in the strange pattern observed
Neither of the two options explored resulted in the stabilization of Ste6p at the plasma
membrane and as such additional screens were not performed
44 Putative Role for Pdr10p in the Weak Acid Response
The substrates Pdr10p transports remain largely elusive and while it is hypothesized to
be a drug pump the drug assays performed in this study do not support the theory as the
73
four drugs tested here aside from rapamycin and artesunate did not have a significant
effect on PDR10 deletion mutants when compared to WT (Fig 16 and Fig 17)
Surprisingly when testing the effects weak acid stress had on interactors of Pdr12p an
interesting phenotype for the pdr10Δkan pdr12Δnat mutant was observed It has been
shown in this study as well as others (24 34 36) that the deletion of PDR12 results in
cells that are hypersensitive to the presence of weak acids (Fig 8 and Fig 13 ndash 15) A
recently published study has also reported the resistance of their pdr10Δ strain to weak
acids (82) At times in our study the pdr10Δkan strain slightly outperforms the WT
with respect to growth as is evident in the spot assays however it typically performs at
the level of the WT strain when exposed to weak acid medium (Fig 13 ndash Fig 15) Based
on the results of the present work it is unlikely that the deletion of PDR10 results in
resistance to weak acids as no significant difference between the deletion and WT strains
can be observed in liquid growth assays Rockwell et al also concluded that Pdr10p
plays a role in maintaining the proper distribution and function of other membrane
proteins mainly Pdr12p and to perform this function Pdr10p requires Pdr5p Pdr12p and
Lem3p (82) Though not showing a physical interaction between Pdr10p and Pdr12p the
authors do suggest that these two proteins are involved in the weak acid stress response
and somehow work together Contrary to Rockwell et al upon the deletion of both
PDR12 and PDR10 in the same strain weak acid resistance is obtained (Fig 13 ndash Fig
15) further supporting the possibility of Pdr10p as having a role in the weak acid
response How these two proteins mediate weak acid response requires further
investigation but a possible mechanism of adaptation is the upregulation of another as of
yet unknown ABC transporter protein This has been shown to occur for the major drug
74
pumps Pdr5p Snq2p and Yor1p where an increase in resistance to Pdr5p specific
substrates was observed upon the deletion of YOR1 and SNQ2 Likewise the deletion of
PDR5 led to the increased resistance of Snq2p and Yor1p specific substrates (90) If in
fact the deletion of PDR12 and PDR10 results in the upregulation of another ABC
protein a likely candidate is Pdr15p In contrast to its closest homologue Pdr5p Pdr15p
is induced by general stress conditions such as starvation and low pH (10) the latter of
which would be caused by weak acids in the medium In fact it has been shown that
cells deleted for PDR15 exhibit resistance to sorbate (82) which could be the result of
Pdr12p upregulation further supporting the possibility of Pdr15p upregulation for the
acquired resistance in pdr10Δ pdr12Δ cells which is dependent on the deletion of
PDR10 In this model the deletion of PDR10 and PDR12 would initiate a cellular
response that would result in the upregulation of Pdr15p to compensate for the lack of
Pdr12p function resulting in resistance to weak acids Similarly the lack of PDR15
would result in the upregulation of Pdr12p which would be perceived as increased
resistance to weak acids It is possible that Pdr12p and Pdr15p have overlapping
functions with respect to coping with cell stress and therefore Pdr12p Pdr10p and
Pdr15p may function together to mediate weak acid resistance through a mechanism
similar to that of Pdr5p Snq2p and Yor1p upregulation
45 Lack of Expression of Prey Proteins
Co-Immunoprecipitation (Co-IP) experiments are frequently used to confirm and further
investigate PPIs identified through iMYTH The plasmids carrying the fragments of the
proteins Pdr5p Pdr10p and Pdr11p which were pulled out of library screens contained
an HA tag fused to the NubG for detection Though various antibodies concentrations
and conditions were tested the expression of a prey protein could not be detected (data
75
not show) It is possible that a single HA tag is not detectible regardless of the antibody
concentration used or perhaps it is not in a conformation that would allow accessibility
to the antibody A single HA tag has been previously used to show an interaction
between Ycf1p and Tus1p (32) however unlike the three prey proteins of interest in this
study that are plasma membrane bound Tus1p is a cytosolic protein which could
account for its detection with a single HA tag
To produce full-length versions of Pdr5p Pdr10p and Pdr11p gap repair was first
attempted A clone could not be generated as the proteins proved to be toxic as can
happen when membrane proteins are expressed in E coli (54) Gateway cloning was
attempted next however it proved to have limited success as a full-length Pdr5p was
generated though multiple attempts to acquire a clone for Pdr10p and Pdr11p were
unsuccessful The Gateway destination vector carries the V5 and 6XHis epitopes
believed to be easier to detect Once again though the expression of the bait protein
Pdr12p was confirmed the expression of the full-length prey Pdr5p could not be
detected
Considering that the expression of the tagged prey protein in either the truncated
or full-length form could not be detected Co-IP experiments were not done
46 iMYTH as a System for the Detection of PPIs
Large scale iMYTH screens were successfully used to identify novel interactors for the
plasma membrane proteins Pdr12p and Ste6p as well as to detect two previously reported
interactions of Pdr12p This system allows for the sensitive detection of both stable and
transient protein interactions and has successfully been used to explore interactions
between proteins from a variety of organisms using yeast as a host The selection of
putative interactor proteins within this system is a rigorous process that removes frequent
76
flier hits common to cDNA libraries as well as addresses the high false positive numbers
observed in other Y2H technologies This stringency is obtained with the bait
dependency test using an artificially made protein localized to the membrane Though
Pdr12p initially had 81 potential interactor proteins only 13 were identified as true
interactions upon the completion of the bait dependency test thereby removing a large
number of false positive hits The requirement of both growth and blue colour for a true
interaction is just another quality control step in this test In addition identified
interactions can easily be re-confirmed simply by transforming the identified prey back
into the bait strain The major advantages and disadvantages of iMYTH have been
discussed above and while it is an excellent system for the study of membrane proteins
in yeast the continued development and modifications of such systems will be key in
experimental research and could be applied in drug discovery elucidating signalling
pathways and studying viral and host protein interactions
77
CHAPTER 5
FUTURE DIRECTIONS AND CONCLUSIONS
78
51 Concluding Remarks and Future Directions
It was the goal of this study to investigate the interactome of the Saccharomyces
cerevisiae ABC transporter proteins Pdr12p and Ste6p in order to gain insight into their
biological relevance and function The iMYTH assay was used to identify 13 interactions
for Pdr12p two of which were previously reported and two novel interactions for Ste6p
The interactome of Pdr12p has three other ABC transporter proteins which are also
members of the ABCG subfamily as well as several uncharacterized ORFs
