Upload
tafa-bramble
View
52
Download
12
Tags:
Embed Size (px)
DESCRIPTION
Notes on Internal Combustion Engines
Citation preview
Reciprocating Internal Combustion Engines
Michele MannoDepartment of Industrial EngineeringUniversity of Rome Tor Vergata
Last update: May 15th, 2014
Internal Combustion Engines 1
Contents
1. General remarks and engine classification
2. Main operating parameters
3. Air intake
4. Supercharging and turbocharging
5. Fuel metering in spark ignition engines
6. Fuel injection in compression ignition engines
7. Operating characteristics and performance maps
8. Load matching: torque and rotational speed requirements
9. Pollutant formation and control
Internal Combustion Engines 2
General remarks and engine classification
Internal Combustion Engines 3
Engine components
Image sources: (left) M. Ehsani, Y. Gao, S.E. Gay, A. Emadi, Modern Electric, Hybrid
Electric, and Fuel Cell Vehicles, CRC Press LLC, New York, 2005.(right) J.B. Heywood, Internal Combustion Engine Fundamentals, McGraw-
Hill, New York, 1988.
General remarks and engine classification
1. Method of ignitiona) Spark Ignition, SI (Otto engines)b) Compression Ignition, CI (Diesel engines)
2. Working cyclea) full cycle in 4 piston strokes (four-stroke engine, 4S)b) full cycle in 2 piston strokes (two-stroke engine, 2S)
3. Fuelgasoline, fuel oil (diesel), natural gas, liquid petroleum gas (LPG), alcohols (methanol, ethanol)...
4. Air intakea) Naturally aspirated engineb) supercharged enginec) turbocharged engine
5. Air/fuel mixture preparationa) Carburetionb) Indirect fuel injectionc) Direct fuel injection
6. ApplicationPropulsion (automobile, truck, light aircraft, marine), portable power systems, power generation
Internal Combustion Engines 4
Engine classification
General remarks and engine classification
Method of ignition
Spark ignition enginesA mixture of air and fuel (usually gasoline) vapor is ignited by an electrical discharge (spark) across the spark plug.
Compression ignition enginesThe fuel is injected directly into the engine cylinder just before the combustion process is required to start. The liquid fuel jet is atomized into tiny droplets, and evaporates inside the hot compressed air; after a short delay period, the air/fuel mixture spontaneously ignites, because temperature and pressure are above the fuels ignition point (thanks to high compression ratios).
Working cycle
o Four-stroke enginesthe working cycle takes four piston strokes, or two crankshaft revolutions, and more than half is dedicated to exhaust gas expulsion (scavenging) from the cylinder and to fresh mixture intake inside the cylinder: the working fluid is thus replaced efficiently at each cycle.
o Two-stroke enginesthe working cycle takes just two piston strokes, i.e. one crankshaft revolution: power density is therefore higher than in 4S engines, but the scavenging process is less efficient.
Internal Combustion Engines 5
Engine classification
General remarks and engine classification
Bore (cylinder diameter) Crank radius Connecting rod length Piston stroke = 2
Unit displacement = Displacement =
(: number of cylinders) Minimum chamber volume Volumetric compression ratio = ( + )/ Working cycle frequency = /
(2S: = 1; 4S: = 2) Rotational speed = 2 Crank angle = = 2 Mean piston velocity = 2
Internal Combustion Engines 6
Geometric and kinematic parameters
Image source: R. Stone, Introduction to Internal Combustion Engines, Palgrave Macmillan, 2012
TC or TDC: Top Dead CenterBC or BDC: Bottom Dead Center
Internal Combustion Engines 7
Geometric and kinematic parameters
General remarks and engine classification
Typical values of geometric and kinematic parameters:
Ratio of cylinder bore to piston stroke = / 0.8 - 1.2 Ratio of connecting rod length to crank radius = / 3.0 - 4.0 Volumetric compression ratio (SI engines) 8 - 12 Volumetric compression ratio (CI engines) 12 - 24 Mean piston speed 8 - 15 m/s
0 45 90 135 1800
0.2
0.4
0.6
0.8
1
1.2
1.4
1.6
1.8
[deg]
u
p
/
u
p
R = 3.0R = 3.5R = 4.0
1. Intake stroke: fresh mixture is drawn into the cylinder by the depression induced by the piston stroke. To increase the mass inducted, the inlet valve opens shortly before the stroke starts and closes after it ends.
2. Compression stroke: air (or air/fuel mixture) is compressed to a small fraction of its initial volume, reaching pressure and temperature levels that depend on initial pressure and volumetric compression ratio . Toward the end of the compression stroke, combustion is initiated and the cylinder pressure rises more rapidly.
3. Power stroke: high temperature and pressure gases push the piston down, forcing the crank to rotate. As the piston approaches BDC the exhaust valve opens to initiate the exhaust process and drop the cylinder pressure to close to the exhaust pressure.
4. Exhaust stroke: exhaust gases exit the cylinder, first spontaneously because the pressure inside the cylinder is higher than inside the exhaust manifold (blowdownprocess), then because they are displaced by the piston as it moves toward TDC. As the piston approaches TDC the inlet valve opens, and just after TDC the exhaust valve closes, so the cycle starts again.
Internal Combustion Engines 8
Four-stroke engine working cycle
General remarks and engine classification
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
1 2 3 4
General remarks and engine classification
I. Compression stroke: as the piston moves toward TDC, the mixture inside the cylinder is compressed, while at the same time the pressure inside the crankcase decreases, so fresh air is drawn as soon as the inlet ports (2) are uncovered by the piston. As the piston approaches TDC, combustion is initiated.
II. Power (or expansion) stroke: all ports are closed by the piston in the first part of the stroke, then the exhaust ports (1) are first uncovered, and most of the burnt gases exit the cylinder in an exhaust blowdown process. Then the transfer ports (3) are uncovered and fresh charge, which has been compressed in the crankcase during the compression stroke, flows into the cylinder. The piston and the ports are generally shaped to deflect the incoming charge from flowing directly into the exhaust ports, so as to achieve effective scavenging of the residual gases.
Internal Combustion Engines 9
Two-stroke engine working cycle
Image source: (top) R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Internal Combustion Engines 10
Naturally aspirated SI 4S engine cutaway
General remarks and engine classification
9. Crankshaft10.Sump11.Oil pump12.Camshaft13.Pushrod14.Coil ignition15.Spark plug16.Exhaust valve17.Rocker arm
1. Air filter2. Carburetor3. Engine head4. Exhaust pipe5. Cylinder block6. Piston7. Alternator8. Connecting rod
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
General remarks and engine classification
Internal Combustion Engines 11
3-cylinder SI 4S engine cutaway
Image source: MTZ worldwide, February 2013
Internal Combustion Engines 12
Naturally aspirated CI (Diesel) 4S engine cutaway
General remarks and engine classification
7. Oil pump8. Oil filter9. Injection pump10.Glow plug11.Injector12.Camshaft
1. Engine head2. Piston3. Cylinder block4. Connecting rod5. Crankshaft6. Sump
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
General remarks and engine classification
CI engine limitations:
o heavier weight, due to higher compression ratios necessary to reach pressures and temperatures required for fuel auto-ignition;
o lower specific power (with reference to engine displacement), and consequently higher footprint for the same power, due to lower rotational speed;
o higher noise level, because of the different nature of the combustion process.
CI engine advantages:
o higher overall efficiency, thanks to higher compression ratios, which in SI engines are limited in order to avoid combustion anomalies (knocking);
o better part-load performance, thanks to the different power control system (no need to throttle air in the intake manifold: partialization is obtained simply through the control of the total amount of fuel injected);
o lower quality fuel required (even though emission regulations have increased manufacture costs).