Notable identified interactions for Pdr12p include the plasma membrane proteins
Pdr11p Pdr10p and Pdr5p the latter of which is a major drug efflux pump All three of
those proteins have diverse roles ranging from sterol uptake in the case of Pdr11p to drug
transport for Pdr5p Though hypothesized to be a drug pump as well the functional
analyses which focused on the Pdr12p identified interactors indicate a possible role for
Pdr10p in the cellular weak acid response This is supported by the observed resistance
to weak acids in the medium when both PDR12 and PDR10 are deleted This could be
the first characterization of Pdr10p function as well as the potential substrates it may
transport In addition the possibility of Pdr12p and Pdr10p forming a heterodimer
cannot be dismissed as it was shown via iMYTH that these proteins physically interact
Through this physical interaction Pdr10p may regulate the activity of Pdr12p and
perhaps other as of yet unidentified cellular detoxification pumps Though an
interaction with Pdr5p was also identified the data presented here do not support a role
for Pdr12p in drug transport with respect to Pdr5p specific substrates The interaction
with Pdr11p requires further exploration as Pdr12p may have a possible role in sterol
uptake through its association with Pdr11p which would also be a novel role for the
weak acid efflux pump
79
In the case of Ste6p both interactions identified have not been previously
reported and given that one of these is a protein of uncharacterized function further
studies based on Ste6p function could provide insight into the function of Ygl081Wp
The interaction with Vps9p is both interesting and puzzling and while the nature of their
interaction remains elusive it may provide insight into the complex machinery of protein
shuttling and delivery to the vacuole for degradation In the case of Ste6p it was also an
aim to improve the yield of protein interactors identified through iMYTH screening and
to this end both α-factor and the deletion of SAC6 a gene involved in endocytosis were
methods employed in order to stabilize Ste6p at the plasma membrane However neither
method provided the expected result
Given the interesting interactors identified for Pdr12p specifically Pdr5p Pdr10p
and Pdr11p it is of great interest to investigate the nature of their interactions further
The confirmation and characterization of the identified PPIs is a logical first step As the
expression of the identified prey proteins could not be confirmed Co-IP experiments
could not be used to confirm the interaction of Pdr12p with each of Pdr5p Pdr10p and
Pdr11p Along the same lines all the other identified interactions can be further
confirmed in the same manner To show the relevance of an interaction between two
proteins it is useful to try and validate interactions using full-length proteins in the Co-IP
experiments keeping in mind the problems sometimes associated with masking of the
binding sites Though a full-length Pdr5p was successfully generated a clone could not
be obtained for Pdr10p and Pdr11p Therefore the generation of full-length proteins will
be an integral part of confirming these interactions
80
Pdr10p is largely uncharacterized with respect to function as are the substrates it
transports The fact that the pdr10Δ pdr12Δ deletion mutant exhibited resistance to high
concentrations of weak acids present in the medium is a puzzling yet interesting result
one which warrants further investigation Firstly conditions that would yield consistent
and repeatable results should be identified as there is an observed difference between the
performance of the pdr10Δ deletion mutant in the presence of weak acids when grown on
solid and in liquid media It would also be interesting to do co-localization experiments
with Pdr12p and Pdr10p to evaluate their proximity and determine whether or not the
two proteins form a heterodimer to export acid anions form the cell In addition the role
of Pdr15p in the weak acid response should be investigated If in fact this protein is
upregulated upon the deletion of PDR12 and PDR10 measuring the amount of mRNA
present in the cell with and without the weak acid stress would provide some insight into
whether or not this is the protein responsible for the observed resistance to weak acids It
would also be interesting to investigate the effects the deletion of PDR15 by itself or in
combination with PDR12 and PDR10 would have on the cells ability to adapt to the
presence of weak acids in the medium
Although the Pdr5p Pdr10p and Pdr11p identified as interactors of Pdr12p are
truncated forms of the proteins the region involved in the interaction can be further
narrowed down with mutant and further truncated versions of the proteins using the
identified sequence as a starting point In addition the region of Pdr12p required for the
interaction can be determined using the same methods As all of these proteins are
involved in the transport of substrates their interactions can be further investigated by
biochemically measuring the rate of transport The ATPase activity of each transporter
81
protein under different conditions with or without an interacting partner deleted can be
determined by using radioactively labelled substrates or fluorescent dyes
Further investigation is also required to identify the nature of the interaction
between Ste6p and Vps9p the latter of which may have a role in the shuttling of Ste6p to
the vacuole for degradation As mentioned above this process is complex and has many
branches and proteins involved therefore the first step in characterizing this interaction
would be mutational analyses It would be worthwhile to investigate the localization and
degradation of Ste6p in a VPS9 deletion background as well as in strains deleted for
other proteins involved in the same pathway as Vps9p
Given the low number of hits obtained for Ste6p it is clear that the standard
screening conditions of iMYTH need to be adjusted to improve the potential results for
this protein The deletion of SAC6 and the presence of α-factor did not result in the
stabilization of Ste6p at the plasma membrane Given that the screen for this a-factor
transporter yielded only two interactors it would be of interest to identify screening
conditions better suited for this protein andor strains that have Ste6p stabilized at the
membrane as they may lead to the discovery of other interactors of this protein A
possible mechanism would be to employ the use of the end4ts mutant strain identified
through random mutagenesis and shown to be defective in endocytosis (91) The region
containing the mutation could be PCR amplified and introduced into the Ste6-CYT strain
via homologous recombination and once all requirements for iMYTH have been met
this strain could be used to screen for additional interactors of Ste6p Conversely Ste6p
could be CT tagged in the end4ts mutant strain and used in screening
82
As a more general view at the next step creating double deletion mutants of all
the protein interactions identified in this study would allow for further characterization of
the nature of these interactions As well through mutational analysis and functional
assays such as drug or weak acid assays proteins of unknown function identified in the
Pdr12p screen could be characterized The same could be done for the uncharacterized
ORF identified in the Ste6p screen If certain ORFs prove to be essential or problematic
decreased abundance by mRNA perturbance (DaMP) alleles can be made By disrupting
the 3rsquo UTR of a gene either through the introduction of a resistance marker or deletion
these alleles provide a decreased yield of mRNA and therefore gene product In
addition more drugs should be tested in either spot assay or TECAN format to
investigate the possibility that Pdr12p has a role in drug transport like its interacting