Internal Combustion Engines 13
Comparison between SI and CI engines
General remarks and engine classification
2S engine limitations:
o lower efficiency, because work is not delivered during the whole expansion stroke, but only during the first part of it, before exhaust ports are uncovered to allow exhaust gas blowdown and scavenging;
o worse exchange of working fluid -> higher pollutant emissions;
o higher thermal and mechanical stresses, because every stroke (compression and expansion) is marked by high pressures and temperatures, while in 4S engines two strokes out of four are dedicated to the gas exchange process (air induction and exhaust gas expulsion), which takes place at low pressures and temperatures.
2S engine advantages:
o higher specific power: theoretically double than 4S engines, because in 2S engines there is a power stroke at every crankshaft revolution; in practice, specific power is only about 5060% higher due to worse gas exchange process;
o simpler construction, because ports or automatic valves can be used to control air intake and exhaust discharge, rather than cam-controlled valves necessary in 4S engines;
o more uniform torque, in particular for low-power engines, because a useful work phase takes place for every crankshaft revolution.
Internal Combustion Engines 14
Comparison between 4S and 2S engines
Internal Combustion Engines 15
Ideal thermodynamic cycles
Operating parameters
Thermodynamic processes1-2 Adiabatic compression2-3 Heat input:
Otto: constant volumeDiesel: constant pressureSabath: mixed (isochoric 2-3, isobaric 3-3)
3-4 Adiabatic expansion4-1 Constant volume heat rejection
Constant-volumeOtto
Constant-pressureDiesel
Limited-pressureSabath
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Ideal cycles parameters
Volumetric compression ratio: = / Heat input ratio at constant volume: = / Heat input ratio at constant pressure: = /
Operating parameters
Heat input: = + ( )
Rejected heat: = ( )
Cycle efficiency:
= 1
+ Reversible adiabatic compression:
=
Isochoric heat input:
= =
Isobaric heat input: = =
Reversible adiabatic expansion:
=
=
=
1
=
=
Internal Combustion Engines 16
Ideal cycle analysis
Sabath cycle efficiency:
= 1 1
1 1 + 1
Otto cycle efficiency:
= 1 1
Diesel cycle efficiency:
= 1 1
1 1
Ideal cycle efficiency:
depends on fluid properties though the ratio of specific heats = /
increases with volumetric compression ratio , because it increases the average temperature of heat input
decreases as the ratio = / increases
Internal Combustion Engines 17
Ideal cycle efficiency
Operating parameters
8 12 16 20 240
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0.8
0.9
1
rv
i
d
k = 1.4b = 2.0
OttoDiesel
Operating parameters
In order to take into account the real
thermodynamic behavior of the working fluid,
a fuel/air cycle is defined. Its characteristics are:
air and combustion products are perfect gases,
with specific heat (, ) and specific heat
ratio dependent on temperature;
the combustion process is complete and
instantaneous;
no heat transfer takes place with engine walls;
reversible compression and expansion.
The fuel/air cycle efficiency (or /) is
thus defined as the ratio between the work output
of such a cycle and its heat input:
= /
The plot on the right shows the influence of volumetric compression ratio
on fuel/air cycle efficiency for different equivalence ratios
(defined later as /), in the case of a constant-volume (Otto) cycle.
is the absolute humidity; the fraction of exhaust gas residuals.
Internal Combustion Engines 18
Fuel/air cycle efficiency
Image source: R. Stone, Introduction to Internal Combustion Engines, Palgrave Macmillan, 2012
Operating parameters
Further differences between air/fuel cycle and real cycle are due to:
Finite combustion time: the combustion process usually lasts at least 50 crank angle degrees
Incomplete combustion and chemical dissociation
Heat transfer between burned gases and cylinder walls and between air and intake manifold
Crevice effects and leakage
Exhaust blowdown loss due to anticipated opening of exhaust valve
Pressure losses at intake and exhaust valves: in naturally aspirated engines, this means in
particular that work must be done by the piston on the gas during the intake and the exhaust
processes (pumping work)
Finite valve opening and closing time
The real working cycle is defined as indicated cycle (see the following slide), so an
indicated thermodynamic efficiency may be defined as the ratio of the actual work output and the
work output of a corresponding fuel/air cycle:
=
Internal Combustion Engines 19
Air/fuel cycle vs real thermodynamic cycle
Operating parameters
Internal Combustion Engines 20
Indicated cycle
The real working cycle and engine performance are
measured with a dynamometer: the engine is clamped on
a test bed and the shaft is connected to the dynamometer
rotor, which is coupled to the stator by electromagnetic,
hydraulic or mechanical (friction) means.
The force required to balance the stator gives the
engine torque:
=
Engine power is then given by the product of torque and
rotational speed
= =
This is the usable power that is delivered by the engine to
the load, which is in this case a brake (brake power):
hence the suffix b.
Besides, pressure inside the engine is measured by
sensors called indicators (hence the definition of
indicated cycle) as a function of crank angle and,
consequently, cylinder volume .
Internal Combustion Engines 21
Real (indicated) cycle
Operating parameters
Pressure vs. crank angle (-) diagram
0 Intake valve opening (IVO)
1 Intake valve closing (IVC)
* Start of combustion (SOC)
4 Exhaust valve opening (EVO)
6 Exhaust valve closing (EVC)
Indicated cycle
(pressure vs cylinder volume diagram, -)
Left: indicated cycle of a 4S, SI engine
Right: indicated cycle of a 4S, CI engine
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Intake
Compression Expansion
Exhaust
EV
C
IVC
EV
O
IVO
TDC BDC TDC BDC TDC
Operating parameters
Indicated work per cycle (per cylinder)
=
Indicated mean effective pressure (imep)
=
=
Indicated fuel conversion efficiency
= =
Indicated cycle power output
= = / = /
Mechanical efficiency
=
=
is the fraction of the engine power needed
to drive accessories and overcome friction
Brake mean effective pressure (bmep)
=/
bmep is the work available per cycle and unit
displacement
Friction mean effective pressure (fmep)
=/
fmep is here defined to include work spent to
drive accessories
Mechanical balance in terms of power =
Mechanical balance in terms of effective pressures:
=
=
Internal Combustion Engines 22
Indicated cycle
Operating parameters
Overall fuel conversion efficiency must take into account energy losses due to friction and work
necessary to drive accessories, so it is defined in terms of brake power:
=
It is therefore the product of indicated fuel conversion efficiency and mechanical efficiency:
= =
The specific fuel consumption is, by definition, the fuel mass flow rate that must be burned in the
engine to obtain a unit power output: thus, it is given by the inverse of the product of fuel conversion
efficiency and heating value. It is usually expressed in [g/kWh]:
=
=
Internal Combustion Engines 23
Overall fuel conversion efficiency and specific consumption
Operating parameters
Volumetric efficiency is used to measure the effectiveness of an engines induction process, and is
defined as the mass of air that effectively flows into the intake system divided by the mass of air
that would fill a volume equal to the displacement at inlet air conditions (inlet air density ):
=
=
In naturally aspirated engines volumetric efficiency is lower than 1 because of pressure losses in the
intake system (distributed losses in the intake manifold and concentrated losses in the intake valve).
Typical maximum values are in the range 8090% for SI engines, and somewhat higher in CI
engines (because there are no throttling losses, which in some measure are always present in SI
engines even at full load).
In supercharged and turbocharged engines inlet air density is higher than the ambient value, so
volumetric efficiency is higher than 1 (and for this reason it is not totally appropriate to talk about
efficiency in this case).
Inlet air mass flow rate can be expressed as follows:
= /
Internal Combustion Engines 24
Volumetric efficiency
Operating parameters
An obviously important parameter for the
combustion process is the air/fuel ratio :
=
The fuel/air equivalence ratio is an even
more informative parameter for defining
mixture composition, because it compares the
stoichiometric air/fuel ratio to the actual one:
=
Its inverse is the relative air/fuel ratio :
=
According to these definitions:
o for fuel-lean mixtures: < 1, > 1
o for stoichiometric mixtures: = 1, = 1
o for fuel-rich mixtures: > 1, < 1
The energy input into the system per unit time
can thus be expressed as:
=
/ =
/
Power output:
=
/
Brake mean effective pressure
=
Torque is proportional to bmep and engine
displacement:
=
=
Internal Combustion Engines 25
Air/fuel ratio, torque and power output
Operating parameters
Fundamental energy balance equation:
= = + + + +
Heat flux absorbed by refrigerating fluid and lubrication oil:
= +
Heat flux rejected as sensible heat in the exhaust gases:
,( )
Other forms of heat dissipation ( ):
o incomplete combustion;
o radiation.
Internal Combustion Engines 26
Thermal energy balance
Spark Ignition Engines Compression Ignition Engines
20 30% 28 40%
16 33% 15 37%
30 50% 24 40%
+ 4 20% 4 12%
Source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Operating parameters
Taking into account indicated thermodynamic efficiency , if rotational speed increases the
working cycle gets shorter, so:
leaks of working fluid and heat transfer between fluid and engine walls both decrease
energy losses due to imperfect and incomplete combustion increase
On the other hand, the air/fuel cycle efficiency slightly increases with the rotational speed because
of higher dilution of fuel (the amount of residual gas is higher) and thus lower temperatures (which
reduce the effect of the specific heats variability).
In the case of mechanical efficiency , if rotational speed increases:
friction losses and pumping work also increase
Therefore, varying rotational speeds:
indicated thermodynamic efficiency has a maximum, albeit with only a slight variation
mechanical efficiency decreases as rotational speed increases
fuel conversion efficiency has therefore a maximum, but with a significant decrease only at
high rotational speeds, due to the marked drop in mechanical efficiency
Internal Combustion Engines 27
Influence of rotational speed on efficiencies
Fuel/air cycle efficiency : for fuel-rich mixtures ( < ,
> 1) a fraction of the fuel cannot burn, so it decreases almost
linearly with the air/fuel ratio, for fuel-lean mixtures, ( > ,
< 1), there is a slight increase due to higher dilution
Indicated thermodynamic efficiency : it is highly dependent
on air/fuel ratio because of its influence on reaction speed. For
air/fuel ratios markedly higher or lower than the stoichiometric
value the speed of the chemical reactions decreases
significantly, bringing about higher energy losses and therefore
efficiency losses.
Maximum reaction speeds are obtained with slightly rich
mixtures ( 0,9); reactions are effectively frozen for < 0,5
or > 1,5.
Friction mean effective pressure does not depend on air/fuel
ratio: mechanical efficiency thus depends on air/fuel ratio only
through its influence on imep, and therefore it varies as the
indicated efficiency does
(because = 1 / and ).
Internal Combustion Engines 28
Influence of air/fuel ratio on efficiencies in SI engines
Operating parameters
Image source (bottom): G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Equivalence ratio
Rich mixture Lean mixture
Air/fuel ratio
Specific
pow
er
outp
ut [k
W/d
m3]
Specific
fuel consum
ption [g/M
J]
Overa
ll fu
el convers
ion e
ffic
iency [%
]
/
Since CI engines work exclusively with lean mixtures
( 0,7), increasing air/fuel ratios is always beneficial
with reference to dissociation and incomplete
combustion, so the indicated thermodynamic
efficiency increases.
The different combustion mechanism makes the effects
related to reaction speeds much less important.
Only with extremely lean mixtures the indicated
thermodynamic efficiency drops significantly.
Regarding the influence of air/fuel ratio on mechanical
efficiency, the same considerations apply to CI and SI
engines, but the mechanical efficiency curve for CI
engines is different than for SI engine because imep
behaves differently.
Internal Combustion Engines 29
Influence of air/fuel ratio on efficiencies in CI engines
Operating parameters
Operating parameters
Internal Combustion Engines 30
Typical design and operating data for internal combustion engines
Source: J.B. Heywood, Internal Combustion Engine Fundamentals, McGraw-Hill, New York, 1988.
Internal Combustion Engines 31
Polar valve timing diagram
Air intake
Intake Valve
Intake valve opens (IVO) before TDC in order to have the valve completely open when the induction stroke begins, so as to maximize air induction into the cylinder.
Intake valve close (IVC) after BDC in order to take advantage of kinetic energy of exhaust gases in the intake manifold, so as to achieve a good air induction, thanks to inertial effects, even after BDC.
Image sources:
(left) R.N. Brady, Internal Combustion (Gasoline and Diesel) Engines, In: Encyclopedia of Energy, Elsevier, New York, 2004, Pages 515-528, ISBN 9780121764807. (right) A. Paul, P.K. Bose, R. S. Panua, R. Banerjee, An experimental investigation of performance-emission trade off of a CI engine fueled by dieselcompressed natural gas (CNG) combination and dieselethanol blends with CNG enrichment, Energy, Volume 55, 15 June 2013, Pages 787-802, ISSN 0360-5442, http://dx.doi.org/10.1016/j.energy.2013.04.002.
Internal Combustion Engines 32
Polar valve timing diagram
Air intake
Exhaust Valve
Exhaust Valve Closes (EVC) after TDC in order to take advantage of the inertia of the exhaust gases, which draw even more fresh air into the cylinder thanks to the overlap period (time while
intake and exhaust valve are simultaneously open).
Exhaust Valve Opens (EVO) before BDC so as to discharge initially the burned gases due to the pressure difference between the cylinder and the exhaust system (blowdown); after BDC the
cylinder is scavenged by the piston as it moves toward TDC (displacement process).
Advanced EVO allows to reduce pumping work (pressure decreases in the cylinder) but it also
reduces the power stroke, so an optimum value exists as a compromise between these effects.
Image sources:
(left) R.N. Brady, Internal Combustion (Gasoline and Diesel) Engines, In: Encyclopedia of Energy, Elsevier, New York, 2004, Pages 515-528, ISBN 9780121764807. (right) A. Paul, P.K. Bose, R. S. Panua, R. Banerjee, An experimental investigation of performance-emission trade off of a CI engine fueled by dieselcompressed natural gas (CNG) combination and dieselethanol blends with CNG enrichment, Energy, Volume 55, 15 June 2013, Pages 787-802, ISSN 0360-5442, http://dx.doi.org/10.1016/j.energy.2013.04.002.
Volumetric efficiency increases as the cross-section
available to induced air and to exhaust gases
increases.
The influence of intake cross-section is much more
pronounced than that of the exhaust cross-section, by
a factor equal to (because it affects the fluid filling
the whole cylinder, and not only the dead volume).
In order to increase intake and exhaust cross-sections,
it is obviously better to adopt multivalve systems
rather than increasing the size of a single valve.
Therefore the following systems are commonly used:
o 3 valves (2 intake and 1 exhaust)
o 4 valves (2 intake and 2 exhaust)
o 5 valves (3 intake and 2 exhaust)
(anyway, exhaust valves are usually smaller)
Internal Combustion Engines 33
Intake and exhaust valves
Air intake
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Air intake
Internal Combustion Engines 34
Phenomena influencing gas exchange processes
In naturally aspirated engines, the volumetric efficiency is
lower than 1 because of several phenomena taking place
in the gas exchange process. The most important are:
1. Exhaust gas expansion: at the end of the exhaust
stroke, the dead volume is filled with exhaust gases,
whose pressure is higher than the atmospheric pressure
( > ): these gases expand as the induction process
begins and the pressure in the cylinder decreases, and
occupy a volume larger than the dead volume.
2. Pressure losses through the intake valve: when the
induction stroke ends, pressure inside the cylinder is
lower than atmospheric pressure (1 < ) because of
energy losses taking place as the fresh air (or mixture)
flows through the valve, so the air density is also lower
than atmospheric air density (1 < ).
3. Heat exchanges between engine walls and induced air
also make airs density lower than atmospheric density.
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Volumes
Pre
ssure
[kP
a]
Intake Exhaust
Internal Combustion Engines 35
Volumetric efficiency: quasi-static effects
Air intake
Fuel vapor (and also water vapor) reduces the air partial pressure
below the mixture pressure. If is the mixture pressure (at the
beginning of the compression stroke), then = , + , + ,
(a -> air, f -> fuel, w -> water). Partial pressure of air is given by:
,
= 1 +
+
1
This effect can be quite large for gaseous fuels.