protein Pdr5p
Give the prevalence of ABC transporter proteins across species and the fact that
their core domain is highly conserved it is clear that this family of proteins is of
significant importance As such they have been the focus of study for many years which
collectively has yielded a vast amount of knowledge about these proteins and their
function However there is still a substantial amount that can be learned about the
proteins they interact with through which domains this interaction occurs and for some
their function By employing the iMYTH assay in the search for interacting proteins of
yeast ABC transporters a subset of unique interactions for Pdr12p and Ste6p have been
discovered which in combination with functional studies will lead to further
understanding of their biological function In addition through the study of yeast
proteins knowledge and insight can be gained into the function of mammalian
83
homologues which will aid in the further understanding of ABC transporter related
diseases and the discovery of new therapeutics for their treatment
84
REFERENCES
1 Rees D C Johnson E and Lewinson O (2009) ABC transporters the power
to change Nat Rev Mol Cell Biol 10 218-227
2 Higgins C F (1992) ABC transporters from microorganisms to man Annu Rev
Cell Biol 8 67-113
3 Jungwirth H and Kuchler K (2006) Yeast ABC transporters-- a tale of sex
stress drugs and aging FEBS Lett 580 1131-1138
4 Schmitt L and Tampe R (2002) Structure and mechanism of ABC transporters
Curr Opin Struct Biol 12 754-760
5 Paumi C M Chuk M Snider J Stagljar I and Michaelis S (2009) ABC
transporters in Saccharomyces cerevisiae and their interactors new technology
advances the biology of the ABCC (MRP) subfamily Microbiol Mol Biol Rev 73
577-593
6 Gietz R D and Woods R A (2002) Transformation of yeast by lithium
acetatesingle-stranded carrier DNApolyethylene glycol method Methods
Enzymol 350 87-96
7 Stagljar I and Fields S (2002) Analysis of membrane protein interactions using
yeast-based technologies Trends Biochem Sci 27 559-563
8 Decottignies A and Goffeau A (1997) Complete inventory of the yeast ABC
proteins Nat Genet 15 137-145
9 Casal M Paiva S Queiros O and Soares-Silva I (2008) Transport of
carboxylic acids in yeasts FEMS Microbiol Rev 32 974-994
10 Ernst R Klemm R Schmitt L and Kuchler K (2005) Yeast ATP-binding
cassette transporters cellular cleaning pumps Methods Enzymol 400 460-484
11 Bauer B E Wolfger H and Kuchler K (1999) Inventory and function of yeast
ABC proteins about sex stress pleiotropic drug and heavy metal resistance
Biochim Biophys Acta 1461 217-236
12 Tarr P T Tarling E J Bojanic D D Edwards P A and Baldan A (2009)
Emerging new paradigms for ABCG transporters Biochim Biophys Acta 1791
584-593
13 Schmitz G Langmann T and Heimerl S (2001) Role of ABCG1 and other
ABCG family members in lipid metabolism J Lipid Res 42 1513-1520
14 Kusuhara H and Sugiyama Y (2007) ATP-binding cassette subfamily G
(ABCG family) Pflugers Arch 453 735-744
15 Miyahara K Mizunuma M Hirata D Tsuchiya E and Miyakawa T (1996)
The involvement of the Saccharomyces cerevisiae multidrug resistance
transporters Pdr5p and Snq2p in cation resistance FEBS Lett 399 317-320
16 Hatzixanthis K Mollapour M Seymour I Bauer B E Krapf G Schuller
C Kuchler K and Piper P W (2003) Moderately lipophilic carboxylate
compounds are the selective inducers of the Saccharomyces cerevisiae Pdr12p
ATP-binding cassette transporter Yeast 20 575-585
17 Balzi E Wang M Leterme S Van Dyck L and Goffeau A (1994) PDR5 a
novel yeast multidrug resistance conferring transporter controlled by the
transcription regulator PDR1 J Biol Chem 269 2206-2214
85
18 Golin J Ambudkar S V and May L (2007) The yeast Pdr5p multidrug
transporter how does it recognize so many substrates Biochem Biophys Res
Commun 356 1-5
19 Rogers B Decottignies A Kolaczkowski M Carvajal E Balzi E and
Goffeau A (2001) The pleitropic drug ABC transporters from Saccharomyces
cerevisiae J Mol Microbiol Biotechnol 3 207-214
20 Bartosiewicz D and Krasowska A (2009) Inhibitors of ABC transporters and
biophysical methods to study their activity Z Naturforsch C 64 454-458
21 Akache B MacPherson S Sylvain M A and Turcotte B (2004) Complex
interplay among regulators of drug resistance genes in Saccharomyces cerevisiae
J Biol Chem 279 27855-27860
22 Ferreira-Pereira A Marco S Decottignies A Nader J Goffeau A and
Rigaud J L (2003) Three-dimensional reconstruction of the Saccharomyces
cerevisiae multidrug resistance protein Pdr5p J Biol Chem 278 11995-11999
23 Ernst R Kueppers P Stindt J Kuchler K and Schmitt L (2009) Multidrug
efflux pumps Substrate selection in ATP-binding cassette multidrug efflux
pumps - first come first served FEBS J
24 Piper P Mahe Y Thompson S Pandjaitan R Holyoak C Egner R
Muhlbauer M Coote P and Kuchler K (1998) The pdr12 ABC transporter is
required for the development of weak organic acid resistance in yeast EMBO J
17 4257-4265
25 Chloupkova M Reaves S K LeBard L M and Koeller D M (2004) The
mitochondrial ABC transporter Atm1p functions as a homodimer FEBS Lett 569
65-69
26 Kispal G Csere P Prohl C and Lill R (1999) The mitochondrial proteins
Atm1p and Nfs1p are essential for biogenesis of cytosolic FeS proteins EMBO J
18 3981-3989
27 Young L Leonhard K Tatsuta T Trowsdale J and Langer T (2001) Role
of the ABC transporter Mdl1 in peptide export from mitochondria Science 291
2135-2138
28 Chloupkova M LeBard L S and Koeller D M (2003) MDL1 is a high copy
suppressor of ATM1 evidence for a role in resistance to oxidative stress J Mol
Biol 331 155-165
29 Dean M Allikmets R Gerrard B Stewart C Kistler A Shafer B
Michaelis S and Strathern J (1994) Mapping and sequencing of two yeast
genes belonging to the ATP-binding cassette superfamily Yeast 10 377-383
30 Haimeur A Conseil G Deeley R G and Cole S P (2004) The MRP-related
and BCRPABCG2 multidrug resistance proteins biology substrate specificity
and regulation Curr Drug Metab 5 21-53
31 Mason D L and Michaelis S (2002) Requirement of the N-terminal extension
for vacuolar trafficking and transport activity of yeast Ycf1p an ATP-binding
cassette transporter Mol Biol Cell 13 4443-4455
32 Paumi C M Menendez J Arnoldo A Engels K Iyer K R Thaminy S
Georgiev O Barral Y Michaelis S and Stagljar I (2007) Mapping protein-
protein interactions for the yeast ABC transporter Ycf1p by integrated split-
ubiquitin membrane yeast two-hybrid analysis Mol Cell 26 15-25
86
33 Cui Z Hirata D Tsuchiya E Osada H and Miyakawa T (1996) The
multidrug resistance-associated protein (MRP) subfamily (Yrs1Yor1) of
Saccharomyces cerevisiae is important for the tolerance to a broad range of
organic anions J Biol Chem 271 14712-14716
34 Schuller C Mamnun Y M Mollapour M Krapf G Schuster M Bauer B
E Piper P W and Kuchler K (2004) Global phenotypic analysis and
transcriptional profiling defines the weak acid stress response regulon in
Saccharomyces cerevisiae Mol Biol Cell 15 706-720
35 Holyoak C D Bracey D Piper P W Kuchler K and Coote P J (1999) The
Saccharomyces cerevisiae weak-acid-inducible ABC transporter Pdr12 transports
fluorescein and preservative anions from the cytosol by an energy-dependent
mechanism J Bacteriol 181 4644-4652
36 Gregori C Bauer B Schwartz C Kren A Schuller C and Kuchler K
(2007) A genetic screen identifies mutations in the yeast WAR1 gene linking
transcription factor phosphorylation to weak-acid stress adaptation FEBS J 274
3094-3107
37 Papadimitriou M N Resende C Kuchler K and Brul S (2007) High Pdr12
levels in spoilage yeast (Saccharomyces cerevisiae) correlate directly with sorbic
acid levels in the culture medium but are not sufficient to provide cells with
acquired resistance to the food preservative Int J Food Microbiol 113 173-179
38 Tarassov K Messier V Landry C R Radinovic S Serna Molina M M
Shames I Malitskaya Y Vogel J Bussey H and Michnick S W (2008) An