Fuel vaporization: the mixture temperature decreases as liquid fuel is
vaporized. The temperature difference that occurs after evaporation is:
=,
, + ,/
with: fraction of fuel evaporated; , enthalpy of vaporization.
For isooctane, at = 1, 19 K; for alcohols, given their large
enthalpy of vaporization, the effect can be quite large ( 128 K
for methanol) and compensate for the reduction in air partial pressure.
As the pressure in the exhaust manifold increases, the volume
occupied by the residual gas in the cylinder also increases, so the
volumetric efficiency decreases.
Image source: J.B. Heywood, Internal Combustion Engine Fundamentals, McGraw-Hill, New York, 1988.
Volumetric efficiency increases with ambient
temperature (according to a power 0,5),
because less heat is exchanged between
mixture and walls. In any case, the mass of
induced air decreases as ambient
temperature increases:
=
1
=
1
1
0,5
Refrigerant temperature affects wall
temperature and thus heat transfer during
the gas exchange process: therefore,
volumetric efficiency slightly increases as
refrigerant temperature decreases.
Internal Combustion Engines 36
Volumetric efficiency: influence of ambient and refrigerant temperature
Air intake
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Volu
metr
ic e
ffic
iency r
atio /
Volu
metr
ic e
ffic
iency r
atio /
Refrigerant temperature [K]
Ambient temperature [K]
= 302,4 K
= 363 K
0,5
Volumetric losses due to charge heating
decrease as (and therefore ) increases
because the time available for heat exchange
between fluid and engine walls also decreases.
The effect of friction, both at the intake and at
the exhaust, is proportional to 2 at low-medium
speeds, and increases even more strongly with
at high speeds, when sonic flow conditions
(choking) are reached at the intake valve.
Backflow: because the inlet valve closes after
the start of the compression stroke, a reverse
flow of fresh charge from the cylinder back into
the intake can occur as the piston moves
toward TDC. This flow is larger at lower speeds.
Dynamic effects: inertial effects and wave
effects (tuning).
Internal Combustion Engines 37
Volumetric efficiency: influence of rotational speed
Air intake
Image source: J.B. Heywood, Internal Combustion Engine Fundamentals, McGraw-Hill, New York, 1988.
Early Exhaust Valve Opening (EEVO)
If the exhaust valve closes much earlier than BDC,
energy losses for incomplete expansion increase,
but the blowdown process is more effective, thus
reducing the work in the exhaust stroke.
Therefore, a compromise value must be sought.
Late Intake Valve Closing (LIVC)
As the difference between BDC and intake valve
closing increases, the volumetric efficiency vs
engine speed curve shifts towards higher rotational
speeds. With fixed valve timing, this also means
that backflow increases at low speeds.
Internal Combustion Engines 38
Volumetric efficiency: effect of valve timing
Air intake
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Cylinder volume
Pre
ssure
[M
Pa]
Volu
metr
ic e
ffic
iency
Engine speed [rps]
[rpm]
IVC point
(degrees after BDC)
EVO point
(degrees before BDC)
TDC BDC
The pressure in the inlet manifold varies during each cylinders
intake process due to the piston velocity variation, and the unsteady
gas-flow effects that result from these geometric variation.
At higher engine speeds, the inertia of the gas as the intake valve is
closing increases the pressure in the inlet port and continues the
charging process as the piston slows down around BDC and starts
the compression stroke. The inlet valve is closed some 40 to 60
after BDC, in part to take advantage of this ram phenomenon.
The fluid filling intake manifold and cylinder can be approximated as
a 1-degree of freedom oscillator (Helmholtz resonator), whose
natural frequency is:
0
2
Pressure oscillations increase volumetric efficiency when the intake
systems natural frequency is twice the rotational speed: 0 2.
Therefore, given the geometry of the intake system, the rotational
speed that maximizes volumetric efficiency is:
Internal Combustion Engines 39
Volumetric efficiency: inertial effect
Air intake
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Volu
metr
ic e
ffic
iency r
atio /
Frequency ratio 0/
0
2
Pressure oscillations due to wave propagation in the
intake system influence the gas exchange process.
When the intake valve opens, a rarefaction wave
propagates upstream; it is then reflected back as a
pressure wave at the first discontinuity.
If the reflected wave reaches the intake valve in the
second half of the induction phase (about 90 after TDC),
pressure at the valve increases just as the intake stroke is
almost complete, aiding the induction process.
In this case the intake system is said to be tuned.
The time required for a wave to travel along the system is
= /, which, in terms of crankshaft angle, is:
= 2 = 2/
The system is tuned if: 2 /2 /
Given actual values of sound speed , an intake system is
usually tuned at high rotational speeds; it could also be
tuned at relatively low speeds with very long pipes.
Internal Combustion Engines 40
Volumetric efficiency: wave effects (tuning)
Air intake
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Pre
ssure
[M
Pa]
Crankshaft angle [deg]
TDC BDC
Reflected
wave
Resulting pressure
Without reflection
LIVC EIVO
Air intake
a)Mechanical supercharging
b)Turbocharging
c) Engine-driven compressor and turbocharger
d)Two-stage turbocharging
e)Turbocharging with turbocompounding
f) Turbocharger with intercooler
C Compressor
E Engine
I Intercooler
T Turbine
Internal Combustion Engines 41
Supercharging and turbocharging: layouts
Image source: J.B. Heywood, Internal Combustion Engine Fundamentals, McGraw-Hill, New York, 1988
Air intake
Internal Combustion Engines 42
Supercharging: Roots compressor (positive displacement)
Image source:
(right) R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
(left) P.W.Wetzel, J.P.Trudeau, New supercharger for downsized Engines, MTZ worldwide, February 2013
Air intake
Internal Combustion Engines 43
Turbocharger
Image source: E. Chebli et al., Development of an exhaust-gas turbocharger for HD Daimler CV engines, MTZ Worldwide, February 2013
Air intake
Internal Combustion Engines 44
Turbocharging with intercooler
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Internal Combustion Engines 45
Turbocharging
Air intake
Turbocharging is based on the residual energy of the exhaust gases
Backpressure increases as exhaust gases flow through the turbine
Area 2-3-4-5 represents the energy related to a spontaneous discharge in atmosphere, and it is the
maximum energy that could theoretically be extracted from the exhaust gases in an ideal impulse
layout (where each cylinder is directly connected to the turbine inlet)
In a constant pressure system, each cylinder discharges to an exhaust manifold that is large enough
to dampen pressure oscillations; kinetic energy is then lost while exhaust gases expand to pressure
(2-3 process), with an increase in total enthalpy and temperature
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
pre
ssure
Volume
TDC BDC
Adiabatic expansion
Air intake
For positive displacement compressors, pressure ratio is almost independent on the engines
rotational speed: therefore, good performances can be achieved even at low rotational speeds and
when accelerating from low speeds.
The turbocharger on the other hand provides increasing pressure ratios as the engine speed
increases: inlet pressure may be either insufficient at low speeds or too high at high speeds.
The turbocharger is more reliable; installation and maintenance are easier.
The turbocharger weighs less and is smaller than a supercharger, other things being equal
(in particular, for the same pressure ratio and air flow rate).
Pressure ratio is approximately up to 3 for a turbocharger and up to 2 for a Roots compressor.
During transient response, turbochargers do not respond as fast
as mechanically driven compressors (turbo lag), due to the time
needed for the exhaust system and turbocharger to generate
the required boost.
Inertia, friction, and compressor load are the primary contributors
to turbo lag.
The mechanically driven compressor has a faster response
because its rotational speed is directly coupled to the engines speed.
Internal Combustion Engines 46
Supercharging vs. turbocharging
Time [s] T
orq
ue
Mechanically driven
Turbo
Naturally Aspirated
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Air intake
Spark Ignition engines:
o The degree of supercharging in SI engines is mainly limited by the knock: supercharging reduces
ignition delay which increases the knocking tendency.
o Before the advent of direct injection systems, turbocharging required a decrease of the
compression ratio in order to reduce the risk of knocking -> higher specific fuel consumption.
o With the advent of direct injection systems and the availability of better fuels (higher octane
numbers), turbocharging could be more easily adopted, because fuel vaporization, together with a
wide use of charge cooling, allows to avoid the need to reduce compression ratios.
Compression Ignition engines:
o Since in CI engines there is no risk of knocking, supercharging is limited only by the maximum
permissible mechanical and thermal loads. Indeed, supercharging has even a positive influence on
the combustion process.
o Therefore, turbocharging is extensively used in CI engines, and it makes their performance reach
the same level of naturally aspirated SI engines.
Internal Combustion Engines 47
Turbocharging: applications
Internal Combustion Engines 48
Turbocharging: exhaust gas by-pass valve
Air intake
The turbocharger is sized in such a way that it can
provide maximum supercharging pressure at
4050% of the maximum rotational speed, in order
to achieve good torque output even at low speeds.
At high rotational speeds, the excess exhaust
gases are discharged through a bypass valve.
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Bypass valve
Exhaust gas
Turbocharger
Fresh air
Engine
Discharge Turbine Inlet
Air intake
As an alternative, in order to achieve
good performances on a wide range
of rotational speeds, a variable-
geometry turbine can be used, which
is equipped with variable-pitch nozzle
blades.
Internal Combustion Engines 49
Turbocharging: variable geometry turbine
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Equivalence ratio
Rich mixture Lean mixture
Air/fuel ratio
Specific
pow
er
outp
ut [k
W/d
m3]
Specific
fuel consum
ption [g/M
J]
Overa
ll fu
el convers
ion e
ffic
iency [%
]
/
Fuel metering in SI engines
Fuel volatility
Fuel must be premixed with air, before the
spark starts the combustion process.
Air/fuel ratio
The metering system must provide the
appropriate quantity of fuel, so as to obtain the
required air/fuel ratio for every operating point.
Mixture homogeneity
The air/fuel mixture must be homogeneous, in
order to burn fuel rapidly and completely.
Internal Combustion Engines 50
Requirements of a 4S, SI engine
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Fuel metering in SI engines
1. Air filter
2. Carburetor
3. Throttle valve
4. Intake manifold
5. Fuel tank
6. Fuel filter
7. Cam
8. Diaphragm pump
Internal Combustion Engines 51
Carburetor
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Fuel metering in SI engines
Fundamental components:
Venturi (convergent-divergent nozzle)
In its throat the depression originated by the
inlet air flow draws fuel from its tank.
Fuel discharge tube
Connects the fuel tank to the Venturi throat.
The fuel flow is metered by a calibrated orifice.
Float chamber
The fuel level is maintained at a constant
height in a float chamber: a pressure
equalizing passage makes the pressure inside
the float chamber equal to air pressure at the
Venturi inlet. Thus, hydrostatic pressure on the
calibrated orifice depends only on the flow rate
of air.
Throttle valve
It controls air flow rate, and as a consequence
power output, acting on volumetric efficiency.
Internal Combustion Engines 52
Elementary carburetor
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Air
Fuel
Float
chamber
Calibrated
orifice
Throttle
plate
Pressure
equalizing
passage
Venturi
throat
Fuel discharge
nozzle
Fuel metering in SI engines
Limits of carburetors
It is difficult to control precisely the required
air/fuel ratio in different operating conditions
Pressure loss in aspiration
It is difficult to control its operation in transient
conditions, due to the inertia of the fuel mass
Significant variation of specific fuel
consumption with load, particularly pronounced
in case of frequent transient operating conditions
It is necessary to heat the intake manifold in
particular operating conditions, with the
consequent decrease in volumetric efficiency, in
order to avoid that fuel condenses on engine walls
Limited control on pollutant emissions in the
whole operating range
Advantages of fuel injection
better control on air/fuel ratio, both in terms of
precision and repeatability, in all operating
conditions; more uniform distribution among
cylinders; consequently, positive influence on:
o specific fuel consumption
o performance
o pollutant emissions
better transient operation, because of lower fluid
volumes in the system (lower fluid inertia)
higher volumetric efficiency, thanks to lower
pressure losses and no intake manifold heating
it makes possible to increase compression ratio,
because the fuel/air mixture has less time
available for autoignition, or alternatively to use a
fuel with lower octane rating
Internal Combustion Engines 53
Carburetor vs. injection systems
Fuel metering in SI engines
Position of fuel injectors
o Indirect injection (IDI): it takes place in the intake manifold
o Direct injection (DI): fuel is directly injected inside the cylinder
Control of injectors
o Mechanical injection: an engine-driven pump pressurizes the fuel and meters the injected volume
by means of an automatic mechanical injector
o Electronic injection: an electromagnetic fuel injector is used; metering and control of injection are
bestowed upon the ECU
Distribution among cylinders (only for indirect injection)
o Single-point systems: only one or two fuel injectors meter the fuel into the air flow directly above
the throttle body
o Multipoint port injection: a fuel injector is used for each cylinder; fuel is injected into the intake
port of each cylinder
Internal Combustion Engines 54
Classification of injection systems
Internal Combustion Engines 55
Injection systems
Fuel metering in SI engines
Bosch Electromagnetic Injector
(electronic injection system)
1. Filter
2. Electric wire
3. Winding
4. Winding armature
5. Needle valve
6. Needle tip
7. Fuel pipe
8. Tightening ring
9. Seal ring
10.Seal ring
Direct Injection (DI, left)
and Indirect Injection (IDI, right)
1. Injector
2. Intake manifold
3. Intake valve
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Internal Combustion Engines 56
MultiPoint Fuel Injection (MPFI)
Fuel metering in SI engines
11.Throttle switch
12.Air flow sensor
13.Air temperature sensor
14.Lambda sensor
15.Coolant temperature sensor
16.Auxiliary air device
17.Crankshaft angle sensor
18.Battery
19.Ignition and starting switch
20.HVAC switch
1. Fuel tank
2. Fuel pump
3. Fuel filter
4. Pressure regulator
5. Electronic Control Unit (ECU)
6. Ignition coil
7. HT distributor
8. Spark plug
9. Injector
10.Throttle valve
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Internal Combustion Engines 57
Direct injection system (Bosch)
Fuel metering in SI engines
Solenoid (HDEV5) and piezo (HDEV 4.1) injectors
Metering accuracy 2 mg/inj
up to 3 injections per cycle (up to 5 inj/cycle for
stratified-charge combustion)
Source: A. Heinstein et al., High-pressure Direct Injection Systems for Gasoline Engines , MTZ Worldwide, March 2013
HDEV5 HDEV4.1
Fuel metering in SI engines
Problems arising with direct injection systems:
Higher mechanical and thermal stress
The injectors must withstand pressure and temperature levels that are reached inside the cylinder;
furthermore, they are subject to dirt and soot particles originating from the combustion process.
Installation complexity
Direct injection requires that the injector be mounted directly on top of the cylinder, where spark plug
and intake and exhaust valves are placed too.
Higher injection pressure
Direct injection systems need at least 3540 bar in order to achieve the correct fuel vaporization and
mixing with the air inside the cylinder (modern injection systems reach pressures up to 200 bar).
In the case of indirect injection systems, an injection pressure of 45 bar is good enough.
More difficult mixture homogenization
In order to achieve a mixture homogenization comparable to indirect injection systems, the air intake
system needs to be more sophisticated, so as to increase turbulence (through swish, squish and
tumble motions): a high degree of turbulence speeds evaporation of fuel, enhances air-fuel mixing
and increases combustion speed and efficiency.