in vivo map of the yeast protein interactome Science 320 1465-1470
39 Ketchum C J Schmidt W K Rajendrakumar G V Michaelis S and
Maloney P C (2001) The yeast a-factor transporter Ste6p a member of the ABC
superfamily couples ATP hydrolysis to pheromone export J Biol Chem 276
29007-29011
40 McGrath J P and Varshavsky A (1989) The yeast STE6 gene encodes a
homologue of the mammalian multidrug resistance P-glycoprotein Nature 340
400-404
41 Kelm K B Huyer G Huang J C and Michaelis S (2004) The internalization
of yeast Ste6p follows an ordered series of events involving phosphorylation
ubiquitination recognition and endocytosis Traffic 5 165-180
42 Loayza D Tam A Schmidt W K and Michaelis S (1998) Ste6p mutants
defective in exit from the endoplasmic reticulum (ER) reveal aspects of an ER
quality control pathway in Saccharomyces cerevisiae Mol Biol Cell 9 2767-
2784
43 Loayza D and Michaelis S (1998) Role for the ubiquitin-proteasome system in
the vacuolar degradation of Ste6p the a-factor transporter in Saccharomyces
cerevisiae Mol Cell Biol 18 779-789
44 Kuchler K Sterne R E and Thorner J (1989) Saccharomyces cerevisiae STE6
gene product a novel pathway for protein export in eukaryotic cells EMBO J 8
3973-3984
45 Teem J L Berger H A Ostedgaard L S Rich D P Tsui L C and Welsh
M J (1993) Identification of revertants for the cystic fibrosis delta F508 mutation
using STE6-CFTR chimeras in yeast Cell 73 335-346
87
46 Elion E A (2000) Pheromone response mating and cell biology Curr Opin
Microbiol 3 573-581
47 Yu R C Pesce C G Colman-Lerner A Lok L Pincus D Serra E Holl
M Benjamin K Gordon A and Brent R (2008) Negative feedback that
improves information transmission in yeast signalling Nature 456 755
48 Metzger M B and Michaelis S (2009) Analysis of quality control substrates in
distinct cellular compartments reveals a unique role for Rpn4p in tolerating
misfolded membrane proteins Mol Biol Cell 20 1006-1019
49 Fromont-Racine M Mayes A E Brunet-Simon A Rain J C Colley A
Dix I Decourty L Joly N Ricard F Beggs J D and Legrain P (2000)
Genome-wide protein interaction screens reveal functional networks involving
Sm-like proteins Yeast 17 95-110
50 Miller J P Lo R S Ben-Hur A Desmarais C Stagljar I Noble W S and
Fields S (2005) Large-scale identification of yeast integral membrane protein
interactions Proc Natl Acad Sci U S A 102 12123-12128
51 Adle D J Wei W Smith N Bies J J and Lee J (2009) Cadmium-mediated
rescue from ER-associated degradation induces expression of its exporter Proc
Natl Acad Sci U S A 106 10189-10194
52 Berkower C Taglicht D and Michaelis S (1996) Functional and physical
interactions between partial molecules of STE6 a yeast ATP-binding cassette
protein J Biol Chem 271 22983-22989
53 Suter B Kittanakom S and Stagljar I (2008) Two-hybrid technologies in
proteomics research Curr Opin Biotechnol 19 316-323
54 Lalonde S Ehrhardt D W Loque D Chen J Rhee S Y and Frommer W
B (2008) Molecular and cellular approaches for the detection of protein-protein
interactions latest techniques and current limitations The Plant Journal 53 610-
635
55 Fields S and Song O (1989) A novel genetic system to detect protein-protein
interactions Nature 340 245-246
56 Fields S (2009) Interactive learning lessons from two hybrids over two decades
Proteomics 9 5209-5213
57 Koegl M and Uetz P (2007) Improving yeast two-hybrid screening systems
Brief Funct Genomic Proteomic 6 302-312
58 Auerbach D Thaminy S Hottiger M O and Stagljar I (2002) The post-
genomic era of interactive proteomics facts and perspectives Proteomics 2 611-
623
59 Ito T Chiba T Ozawa R Yoshida M Hattori M and Sakaki Y (2001) A
comprehensive two-hybrid analysis to explore the yeast protein interactome Proc
Natl Acad Sci U S A 98 4569-4574
60 Uetz P Giot L Cagney G Mansfield T A Judson R S Knight J R
Lockshon D Narayan V Srinivasan M Pochart P Qureshi-Emili A Li Y
Godwin B Conover D Kalbfleisch T Vijayadamodar G Yang M
Johnston M Fields S and Rothberg J M (2000) A comprehensive analysis of
protein-protein interactions in Saccharomyces cerevisiae Nature 403 623-627
61 Lievens S Lemmens I and Tavernier J (2009) Mammalian two-hybrids come
of age Trends Biochem Sci 34 579-588
88
62 Stagljar I Korostensky C Johnsson N and te Heesen S (1998) A genetic
system based on split-ubiquitin for the analysis of interactions between membrane
proteins in vivo Proc Natl Acad Sci U S A 95 5187-5192
63 Glickman M H and Ciechanover A (2002) The ubiquitin-proteasome
proteolytic pathway destruction for the sake of construction Physiol Rev 82 373-
428
64 Hershko A and Ciechanover A (1992) The ubiquitin system for protein
degradation Annu Rev Biochem 61 761-807
65 Verma R Oania R Graumann J and Deshaies R J (2004) Multiubiquitin
chain receptors define a layer of substrate selectivity in the ubiquitin-proteasome
system Cell 118 99-110
66 Johnsson N and Varshavsky A (1994) Split ubiquitin as a sensor of protein
interactions in vivo Proc Natl Acad Sci U S A 91 10340-10344
67 Iyer K Burkle L Auerbach D Thaminy S Dinkel M Engels K and
Stagljar I (2005) Utilizing the split-ubiquitin membrane yeast two-hybrid system
to identify protein-protein interactions of integral membrane proteins Sci STKE
2005 pl3
68 Paumi C M Chuk M Chevelev I Stagljar I and Michaelis S (2008)
Negative regulation of the yeast ABC transporter Ycf1p by phosphorylation
within its N-terminal extension J Biol Chem 283 27079-27088
69 Thaminy S Auerbach D Arnoldo A and Stagljar I (2003) Identification of
novel ErbB3-interacting factors using the split-ubiquitin membrane yeast two-
hybrid system Genome Res 13 1744-1753
70 Fetchko M and Stagljar I (2004) Application of the split-ubiquitin membrane
yeast two-hybrid system to investigate membrane protein interactions Methods
32 349-362
71 Condamine T Le Texier L Howie D Lavault A Hill M Halary F
Cobbold S Waldmann H Cuturi M C and Chiffoleau E (2010) Tmem176B
and Tmem176A are associated with the immature state of dendritic cells J
Leukoc Biol 1-9
72 Regan J A and Laimins L A (2008) Bap31 is a novel target of the human
papillomavirus E5 protein J Virol 82 10042-10051
73 Ferrandiz-Huertas C Fernandez-Carvajal A and Ferrer-Montiel A (2010)
RAB4 interacts with the human P-glycoprotein and modulates its surface
expression in multidrug resistant K562 cells Int J Cancer
74 Gisler S M Kittanakom S Fuster D Wong V Bertic M Radanovic T
Hall R A Murer H Biber J Markovich D Moe O W and Stagljar I
(2008) Monitoring protein-protein interactions between the mammalian integral
membrane transporters and PDZ-interacting partners using a modified split-
ubiquitin membrane yeast two-hybrid system Mol Cell Proteomics 7 1362-1377
75 Scheper W Thaminy S Kais S Stagljar I and Romisch K (2003)
Coordination of N-glycosylation and protein translocation across the endoplasmic
reticulum membrane by Sss1 protein J Biol Chem 278 37998-38003
76 Deribe Y L Wild P Chandrashaker A Curak J Schmidt M H
Kalaidzidis Y Milutinovic N Kratchmarova I Buerkle L Fetchko M J
Schmidt P Kittanakom S Brown K R Jurisica I Blagoev B Zerial M
89
Stagljar I and Dikic I (2009) Regulation of epidermal growth factor receptor
trafficking by lysine deacetylase HDAC6 Sci Signal 2 ra84
77 Kittanakom S Chuk M Wong V Snider J Edmonds D Lydakis A
Zhang Z Auerbach D and Stagljar I (2009) Analysis of Membrane Protein
Complexes Using the Split-Ubiquitin Membrane Yeast Two-Hybrid (MYTH)
System in Yeast Functional Genomics and Proteomics Methods and Protocols
(Stagljar I Ed) p 247 Humana Press New York
78 Inoue H Nojima H and Okayama H (1990) High efficiency transformation of
Escherichia coli with plasmids Gene 96 23-28
79 Winzeler E A Shoemaker D D Astromoff A Liang H Anderson K
Andre B Bangham R Benito R Boeke J D Bussey H Chu A M
Connelly C Davis K Dietrich F Dow S W El Bakkoury M Foury F
Friend S H Gentalen E Giaever G Hegemann J H Jones T Laub M