Internal Combustion Engines 58
Direct vs. Indirect injection systems
Fuel metering in SI engines
Advantages of direct injection systems:
Evaporative cooling
In indirect injections systems, fuel vaporization takes place in the intake manifold and it subtracts
heat from the manifold walls and from the intake valve; in direct injection systems, on the contrary,
fuel vaporization takes place inside the cylinder, so that it cools the induced air, with a double
benefit:
o higher density -> higher volumetric efficiency: torque output increases by approximately 56%;
o lower temperature -> lower risk of detonation (knocking) -> compression ratio can be increased
(by approx. 20%) -> significant improvements in efficiency and fuel consumption are possible.
Cold start and transients
Direct injection removes the problem of fuel condensation on the intake manifolds walls or on the
intake valve, which is particularly important during transient behaviors and at cold start: both fuel
consumption and CO and HC pollutant emissions are reduced.
Longer valve overlap period possible
Fuel injection is carried out when both valves are closed, so the induced air does not contain any
fuel, and thus in the overlap period there is no risk of fuel flowing back to the intake manifold (with
the possible risk of backfire) or of fuel loss with exhaust gases.
Internal Combustion Engines 59
Direct vs. Indirect injection systems
Fuel metering in SI engines
Indirect
injection
Direct
injection
[cm3] 3498 3498
10,7 12,2
[bar] 45 200
[kW] 200 215
[rpm] 6000 6400
[bar] 11,4 11,5
/ [kW/l] 57,2 61,5
[Nm] 350 365
[bar] 12,6 13,1
/ [Nm/l] 100,0 104,3
, [g/kWh] 240 235
(part load) [g/kWh] 360 290
Internal Combustion Engines 60
Direct vs. Indirect injection systems
Source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
T
n [rpm]
Fuel injection in CI engines
CI engines use low-volatility fuels: the fuel must
therefore be injected into the induced air in the form
of droplet spray, and the drops should be as
small as possible.
The air/fuel ratio must be close to the stoichiometric
value only locally, i.e. close to the injector; overall,
the fuel/air mixture can be lean, which allows to
control power output just through the mass of fuel
injected, without the need of controlling also the
mass of air induced.
On the other hand, the fuel/air equivalence ratio
cannot exceed threshold levels given by the
following reasons:
o pollutant emission
o mechanical stresses
o thermal stresses
Internal Combustion Engines 61
General remarks
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Rotational speed n
Bra
ke m
ean e
ffective p
ressure
(bm
ep)
[MP
a]
rps
rpm
Power
Internal Combustion Engines 62
Indirect injection (prechamber) and direct injection
Fuel injection in CI engines
Indirect injection (prechamber)
1. Injector
2. Prechamber
3. Glow plug (used as a cold-starting aid)
Direct injection
Reduction of heat losses (no heat exchange
with the prechamber walls) -> increase in fuel
efficiency
On the other hand, injection pressure must be
significantly higher
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Fuel injection in CI engines
Internal Combustion Engines 63
Common Rail Fuel Injection System
Fuel injection in CI engines
Internal Combustion Engines 64
Common Rail: injector
Open injector Closed injector
High pressure
fuel inlet
Solenoid
actuator
Two-way valve
High pressure
fuel inlet
Solenoid
actuator
Two-way valve
Electrical
connection
Fuel leak back
(return)
Nozzle open Nozzle closed
Injector valve
open
Injector valve
closed
Solenoid energized Solenoid not energized
Fuel pressure is relieved above
the valve control plunger
Balance of forces: Fa > Fc+Fe
Fuel pressure is the same above
and below the valve control plunger
Balance of forces: Fa < Fc+Fe
Fuel injection in CI engines
Internal Combustion Engines 65
Common Rail: injector characteristics
Source: D. Schppe et al., Servo-Driven Piezo Common Rail Diesel Injection System, MTZ Worldwide, March 2012
Fuel injection in CI engines
Internal Combustion Engines 66
Common Rail: multiple injections
Internal Combustion Engines 67
Common Rail: application examples
Fuel injection in CI engines
Cursor 11 Euro VI engine series, used for commercial truck propulsion (FPT Industrial)
Fuel injection in CI engines
Internal Combustion Engines 68
Common Rail: application examples
Vector V20 engine series, used in power generators (FPT Industrial)
Performance maps are usually drawn with reference
to full-load operation (full-load performance maps)
and represent power, torque and fuel consumption vs.
rotational speed.
Torque depends on and , so its maximum lies
where volumetric efficiency is highest, and falls
rapidly because of the decrease in mechanical
efficiency.
Beyond a particular value of rotational speed, the
speed increase cannot compensate the decrease in
mechanical and volumetric efficiency: therefore that
operating point () corresponds to the maximum
power output of the engine.
The operating range of the engine is usually limited to
a maximum speed only slightly higher than
, because there is no point in using the
decreasing part of the power curve.
Fuel specific consumption depends only on the
overall fuel conversion efficiency .
Internal Combustion Engines 69
Power, torque and fuel specific consumption curves
Operating characteristics and performance maps
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Power
Fuel specific consumption
Torque
This chart shows the performance map of a
naturally aspirated 4S SI engine
(displacement 2525 cm3).
The brake mean effective pressure curve has
the same shape of the torque curve, because:
Curves do not start from zero power output
but from a minimum speed, below which
excessive vibrations and irregular operating
conditions would arise.
The operating range goes from the minimum
speed up to a maximum speed slightly higher
than the maximum power operating point.
Internal Combustion Engines 70
Power, torque and brake mean effective pressure curves of a SI engine
Operating characteristics and performance maps
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Engine characteristics:
Turbocharged
Direct injection
Displacement = 4134 cm3
The torque rises very fast at low speeds,
then it is maintained constant over a wide
range of speed, and finally decreases at high
speeds. This behavior depends on:
the turbocharger characteristics;
the limits on the fuel/air equivalence ratio.
Internal Combustion Engines 71
Performance map of a CI engine
Operating characteristics and performance maps
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
T
n [rpm]
The chart on top shows the performance map of two
similar SI 4S naturally aspirated engines of different
displacement.
Displacement does not affect bmep
(there is only a marginal influence on the volumetric
efficiency related to valve area).
Therefore, torque and power output increase linearly
with the increase in displacement, on the whole
operating range.
The bottom chart shows the performance map of two
CI 4S engines, same displacement ( = 2500 cm3),
different number of valves.
The volumetric efficiency increases significantly in the
4-valve engine: this results in a higher torque output.
The increase in power output is even more
pronounced because the 4-valve engine has a wider
speed range (the valves are smaller and lighter, so can
withstand higher velocities).
Internal Combustion Engines 72
Influence of displacement and number of intake valves
Operating characteristics and performance maps
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Operating characteristics and performance maps
Internal Combustion Engines 73
SI automotive engine performances
Design characteristics and performance of some SI 4S supercharged engines for automotive applications, built by European companies from 2001 to 2007
Source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
1 2 3 4 5 6 7
Year 2001 2006 2002 2002 2005 2006 2007
[cm3] 1998 1598 1796 1796 1390 1798 2979
Supercharging Turbo Turbo Mech. Mech. Mech. + Turbo Turbo 2 Turbo in //
Injection Indirect Indirect Indirect Direct Direct Direct Direct
8,8 8,8 8,7 10,5 10,0 9,4 10,2
[bar] 120 120 150 200
[kW] 140 132 141 125 125 118 225
/ [kW/l] 70 82,6 78,5 69,6 89,9 65,6 75,5
[rpm] 5400 5500 5800 5300 6000 5000 5800
[Nm] 250 230 260 250 240 250 400
/ [Nm/l] 125,1 144 144,8 139,1 172,7 139 134,3
(max) [bar] 15,7 18,1 18,2 17,5 21,7 17,4 16,8
(min) [g/kWh] 239 < 250 < 235
Operating characteristics and performance maps
Internal Combustion Engines 74
CI automotive engine performances
Design characteristics and performance of some CI 4S turbocharged engines for automotive applications, built by European companies from 1999 to 2006
Source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
1 2 3 4 5 6 7 8 9 10 11 12 13
Year 1999 2001 2002 2003 2004 2004 2004 2004 2005 2005 2005 2005 2006
[cm3] 3900 1995 2148 3936 2460 2967 2497 1991 1493 2993 2987 4134 3996
Turbocharging
2
Turbo
in //
Turbo Turbo
2
Turbo
in //
Turbo Turbo Turbo Turbo Turbo
2
Turbo,
series
Turbo
2
Turbo
in //
Turbo
Injection CR
I gen.
CR
II gen.
CR
II gen.
CR
II gen.
CR
II gen.
CR
II gen.
CR
II gen.
CR
II gen. CR
CR
III gen.
CR
III gen.
CR
III gen.
18 17 18 17,3 18 17,1 17 18 18 16,5 18 16,5 17
[bar] 1350 1600 1600 1600 1600 1600 1600 1600 1600 1600 1600
n. of injections 1 pilot up to
5 2 pilot 2 pilot > 1 2 pilot 2 pilot 2+1+2 5
[kW] 175 110 110 202 128 171 130 103 70 200 165 240 231
/ [kW/l] 44,9 55,1 51,2 51,3 52,0 57,6 52,1 51,7 46,9 66,8 55,2 58,1 57,8
() [rpm] 4000 4000 4200 3750 3500 4000 4200 4000 4400 3800 3750 3600
[Nm] 560 330 340 650 400 450 400 300 210 560 510 650 730
/ [Nm/l] 143,6 165,4 158,3 165,1 162,6 151,7 160,2 150,7 140,7 187,1 170,7 157,2 182,7
() [rpm] 1750-
2500 2000 2000
1800-
2500 2000
1400-
3250 2000
1600-
3000
1800-
2800 2000
1600-
2800
1600-
3500 2200
[bar] 18,0 20,8 19,9 20,8 20,4 19,1 20,1 18,9 17,7 23,5 21,5 19,8 23,0
[g/kWh] 207 202 205 198 202 202 206 208 202
Operating characteristics and performance maps
Internal Combustion Engines 75
Performance of 4S, 4-cylinder automotive engines
* Direct control system of valve opening, with no throttle valve.
Design characteristics and performance of the Alfa Romeo Giulietta engines.
Source: http://www.alfaromeo.it/it/Documents/schede-tecniche/GiuliettaSchedaTecnica-ConsumiPrestazioniEmissioni.pdf (last retrieved December 2013).
1 2 3 4 5 6 7 8 9 10
Fuel Gasoline Gasoline Gasoline Gasoline Gasoline LPG Diesel Diesel Diesel Diesel
[cm3] 1368 1368 1368 1368 1742 1368 1598 1956 1956 1956
Turbocharging
Turbo,
inter-
cooler
Turbo,
inter-
cooler
Turbo,
inter-
cooler
Turbo,
inter-
cooler
Turbo,
inter-
cooler
Turbo,
inter-
cooler
Turbo,
inter-
cooler
Turbo,
inter-
cooler,
var.
geom.
Turbo,
inter-
cooler,
var.
geom.
Turbo,
inter-
cooler,
var.
geom.
Air inlet Multiair* Multiair*
Injection MPFI MPFI MPFI MPFI DI MPFI Multijet 2 Multijet 2 Multijet 2 Multijet 2
9,8 9,8 9,8 9,8 9,25 9,8 16,5 16,5 16,5 16,5
[bar] 1600 1600 1600 1600
[kW] 77 88 125 125 173 88 77 103 125 125
/ [kW/l] 56,3 64,3 91,4 91,4 99,3 64,3 48,2 52,7 63,9 63,9
() [rpm] 5000 5000 5500 5500 5500 5000 4000 3750 4000 4000
[Nm] 206 206 250 250 340 206 320 350 350 350
/ [Nm/l] 150,6 150,6 182,7 182,7 195,2 150,6 200,3 178,9 178,9 178,9
() [rpm] 1750 1750 2500 2500 1900 1750 1750 1500 1750 1750
[bar] 18,9 18,9 23,0 23,0 24,5 18,9 25,2 22,5 22,5 22,5
Operating characteristics and performance maps
Naturally aspirated SI engine, direct injection,
displacement = Full-load performance map: see Direct vs. Indirect injection systems
Turbocharged CI engine, direct injection,
displacement = Full-load performance map: see Performance map of a SI engine
Internal Combustion Engines 76
Fuel economy characteristics
Image source: R. della Volpe, Macchine, Liguori Editore, Napoli, 2011
Rotational speed [rpm] Rotational speed [rpm]
bmep bmep
Load matching
1. Load requiring constant rotational speed
(as in the case of an electric generator, with the rotational speed linked to the grid frequency):
as a consequence, torque output depends on the external load.
In this case, in order to contain as much as possible any speed fluctuation, power output is divided
among many cylinders and a flywheel with a large moment of inertia is used.
Furthermore, it is possible to optimize the performance, in terms of fuel specific consumption, for
the required operating conditions, taking into account possible load variations.
2. Load requiring torque output increasing as the square of the rotational speed ):
the engine is thus matched to a fluid machine such as compressors, pumps, aeronautical or
marine propellers, etc.
In this case the engine speed at design operating conditions should be as close as possible to the
optimal one for the external load, in order to reduce the size of the gearbox, or if possible avoid
altogether its use. For large marine 2S CI engines, engine speed has even been reduced down to
12 s-1, so as to couple directly the engine to the propeller.
3. Load requiring a wide range of operating conditions, both in terms of speed and torque.
It is for example the case of ground propulsion.
Internal Combustion Engines 77
Typical applications
Internal Combustion Engines 78
Power generation: example of state-of-art engine performance
Load matching
Source: MAN Diesel & Turbo Power Plant Programme
/#0)$QTGOO5VTQMGOO 8'PIKPGURGGF TRO (TGSWGPE[ *\ 'NGEVT)GP5GVRQYGT M9
'NGEVT)GP5GVJGCVTCVGCVNQCF'NGEVTKECNQRVKOKUGF9$6#.WHV M,M9J
.WDGQKNEQPUWORVKQP MIJ 0QOKPCNIGPGTCVQTGHEKGPE[/GVJCPGPQ
/#085$QTGOO5VTQMGOO 8 8'PIKPGURGGF TRO (TGSWGPE[ *\ 'NGEVT)GP5GVRQYGT M9
'NGEVT)GP5GVJGCVTCVGCVNQCF.KSWKFHWGN9$ M,M9J
.WDGQKNEQPUWORVKQP MIJ 0QOKPCNIGPGTCVQTGHEKGPE[
/#0865$QTGOO5VTQMGOO 1RGTCVKQPOQFG 'PIKPGURGGF TRO (TGSWGPE[ *\ 'NGEVT)GP5GVRQYGT M9
'NGEVT)GP5GVJGCVTCVGCVNQCF9QTNF$CPM M,M9J
.WDGQKNEQPUWORVKQP MIJ 0QOKPCNIGPGTCVQTGHEKGPE[
/#0%4$QTGOO5VTQMGOO . . 8 8 8'PIKPGURGGF TRO (TGSWGPE[ *\ 'NGEVTIGPUGVRQYGT M9
'NGEVT)GP5GVJGCVTCVGCVNQCF9QTNF$CPM M,M9J 9QTNF$CPM
OI01Z"
M,M9J
.WDGQKNEQPUWORVKQP MIJ 0QOKPCNIGPGTCVQTGHEKGPE[.V[RG8V[RG
Internal Combustion Engines 79
Power generation: example of state-of-art engine performance and dimensions
Load matching
Source: MAN Diesel & Turbo Power Plant Programme
H
WA B
C
18V48/60TS engine
Performance data
Power per cylinder
Tot. engine power
Tot. el. genset power
Spec. fuel oil consumption
acc. to ISO 3046, without pumps,
mech. Power output, +5% tolerance
Heat Rate
acc. to ISO 3046, without pumps,
mech. Power output, +5% tolerance
NOx emissions (dry at 15% O2)
Mean effective pressure
Spec. lube oil consumption
Dimensions (mm)
1
1050
18,900
18,428
171
7,305
1850
23.2/22.6
0,60
B
5410
2
1100
19,800
19,305
172
7,350
1740
24.3/23.7
0,60
C
24510
3
1150
20,700
20,183
174
7,430
1580
25.4/24.7
0,60
H
9023
4
1200
21,600
21,060
177
7,560
1480
26.5/25.8
0,60
W
4694
Unit
kW
kW
kW
g/kWh
kJ/kWh
mg/Nm3
bar
g/kWh
A
9625
Operation mode
Dry mass (t) 407 407 407 407 407
Internal Combustion Engines 80
Power generation: example of state-of-art engine performance and dimensions
Load matching
Source: MAN Diesel & Turbo Power Plant Programme
With generator (genset) Without generator
In-line engine L32/44CR
Engine type No. of cyl. L L1 W H Weightmm mm mm mm t
6L32/44CR 6 6,312 5,265 2,174 4,163 39.5
7L32/44CR 7 6,924 5,877 2,359 4,369 44.5
8L32/44CR 8 7,454 6,407 2,359 4,369 49.5
9L32/44CR 9 7,984 6,937 2,359 4,369 53.5
10L32/44CR 10 8,603 7,556 2,359 4,369 58.0
V-engine V32/44CR
Engine type No. of cyl. L L1 W H Weightmm mm mm mm t
12V32/44CR 12 7,195 5,795 3,100 4,039 70
14V32/44CR 14 7,970 6,425 3,100 4,262 79
16V32/44CR 16 8,600 7,055 3,100 4,262 87
18V32/44CR 18 9,230 7,685 3,100 4,262 96
20V32/44CR 20 9,860 8,315 3,100 4,262 104
All weights and dimensions are for guidance only and apply to dry engines without flywheel. Masses include built-on lube oil automatic filter, fuel oil filter and electronic equipment.Minimum centreline distance for twin engine installation: 2,500 mm (L32/44CR), 4,000 mm (V32/44CR). More information available upon request.