Liao H Liebundguth N Lockhart D J Lucau-Danila A Lussier M
MRabet N Menard P Mittmann M Pai C Rebischung C Revuelta J L
Riles L Roberts C J Ross-MacDonald P Scherens B Snyder M Sookhai-
Mahadeo S Storms R K Veronneau S Voet M Volckaert G Ward T R
Wysocki R Yen G S Yu K Zimmermann K Philippsen P Johnston M
and Davis R W (1999) Functional characterization of the S cerevisiae genome
by gene deletion and parallel analysis Science 285 901-906
80 Chen D C Yang B C and Kuo T T (1992) One-step transformation of yeast
in stationary phase Curr Genet 21 83-84
81 Shimomura T Ando S Matsumoto K and Sugimoto K (1998) Functional
and physical interaction between Rad24 and Rfc5 in the yeast checkpoint
pathways Mol Cell Biol 18 5485-5491
82 Rockwell N C Wolfger H Kuchler K and Thorner J (2009) ABC
transporter Pdr10 regulates the membrane microenvironment of Pdr12 in
Saccharomyces cerevisiae J Membr Biol 229 27-52
83 Hama H Tall G G and Horazdovsky B F (1999) Vps9p is a guanine
nucleotide exchange factor involved in vesicle-mediated vacuolar protein
transport J Biol Chem 274 15284-15291
84 Hillenmeyer M E Fung E Wildenhain J Pierce S E Hoon S Lee W
Proctor M St Onge R P Tyers M Koller D Altman R B Davis R W
Nislow C and Giaever G (2008) The chemical genomic portrait of yeast
uncovering a phenotype for all genes Science 320 362-365
85 Balzi E and Goffeau A (1995) Yeast multidrug resistance the PDR network J
Bioenerg Biomembr 27 71-76
86 Gregori C Schuller C Frohner I E Ammerer G and Kuchler K (2008)
Weak organic acids trigger conformational changes of the yeast transcription
factor War1 in vivo to elicit stress adaptation J Biol Chem 283 25752-25764
87 Wolfger H Mahe Y Parle-McDermott A Delahodde A and Kuchler K
(1997) The yeast ATP binding cassette (ABC) protein genes PDR10 and PDR15
are novel targets for the Pdr1 and Pdr3 transcriptional regulators FEBS Lett 418
269-274
88 Wilcox L J Balderes D A Wharton B Tinkelenberg A H Rao G and
Sturley S L (2002) Transcriptional profiling identifies two members of the ATP-
90
binding cassette transporter superfamily required for sterol uptake in yeast J Biol
Chem 277 32466-32472
89 Burd C G Mustol P A Schu P V and Emr S D (1996) A yeast protein
related to a mammalian Ras-binding protein Vps9p is required for localization of
vacuolar proteins Mol Cell Biol 16 2369-2377
90 Kolaczkowska A Kolaczkowski M Goffeau A and Moye-Rowley W S
(2008) Compensatory activation of the multidrug transporters Pdr5p Snq2p and
Yor1p by Pdr1p in Saccharomyces cerevisiae FEBS Lett 582 977-983
91 Raths S Rohrer J Crausaz F and Riezman H (1993) end3 and end4 two
mutants defective in receptor-mediated and fluid-phase endocytosis in
Saccharomyces cerevisiae J Cell Biol 120 55-65
92 Vojtek A B Hollenberg S M and Cooper J A (1993) Mammalian Ras
interacts directly with the serinethreonine kinase Raf Cell 74 205-214
93 Kelly D E Lamb D C and Kelly S L (2001) Genome-wide generation of
yeast gene deletion strains Comp Funct Genomics 2 236-242
94 Brachmann C B Davies A Cost G J Caputo E Li J Hieter P and
Boeke J D (1998) Designer deletion strains derived from Saccharomyces
cerevisiae S288C a useful set of strains and plasmids for PCR-mediated gene
disruption and other applications Yeast 14 115-132
91
APPENDIX
92
Appendix I ndash Yeast Strains Media Recipes and Reagents
Table 3 Yeast strains used in this study
Strain Genotype Source
L40 MATa trp1 leu2 his3 LYS2lexA-HIS3 URA3lexALacZ (92)
PDR12-CYT MATa PDR12-CYT (isogenic to L40) I Stagljar (University of
Toronto Toronto)
PDR12-CT MATa PDR12-CT (isogenic to L40) I Stagljar
STE6-CYT MATa STE6-CYT (isogenic to L40) I Stagljar
STE6-CT MATa STE6-CT (isogenic to L40) I Stagljar
BY157 MATa gcn2-101 ura3-52 C Nislow (University of
Toronto Toronto)
BY158 MATα gcn2-101 gcn3-101 ura3-52 C Nislow
BY4741 MATa ura3D leu2D his3D met15 D LYS2 (93)
BY4742 MATa ura3D leu2 his3D MET15 lys2D (93)
BY4743 MATaα his3Δ1his3Δ1 leu2Δ0leu2Δ0 LYS2lys2Δ0
met15Δ0MET15 ura3Δ0ura3Δ0
(94)
DDK1240 MATa pdr12Δkan (isogenic to L40) This study
DDN1240 MATa pdr12Δnat (isogenic to L40) This study
DDK0640 MATa ste6Δkan (isogenic to L40) This study
DDS0640 MATa sac6Δnat STE6-CYT (isogenic to L40)
DDN1242 MATa pdr12Δnat (isogenic to BY4742) This study
DD1210 MATaα pdr10Δkan pdr12Δnat (isogenic to BY4743) This study
DD1211 MATaα pdr11Δkan pdr12Δnat (isogenic to BY4743) This study
DD1205 MATaα pdr5Δkan pdr12Δnat (isogenic to BY4743) This study
DDG121 MATaα gtt1Δkan pdr12Δnat (isogenic to BY4743) This study
DDS121 MATaα sod1Δkan pdr12Δnat (isogenic to BY4743) This study
DD1207 MATaα tma7Δkan pdr12Δnat (isogenic to BY4743) This study
DD1256 MATaα ybr056wΔkan pdr12Δnat (isogenic to BY4743) This study
DDZ121 MATaα zeo1Δkan pdr12Δnat (isogenic to BY4743) This study
Table 4 Plasmids used in this study
Plasmid Features Promoter Resistance Marker Source
L2 Cub-TF-KanMX AMPR
DSB
L3 TF-Cub-KanMX AMPR DSB
pPR3N NubG-HA ADH TRP1 AMPR DSB
p4339 Nat Cassette T7 AMPR NAT
R
pFur4-NubG Fur4-HA-NubG ADH TRP1 AMPR DSB
pFur4-NubI Fur4-HA-NubI ADH TRP1 AMPR DSB
pOst1-NubG Ost1-HA-NubG ADH TRP1 AMPR DSB
93
pOst1-NubI Ost1-HA-NubI ADH TRP1 AMPR DSB
pDONR223 attB1 and attB2 T7 SPCR
Invitrogen
pYES-DEST52 V5 ndash HIS6 Epitope GAL1 T7 URA3 AMPR Invitrogen
DBS ndash Dual Systems Biotech
Recipes
05M EDTA pH 80
Dissolve 9305 g of EDTA (disodium salt dihydrate) in 400 mL of ddH2O Adjust pH to
80 using NaOH pellets and bring the final volume up to 500 mL with ddH2O Autoclave
and store at room temperature
09 NaCl
Dissolve 09 g of NaCl in a final volume of 100 mL of ddH2O Autoclave and store at
room temperature
1M 3-AT Solution
Dissolve 84 g of 3-Amino-124-triazole (3-AT) in a total volume of 100 mL ddH2O
Filter sterilize and aliquot as required Store at -20degC
1M Lithium Acetate
Dissolve 102 g of lithium acetate dihydrate in a total volume of 100 mL of ddH2O
Autoclave and store at room temperature
1M Tris pH 75
Dissolve 12114 g of Tris Base in 800 mL ddH2O Adjust the pH to 75 using
concentrated HCl and bring the volume up to 1L with ddH2O Autoclave and store at
room temperature
10X Tris EDTA (TE) Buffer pH 75
Mix 100 mL of 1M Tris pH 75 20 mL of 05M EDTA pH 80 and 880 mL of ddH2O
Filter sterilize through a 02 microm pore filter and store at room temperature
10x Drop-out Mix
Dissolve the appropriate amino acids in a total volume of 2 L of ddH2O Autoclave and
store at 4degC Omit components from the above solution as required depending upon the
selective medium being prepared
94
Amino Acid 2L (mg)
Isoleucine 600
Valine 3000
Adenine (A) 800
Histidine (H) 400
Leucine 2000
Lysine 600
Methionine 3000
Phenylalanine 1000
Threonine 4000
Tryptophan (W) 800
Tyrosine 600
Uracil 400
Arginine 400
50 PEG Solution (wv)
Dissolve 50 g of PEG-3350 in a total volume of 100 mL of ddH2O Autoclave or filter
sterilize once completely dissolved Make fresh
Ampicillin (1000x) Stock
Dissolve 100 mg of Ampicillin sodium salt in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 100 mgL Store at -
20degC
Geneticin (G418) (1000x) Stock
Dissolve 200 mg of G418 sulphate in a total volume of 1 mL ddH2O Filter sterilize and
aliquot as required Use at a working concentration of 200 mgL Store at 4degC
Kanamycin (1000x) Stock
Dissolve 50 mg of Kanamycin monosulphate in a total volume of 1 mL of ddH2O Filter
sterilize and aliquot as required Use at a working concentration of 50 mgL Store at -
20degC
Spectinomycin (1000x) Stock
Dissolve 100 mg of Spectinomycin dihydrochloride pentahydrate in a total volume of 1
mL of ddH2O Filter sterilize and aliquot as required Use at a working concentration of
100 mgL Store at -20degC
Transformation Master Mix
Per reaction combine 240 μL sterile 50 PEG 36 μL 1M LiOAc and 25 μL ssDNA
Vortex well to combine and use immediately Do not store for later use
Single-stranded Carrier DNA (ssDNA) Solution
Sterilize a 250 mL bottle and magnetic stir bar by autoclaving Dissolve 200 mg of
salmon sperm DNA in 100 mL sterile ddH2O Aliquot solution into sterile 15 mL
95
microfuge tubes Boil at 100degC for 5 minutes and put on ice immediately Store at -
20degC Before use boil again for 5 min at 100degC
Sodium Phosphate Solution
Dissolve 7 g of sodium phosphate dibasic and 3 g of sodium phosphate monobasic in a
total volume of 100 mL of ddH2O Autoclave and store at room temperature
X-Gal Solution
Dissolve 100 mg of X-Gal powder in a 1 mL total volume of NN-dimethyl formamide
Make fresh just before use Do not expose to light for prolonged periods of time
LB +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g bio-tryptone 5 g yeast extract and 10 g of NaCl in a total volume of 1 L of
ddH2O If making solid medium add 15 g Agar Autoclave and store liquid medium at
room temperature adding antibiotic (if required) before use at the appropriate working
concentration For solid medium allow to cool to 50degC add antibiotic (if required) at the
appropriate working concentration and pour into sterile petri dishes Store at 4degC
Synthetic Dropout (SD) Medium (Liquid and Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar (omit if
preparing liquid medium) in a total volume of 900 mL of ddH2O Add 100 mL of the
appropriate 10X Drop-out Mix Autoclave and store liquid medium at room temperature
For solid medium allow to cool to 50degC and pour into sterile petri dishes Store at 4degC
If inclusion of 3-AT in the solid medium is required reduce the initial volume of ddH2O
by the volume of 1M 3-AT solution needed to obtain the desired concentration Add 3-
AT solution after autoclaving once the medium has cooled to 50C
Synthetic Dropout (SD) + X-Gal Medium (Solid)
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 800 mL of ddH2O Add 100 mL of the appropriate 10X Drop-out Mix
Autoclave allow to cool to 50degC then add 100 mL of sodium phosphate solution and 800
microL of X-Gal solution Mix and pour into sterile petri dishes Wrap in aluminum foil and
store at 4degC If inclusion of 3-AT in the solid medium is required reduce the initial
volume of ddH2O by the volume of 1M 3-AT solution needed to obtain the desired
concentration Add 3-AT solution after autoclaving once the medium has cooled to
50C X-Gal is light sensitive therefore do not expose plates to light for prolonged
periods of time
YPAD +- Antibiotic Medium (Liquid and Solid)
Dissolve 10 g of yeast extract 20 g peptone 20 g of D-glucose 40 mg of adenine
sulphate and 20 g of agar (omit if preparing liquid medium) in a total volume of 1 L of
ddH2O Autoclave and store liquid medium at room temperature adding antibiotic (if
required) at the appropriate working concentration before use Cool solid medium to
50degC before adding antibiotic (if required) at the appropriate working concentration and
pour into sterile petri dishes Store at 4degC
96
2X YPAD (Liquid Medium)
Dissolve 20 g of yeast extract 40 g peptone 40 g of D-glucose and 40 mg of adenine
sulphate in a total volume of 1 L of ddH2O Autoclave and store at room temperature
Agarose Gel
Mix 1 g agarose in 100 mL 1x TAE Microwave for until solution is clear about 1 and a
half minutes and allow to cool slightly before adding 4 μL of SYBR Safe DNA gel stain
(Invitrogen) Pour into tray and allow to solidify for at least 15 minutes prior to use
1M Sorbitol
Dissolve 455 g D-sorbitol in a total volume of 250 mL of ddH2O Filter sterilize and
store at room temperature
Solution A
Combine 250 mL of 4M sorbitol 100 mL of 1M sodium citrate 120 mL of 05M EDTA
and 530 mL of ddH2O for a tola volume of 1L in a bottle with a magnetic stir bar
Autoclave and store at room temperature
Zymolyase Solution (5 mgml in 1M sorbitol)
Combine 0025 g Zymolyase 100T powder and 5 mL 1M sorbitol Store at 4˚C until
needed
Lysis Solution
Combine 20 mL of Solution A 45 mL of Zymolyase solution and 220 μL β-
mercaptoethanol Use immediately after preparation
Terrific Broth (TB)
Dissolve 12 g of tryptone 24 g of yeast extract and 4 mL 100 glycerol in 900 mL of
ddH2O Autoclave then add 100 mL sterile solution of 017M KH2PO4 and 072M
K2HPO4 which is made by dissolving 231 g of KH2PO4 and 1254 g of K2HPO4 in a
total volume of 100 mL of ddH2O Before use add antibiotic (if required) at the
appropriate working concentration
T-B Buffer
Dissolve 1088 g of MnCl24H2O 220 g of CaCl22H2O and 1865 g of KCl in 900 mL
of ddH2O Add 20 mL PIPES (05M pH 67) and top up to 1 L with ddH2O Filter
sterilize and store at -20˚C in 50 mL aliquots until required
Sporulation Medium
Dissolve 10 g of potassium acetate (1) 1 g of yeast extract (01) 05 g of glucose
(005) and 20 g of agar (2) in up to 1 L of ddH2O Autoclave cool to about 55˚C and
pour plates Store at 4˚C
97
SD Minimal Plates
Dissolve 67 g of yeast nitrogen base 20 g of D-glucose and 20 g of agar in a total
volume of 1 L of ddH2O Autoclave and allow to cool to 50degC then pour into sterile
petri dishes Store at 4degC
Sorbic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 56 mg of Sorbic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
Benzoic Acid Solid Medium
Dissolve 5 g of yeast extract 10 g peptone 10 g of D-glucose 20 mg of adenine
sulphate 10 g of agar and 61 mg of Benzoic acid per mM in a total volume of 500 mL of
ddH2O Autoclave and cool the medium to 50degC before pouring into sterile petri dishes
Store at 4degC
1M Stock of Sorbic Acid
Dissolve 56 g of Sorbic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
1M Stock of Benzoic Acid
Dissolve 61 g of Benzoic acid in a total volume of 50 mL of 100 ethanol Vortex
vigorously until solution is completely clear Store at room temperature
YPAD +Acid Liquid Medium
To make stock solutions of YPAD containing various concentrations of either Sorbic or
Benzoic acid add the amount of 1M stock acid solution indicated in the table below to a
total volume of 50 mL YPAD Vortex to combine and store at room temperature
1M Acid Stock Added Stock YPAD + Acid
Medium
Working Concentration Total Volume
1000 microL 20 mM 10 mM 50 mL
900 microL 18 mM 9 mM 50 mL
800 microL 16 mM 8 mM 50 mL
700 microL 14 mM 7 mM 50 mL
600 microL 12 mM 6 mM 50 mL
500 microL 10 mM 5 mM 50 mL
Please note that for the liquid panelling assay 50 microL of cells are added to each well halving the stock
solution of YPAD + Acid into the desired working concentration
4X Separating Buffer pH 87
Combine 6055 g of Tris base (15M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 87 by adding concentrated HCl Store at room temperature
98
4X Stacking Buffer pH 68
Combine 3025 g of Tris base (05M) and 2 g of SDS (04) in a final volume of 500 mL
of ddH2O Adjust the pH to 68 by adding concentrated HCl Store at room temperature
8 Acrylamide SDS PAGE Gels
For the separating gel combine 937 mL of 4X separating buffer 181 mL of ddH2O 10
mL of 30 acrylamide 50 microL of TMED and 250 microL of 10 APS solution Pour into
casts and add 400 microL of isopropanol along the top Once set prepare the stacking gel
mix by adding 25 mL of 4X stacking buffer 61 mL of ddH2O 134 mL of 30
acrylamide 20 microL of TMED and 100 microL of 10 APS Pour into casts add combs and
allow to set If storing gels for later use wrap in wet paper towels and place in a plastic
bag at 4degC Makes four gels
10 APS Solution
Dissolve 1 g of APS in 10 mL of ddH2O Store at 4degC
10X TBS pH 75
Dissolve 6055 g of Tris base (50 mM) and 8766 g of NaCl (150 mM) in a final volume
of 1 L of ddH2O Adjust the pH to 75 by adding concentrated HCl and store at 4degC
1X TBST Solution
Mix 100 mL of 10X TBS solution with 900 mL of ddH2O Add 1 mL of Tween 20 and
mix well Store at room temperature
Blocking and Incubation Solutions
Dissolve 5 g of skim milk powder in 100 mL of 1X TBST solution to make 5 milk
TBST for blocking Dissolve 02 g of skim milk powder in 20 mL of 1X TBST to make
1 milk TBST solution for the primary antibody incubation Dissolve 002 g of skim
milk powder in 20 mL of 1X TBST to make 01 milk TBST solution for secondary
antibody incubation
Antibodies
Polyclonal rabbit α-VP16 1deg antibody
Monoclonal mouse α-LexA 1deg antibody
Polyclonal mouse α-HA 1deg antibody
Monoclonal mouse α-HA 1deg antibody
Monoclonal rat α-HA 1deg antibody
Monoclonal mouse α-V5 1deg antibody
Monoclonal mouse α-HIS 1deg antibody
Sheep anti-mouse horseradish peroxidase (HRP) ndash conjugated
Goat anti-rabbit horseradish peroxidase (HRP) ndash conjugated
Goat anti-rat horseradish peroxidise (HRP) ndash conjugated
99
Appendix II ndash PCR Protocols and Primer Sequences
Table 5 Primers used in this study
Bait Generation and Confirmation Primers
ORF Forward Reverse
PDR12 (Int) 5rsquoATTTTCCAAACAGTTCCAGGTGACGAAAATAAA ATCACGAAGAAAATGTCGGGGGGGATCCCTCC 3rsquo
5rsquoACTCACGAGTGGGATAGAAATGAAATTCTTTT CTTTTAAATGGTAACTATAGGGAGACCGGCAG 3rsquo
PDR12 (Conf) 5rsquoGGATCACAGATGGAGAAACTT 3rsquo NA
STE6 (Int) 5rsquoAATAATCGCGGGGAATTATTCCAAATTGTTTCCA
ACCAAAGCAGTATGTCGGGGGGGATCCCTCCA 3rsquo
5rsquoGTCTCGAATATTTGAGTATGTTTTAGTTTTTTG
TTTTATATTTTCACTATAGGGAGACCGGCAGA 3rsquo
STE6 (Conf) 5rsquoTCAGCCTTGGATTCTGTCAG 3rsquo NA
Deletion Confirmation Primers
ORF Forward Reverse
ATG27 5rsquoGGTTAGTGGCATATTAGTCTGCTGT 3rsquo 5rsquoTCTTGCGGTAAATCGTTTATCTTAC 3rsquo
COS8 5rsquoGGCACACCGTGATGCACCCG 3rsquo 5rsquoCATGTTAATGACACCATGGCAG 3rsquo
CYB5 5rsquoAGTGAGAGAGGTTAGCATAACGAGA 3rsquo 5rsquoGATCGTATTGAAGTAAGAGCAGAGC 3rsquo
GTT1 5rsquoCAAATGAGGATTTTTACAAGGCTTA 3rsquo 5rsquoGTTTACAAGTTTTTGAAGAGCCAAA 3rsquo
GUP2 5rsquoCTACTCGTTTACCTGTAATCTTGGC 3rsquo 5rsquoGTCGCAACTTAGTGATGCATATAGA 3rsquo
IKS1 5rsquo TTTTCAGGATCACATAAATGCATAA 3rsquo 5rsquoGCACATTAAGGTATTGTTCGCTATT 3rsquo
LRE1 5rsquoGCTGTAGTGTGTCCTCCAATACTCT 3rsquo 5rsquoCTCCAAGATTACTGAAAAACCTGAA 3rsquo
Nat Int Conf 5rsquoCTTCGTGGTCATCTCGTACTC 3rsquo 5rsquoGAGTACGAGATGACCACGAAG 3rsquo
NCE102 5rsquoTCTTCCTACTTCTTCTTCCATTTCC 3rsquo 5rsquoAATTATAATAAAAGAAAGCGGGGTG 3rsquo
PDR10 5rsquoGTACTACTACAGAATTGGTCGGCAT 3rsquo 5rsquoTCACTGCAGATGTTAATAGATCCAA 3rsquo
PDR11 5rsquoCACTTTTGTTTCCTACAACTTCCAC 3rsquo 5rsquoGATGCAAATCAAGGAATGTTCTAAT 3rsquo
PDR5 5rsquoTTGAACGTAATCTGAGCAATACAAA 3rsquo 5rsquoTCACACTAAATGCTGATGCCTATAA 3rsquo
PHO88 5rsquoAGAAGAAGAACATCACTTTACACGG 3rsquo 5rsquoGGACACGACTCATTTTTCTTTACAT 3rsquo
RHO5 5rsquo TTTCAGTTTCTCGTAGCTTTTCCTA 3rsquo 5rsquoATTTGCTCGTAAAGAATTTGATGAC 3rsquo
SAC6 5rsquoCCGGATATAGGGTCCTATTTTCTTA 3rsquo 5rsquoCATTTTCTGCATATTTCAAAGAACC 3rsquo
SMF2 5rsquoTAGAATGAACCACAAGTTTGTAGCA 3rsquo 5rsquoTAAGTGTGCTAAAATGTGGATGAAA 3rsquo
SOD1 5rsquoGACGTAAGTATCTCTGAAGTGCAGC 3rsquo 5rsquoGGAAGCTTTATGGTGAAGTTAATGA 3
SPC2 5rsquoTGACAATTGTACACGTTGAAACGGAAT 3rsquo 5rsquoTTTGAGGATGCATGATTATAGCCTAGC 3rsquo
STE6 5rsquoACACGCTGCTTCGCACATATAC 3rsquo 5rsquoCCTGCCATCGCAACAACCAC 3rsquo
TAT1 5rsquoAAACTTCACATTATCTTGACAAGGC 3rsquo 5rsquoTTTTCTTGGCACATTTACACACTTA 3rsquo
100
TMA7 5rsquoGGATACAAGATCACCCATCATAAAG 3rsquo 5rsquoATATTTATCCTTATGCCTGTCACCA 3rsquo
YBR056W 5rsquoAGCTACTAAAGAAAGAGTGCTGCAA 3rsquo 5rsquoCTTCATCTTGATTACCATTATTCCG 3rsquo
YCK2 5rsquoTGTCTCCACAAAATGAGTAATGAAA 3rsquo 5rsquoATAATATTGGCGCTTCCTTAAGAGT 3rsquo
YGL082W 5rsquoTATCTTAAATTGGCTTGAAACGAAC 3rsquo 5rsquoTTCTGTGAAGATATCCCAAAAATGT 3rsquo
YLL023C 5rsquoTGACTTCAATGATCTCTCTCAACTG 3rsquo 5rsquoAAAAAGCTTCGGAAATACTACGAAT 3rsquo
YLR154C-G 5rsquoTAGACCGTAAGGTCGGGTCG 3rsquo 5rsquoCACGCAAGTAGTCCGCCTAG 3rsquo
YML133C 5rsquoCAGGCCGGAAATCAAGGATG 3rsquo 5rsquoGTACGTCTCCTCCAAGCCCT 3rsquo
YOP1 5rsquo GTAAGTAGGTTATATGGCTGCTGGA 3rsquo 5rsquoATAACATGATTAATGACCTTGCGTT 3rsquo
YSY6 5rsquoAATAATGGAAGTGAAACAAGGCTAA 3rsquo 5rsquoAAAGCAGAAAGCCTACTTGAAAAAT 3rsquo
ZEO1 5rsquoGCTTTATCGTGTTTTATATCGATGG 3rsquo 5rsquoGATTCTCGTACCGCTCATATTTTTA 3rsquo
ZRT1 5rsquoAAAACAATACACCCGTACTCTCTTG 3rsquo 5rsquoTGAAGCAAACTAGGTCTGTTGTAGA 3rsquo
ZRT3 5rsquoTTGACACATCTCTAAGCTGAAACTG 3rsquo 5rsquoTTGAACATACTCTAAACTCGGGAAC 3rsquo
Deletion Generation Primers
COS8 5rsquoGTTACTGAGCCATTGCATGAACGCGCGCGC
CTCGGCGGCTTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCAAATATTGAAAAT
AAGTGTTTTTGAATTTAGTG GTTATTGTATGGTG 3rsquo
PDR12 5rsquoGGTTTACAGATTTATTGTTATTGTTCTTATT AATAAAAAATGTCGCCCGTACATTTAGCC 3rsquo
5rsquoATTGTGTGTTAAACCACGAAATACAAATATA TTTGCTTGCTTGTACTATAGGGAGACCGGCAGA 3rsquo
SAC6 5rsquoGGATATAGGGTCCTATTTTCTTACGTGAACGG
CTTTTCTTCTTGCAGA ATACCCTCCTTGACAGTC 3rsquo
5rsquoGTAGGTGGAAGTTGAAATCTATTATTACATATTA
AAAACTTCGCGACC AGCATTCACATACG 3rsquo
SOD1 5rsquoGTAAGCGGACATCCCTTCCGCTGGGCTCG CCATCGCAGTGTC GCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTGACATAAATCTAA GCGAGGGAAATGAAAATG AAT GAATTG 3rsquo
STE6 5rsquoAGTGCCGCTGAAAATTCCACTAGGAAACAAAG
AACAAGCTACGTCTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTTAACTGCTTTGGTTGGAAACAATTTGGAATAATTC
CCCGCGATTACTATAGGGAGACCGGCAGA 3rsquo
TMA7 5rsquoAATGAACGAGGAAAATAAAAAATTTCATG
TTTAAAATCCTTGTCGCCCGTACAT TTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTAATATATGTA
TTTACTTAAAAAACGAGA ACTAGAAAATAC 3rsquo
YLR154C-G 5rsquoCTCCGTTTCAAAGGCCTGATTTTATGCAGGCCA CCATCGAAAGGGTGTCGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTCTACATTATTCTATC AACTAGAGGCTGT TCACCTTGGAGACCTGC 3rsquo
YML133C 5rsquoCTTCTTCTCAATAGAGTAGCTTAATTATTACA
TTCTTAGATGATGTGT CGCCCGTACATTTAGCC 3rsquo
5rsquoTCTGCCGGTCTCCCTATAGTTGCAACAAACACT
AAATCAAAACAGTGA AATACTACTACATCAAA 3rsquo
Gap Repair Primers
PDR5 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAA
GCAGTGGTATCAACGCAGAGTGATG
CCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGA
GAGGCCGAGGCGGCCGACATTATTTCT
TGGAGAGTTTACCG 3rsquo
101
PDR5
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT ACCCATACGATGTTCCAGATTACGCTA
TGCCCGAGGCCAAGCTTAAC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTG
GAGAGTTTACCG 3rsquo
PDR10 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG
CAGTGGTATCAACGCAGAGTGATGTT
GCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR10
5rsquoTCTATAGACACGCAAACACAAATA
CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA TGTTGCAAGCGCCCTCAAGTTC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATTTCTTTA
ATTTTTTGCTTTTCTTTG 3rsquo
PDR11 NubG 5rsquoTGTTCCAGATTACGCTGGATCCAAG CAGTGGTATCAACGCAGAGTGATGTC
TCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG AGGCCGAGGCGGCCGACATTATACGCTT
TGTTCGTTTGG 3rsquo
PDR11
5rsquoTCTATAGACACGCAAACACAAATA CACACACTAATCTAGAACTAGTATGT
ACCCATACGATGTTCCAGATTACGCTA
TGTCTCTTTCCAAATATTTTAATCC 3rsquo
5rsquoCGATAAGCTTGATATCGAATTCTCGAG
AGGCCGAGGCGGCCGACATTATACGCTT TGTTCGTTTGG 3rsquo
Sequencing Primers
PDR5 NubG 5rsquoAACATGTATGCCCGAGG 3rsquo NA
PDR5 1 5rsquoAGATTACGCTATGCCCGAGG 3rsquo NA
PDR5 2 5rsquoAGGCTCTGGCTGTACTAC 3rsquo NA
PDR5 3 5rsquoTGCCACAGTGGCCATCTATC 3rsquo NA
PDR5 4 5rsquoTGGGTAACTGTAGTATGGC 3rsquo NA
PDR5 5 5rsquoGAATATGTTCCTCGTGGTCC 3rsquo NA
PDR5 6 5rsquoCACTTCTGGATTGTTTGGCC 3rsquo NA
PDR5 7 5rsquoAAGTTGTTGGTGCAGCTC 3rsquo NA
PDR5 8 5rsquoTTTACTCCAACGCGTCTG 3rsquo NA
PDR5 9 5rsquoACTGGTTAGCAAGAGTGCC 3rsquo NA
PDR12 1 5rsquoATGTCTTCGACTGACGAACA 3rsquo NA
PDR12 2 5rsquoTTATTTGTCGTCGGTAGGCC 3rsquo NA
PDR12 3 5rsquoGTTGCTATTTACCAAGCTGG 3rsquo NA
PDR12 4 5rsquoGGGTTAAGGGTGATTCAACG 3rsquo NA
PDR12 5 5rsquoGCATCATTGGATTAGATGGC 3rsquo NA
PDR12 6 5rsquoTACACCATTCCATACGACGG 3rsquo NA
PDR12 7 5rsquoGAGAGCCTTAGCTGATTCTG 3rsquo NA
PDR12 8 5rsquoATCGCCTGTCTATATCAGGG 3rsquo NA
PDR12 9 5rsquoATGCCTGCCTTCTGGAGAAG 3rsquo NA
102
PDR12 10 5rsquoTCCAAACAGTTCCAGGTGAC 3rsquo NA
Gateway Cloning Primers
PDR5 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGCCCGAGGCCAAGCTT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTGGAGAGTTTACC 3rsquo
PDR10 5GGGGACAAGTTTGTACAAAAAAGCA
GGCTTAATGTTGCAAGCGCCCTCAAGT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGC
TGGGTATTTCTTTAATTTTTTGCT 3rsquo
PDR11 5rsquoGGGGACAAGTTTGTACAAAAAAGC
AGGCTTAATGTCTCTTTCCAAATAT 3rsquo
5rsquoGGGGACCACTTTGTACAAGAAAGCTG
GGTATACGCTTTGTTCGTTTGGATTAT 3rsquo
Table 6 PCR Reactions
PCR Reaction
Ingredient TaqPfu Reaction Phusion Flash Master Mix
Template DNA 1 microL 1 microL
Forward Primer 1 microL 1 microL
Reverse Primer 1 microL 1 microL
10 mM dNTPs 1 microL NA
Buffer (-MgSO4) 5 microL 25 microL
MgSO4 3 microL NA
Taq Polymerase 05 microL NA
Pfu Polymerase 05 microL NA
ddH2O 37 microL 22 microL
Total Reaction Volume 50 microL 50 microL
Table 7 PCR Programs
TaqPfu Reaction Phusion Flash Master Mix
Step Temperature (degC) Time (min) Temperature (degC) Time (min)
Initial Denature 95 5 98 5
Denature 95 2 98 075
Annealing Primer Dependent 1 Primer Dependent 1
Extension 72 5 72 225
Final Extension 72 55 72 25
Cycles 35 35
103
Appendix III ndash Sequences of Pdr12p Identified Interactors
Table 8 iMYTH Identified Prey Protein Regions of Interaction from Pdr12p Screen
Gene Name Residues Sequence
COS8 222-381 LPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPV
VMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEI
AKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMW
FASLNVELWPYIKEAQSARNEKPLK
GGT1 1-230 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPEL
KKIHPLGRSPLLEVQDRETGKKKILAESGFIFQYVLQHFDHSHVLMS
EDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARK
VADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFP
LQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARAL
SOD1 NA LYFRYHRHVKSKIQDKEGIPGGPYPYDVPDYAGSKQWYQRRVAITA
GRKDGRKWCGQGLLQGLFDQAYRSYLRCRQKRRYPRRPRLRGH
RIFEDWCRSKTSLWCHWSNQLMLMIIYLNKNRMVSSKRINSFILK
KKKKKKKKHVGRLGLSRIRYQAYRYR
TMA7 6-64 GGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKS
GKPLVGGGIKKSGKK
TUB2 295-414 DAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNS
DYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQF
SAMFKRKAFLHWYTSEGMDELEFSEAESN
YBR056W 395-479 QKGNLPKRPHGDDLQVDKKKIDSIIHEHEAYWNGKGKNFEHWRFED
GIKTAVDDIIAFRKFDNSLIGRWHSWKSQRRAEYVSAKK
YCK2 12-28 NSGLAVNNNTMNSQMPN
YLR154C-G NA GSSIHRHVKSKIQDKEGIPGGSTMSGHAYPYDVPDYAHGGPVEVSDE
ATVRSGRTASSADLGGSSKYSNENFEDSGERFHVNSSWTWVSRS
EMGKLRFKGLILCRPPSKGNPVKIPEPGYGFFTVTLNVETSARALGG
VIFSSQLITPELVYPEMGSYGWK
YMR315W-A 20-35 FTALRACPLRPKSLIA
ZEO1 1-109 MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKN
EATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKK
ETKKEGGFLKKLNRKIA
() Denotes iMYTH identified translated sequences not aligned to OFR of gene
104
Appendix IV ndash Pdr12-CT Bait Dependency Test
105
106
107
108
109
Figure 20 Pdr12p Bait Dependency Test Positive (OstI and Fur4) and negative (OstG and FurG)
control plasmids are shown in the top most panel Potential interactor proteins are listed along the left hand
side in alphabetical order SD-W is selective for the presence of prey plasmid but not interaction while
SD-WH + X-gal is selective for interaction between bait and prey Growth on medium selective for
interaction using the artificial bait strain is scored as a false positive as is failure to detect growth using the
original bait strain Both growth and blue colour are criteria used to evaluate interactions which are
genuine and specific and these are indicated by yellow stars The results of this test were used to generate
the Pdr12p interactome
110
Appendix V ndash Sequences of Ste6p Identified Interactors
Table 9 iMYTH Identified Prey Protein Regions of Interaction from Ste6p Screen
Gene Name Residues Sequence
VPS9 321-451 EAYQRNLKQLAEEKEEEEKKKQLEVPDELQPNGTLLKPLDEVTNIVI
SKFNELFSPIGEPTQEEALKSEQSNKEEDVSSLIKKIEENERKDTLNTL
QNMFPDMDPSLIEDVCIAKKSRIGPCVDALLSLSE
YGL081W 248-320 EEKEEEEEKEEGDDEEGEIELEIIRVKRIKGRTKIKKTLTCFSKNKKIIT
PQHSNSMWLLLIVILIFDRLLSN
111
Appendix VI ndash Ste6-CT Bait Dependency Test
Figure 21 Ste6p Bait Dependency Test Positive (OstI) and negative (OstG) control plasmids are shown
in the top panels Potential interactor proteins are listed along the left hand side SD-W is selective for the
presence of prey plasmid but not interaction while SD-WH is selective for interaction between bait and
prey Growth on medium selective for interaction using the artificial bait strain is scored as a false positive
as is failure to detect growth using the original bait strain Yellow stars indicate interactions which appear
genuine and specific The results of this test were used to generate the Ste6p interactome
112
Appendix VII ndash Pdr12 and Ste6p iMYTH Identified Interactors
Table 10 Description of Pdr12p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
COS8 YHL048W
Nuclear membrane protein member of the DUP380 subfamily of
conserved often subtelomerically-encoded proteins regulation
suggests a potential role in the unfolded protein response
GTT1 YIR038C
ER associated glutathione S-transferase capable of
homodimerization expression induced during the diauxic shift and
throughout stationary phase functional overlap with Gtt2p Grx1p
and Grx2p
PDR5 YOR153W
Plasma membrane ATP-binding cassette (ABC) transporter
multidrug transporter actively regulated by Pdr1p also involved in
steroid transport cation resistance and cellular detoxification
during exponential growth
PDR10 YOR328W
ATP-binding cassette (ABC) transporter multidrug transporter
involved in the pleiotropic drug resistance network regulated by
Pdr1p and Pdr3p
PDR11 YIL013C
ATP-binding cassette (ABC) transporter multidrug transporter
involved in multiple drug resistance mediates sterol uptake when
sterol biosynthesis is compromisedregulated by Pdr1p required for
anaerobic growth
SOD1 YJR104C
Cytosolic copper-zinc superoxide dismutase some mutations are
analogous to those that cause ALS (amyotrophic lateral sclerosis) in
humans
TMA7 YLR262C-A
Protein of unknown function that associates with ribosomes null
mutant exhibits translation defects altered polyribosome profiles
and resistance to the translation inhibitor anisomcyin
TUB2 YFL037W Beta-tubulin associates with alpha-tubulin (Tub1p and Tub3p) to
form tubulin dimer which polymerizes to form microtubules
YBR056W YBR056W Putative cytoplasmic protein of unknown function
YCK2 YNL154C
Palmitoylated plasma membrane-bound casein kinase I isoform
shares redundant functions with Yck1p in morphogenesis proper
septin assembly endocytic trafficking provides an essential
function overlapping with that of Yck1p
YLR154C-G YLR154C-G
Putative protein of unknown function identified by fungal homology
comparisons and RT-PCR this ORF is contained within RDN25-2
and RDN37-2
YMR315W-A YMR315W-A Putative protein of unknown function
ZEO1 YOL109W
Peripheral membrane protein of the plasma membrane that interacts
with Mid2p regulates the cell integrity pathway mediated by Pkc1p
and Slt2p the authentic protein is detected in a phosphorylated state
in highly purified mitochondria
113
Table 11 Description of Ste6p Interactors According to the Saccharomyces Genome
Database
Gene Name Systematic Name Description
VPS9 YML097C
A guanine nucleotide exchange factor involved in vesicle-mediated
vacuolar protein transport specifically stimulates the intrinsic
guanine nucleotide exchange activity of Vps21pRab5 similar to
mammalian ras inhibitors binds ubiquitin
YGL081W YGL081W Putative protein of unknown function non-essential gene interacts
genetically with CHS5 a gene involved in chitin biosynthesis
114
Appendix VIII ndash Weak Acid TECAN Assay Replicate
115
Figure 22 Sorbic and benzoic acid TECAN replicate Concentrations of acid used are indicated in the
top left hand corner of each graph YPAD is rich medium and contains no sorbic acid The legend is
found along the top and shows the strains used (A) Sorbic acid assay As the concentration of sorbic acid
increases the pdr10Δkan pdr12Δnat mutant is able to grow implying resistance even though its growth
is comparable to that of the WT strain All strains tested in this replicate are unable to grow at 10 mM
which is unexpected as growth was observed at this concentration previously (B) Benzoic acid assay
Same trends as observed with the sorbic acid assay in (A) though the double deletion mutant is able to
grow at 10 mM