GenSet dimensions
A mm 7,470 8,530 7,055 8,315 9,575
B mm 4,328 4,328 4,376 4,376 4,376
C mm 11,795 12,858 11,431 12,691 13,951
W mm 2,676 2,676 4,200 4,260 4,260
H mm 4,975 4,975 5,000 5,200 5,200
Dry mass t 84 97 117 144 172
Load matching
Internal Combustion Engines 81
Power generation: plant layout
Source: Wrtsil, Power Plants Solutions 2013
Load matching
Internal Combustion Engines 82
Power generation
Source: extract from The largest recip-based power plants worldwide, Modern Power Systems, February 2014, pp. 18-21.
Facilities of 80 MW or more, operating or under construction
Name Location Capacity MW Fuel Year1 Configuration E/G supplier
Aratu, Salvador Brazil 1056 Diesel U/C 120 x 18V32/40 in 6 units MAN Diesel & Turbo
IPP3 Jordon 573 Tri-fuel 2014 38 x 50DF Wrtsil
Quisqueya I+II Dominican Republic 430 HFO, nat gas 2013 12 x 18V50DF + 12 x 18V50DF Wrtsil
Boyuk Shor Azerbaijan 384 Nat gas 2013 21 x SG Wrtsil
Suape II Brazil 382.5 HFO 2011 17 x 46F Wrtsil
Geramar I+II Brazil 331.8 HFO 2010 38 x 20V32 Wrtsil
Sangachal Baku, Azerbaijan 306.8 FO, nat gas 2012 18 x 16.6 MW 50DF Wrtsil
Coloane, Macau China 271.4 CC HFO, diesel 1978-97 2x24, 2x38.6, 2x53.1, +2x20 ST MAN D&T, Pter Brotherhood
Aliaga Alosbi-II2 Izmir, Turkey 270.6 CC HFO, nat gas 20074 x 18V46, 28 x 20V34SG, 2 x 13.5 MW steam
Wrtsil
Pavana III Honduras 267.2 Oil 2004 16 x 18V46 Wrtsil
Kiisa ERPP 1 & II Estonia 250 Nat gas, LFO 2013-4 27 x W20V34DF Wrtsil
Choloma Honduras 250 HFO 2004-5 14 x 18V48/60 MAN Diesel & Turbo
IPP4 Jordan 240 HFO, DFO, gas 2014 16 x 50DF Wrtsil
Bauang La Union Philippines 241.5 HFO 1994 21 x 16ZA40S Sulzer, Alstom
Plains End, Colorado3 USA 231 Nat gas 2002, 2006 20xW18V34SG, 14xW20V34SG Wrtsil
STEC Red Gate, Texas USA 225 Nat gas 2014 12 x 50SG Wrtsil
Port-Est Reunion 222 HFO 2010 12 x 18V48/60 MAN Diesel & Turbo
Port Westward Unit 2, Oregon USA 220 Nat gas 2015 12 x 50SG Wartsila
Atlas Pakistan 220 Furnace oil 2009 11 x 18V48/60 MAN Diesel & Turbo
Kribi Cameroon 216 Nat gas/LFO 2013 Wrtsil
Pearsall, Texas USA 202.5 Nat gas 2010 24 x 20V34SG Wrtsil
Linhares Brazil 204 Nat gas 2010 24 x 20V34SG Wrtsil
Pesangarran, Bali Indonesia 200 Nat gas, HFO 2014-5 12 x 50DF Wrtsil
Nishat Pakistan 200 HFO 2010 11 x 18V46 Wrtsil
Nishat Chunian Pakistan 200 HFO 2010 11 x 18V46 Wrtsil
Vasavi India 200 HFO 1998 4 x 12K90MC-S MAN D&T, Hyundai, ABB
Liberty Power Tech Pakistan 200 CC HFO 2010 11 x 18V46, CC plant (1xST) Wrtsil
Sasolburg South Africa 175 Nat gas 2012 18 x W20V34SG Wrtsil
Viana Brazil 175 HFO 2009 20 x 20V32 Wrtsil
La Paz (Baja California Sur) Mexico 173 Diesel oil 2005-13 4 units, CC plant Man Diesel & Turbo
Eklutna, Arkansas USA 171 Nat gas, LFO 2014 10 x W18V50DF Wrtsil
Cear Brazil 168 HFO 2010 8 x 20V46F Wrtsil
Clifton Pier Bahamas 165 HFO 19631 x 6 MW, 4 x 10 MW, 2 x 26.5 MW, 2 x 33 MW
Sulzer, MAN Diesel & Turbo
Campina Grande Brazil 164 HFO 2010 20 x 20V32 Wrtsil
King Salmon California 163 Nat gas, diesel 2010 10 x 18V50DF Wrtsil
Cntrl Termica Ressano Garcia Mozambique 162 Nat gas 2014 18 x 34SG Wrtsil
Planta Arizona Guatemala 160 HFO, LFO 2003 10 x 18V46 Wrtsil
Sapugaskanda Sri Lanka 160 HFO 1984 16 x 10 MW SEMT, MAN D&T, Siemens
Attock Pakistan 160 HFO 2008 9 x 18V46 Wrtsil
Load matching
*GCVDCNCPEGQHC&%%RTQEGUU
'NGEVTKECNRQYGTVQITKF 'NGEVTKECNRQYGT .6EQQNKPIYCVGT
4CFKCVKQPKPENIGPGTCVQTNQUUGU
*6EQQNKPIYCVGT
*6EQQNKPIYCVGT
#WZKNKCT[UVGCO
%CDNGVTCHQNQUUGU
#WZKNKCT[RQYGT
'ZJCWUVICUJGCV
.QUUGU
4GEQQNKPI
'
N
G
E
V
T
K
E
C
N
R
Q
Y
G
T
'
Z
J
C
W
U
V
I
C
U
J
G
C
V
5VGCORTQEGUU
6
T
C
P
U
H
Q
T
O
G
T
U
V
C
V
K
Q
P
HWGNGPGTI['PIKPGRTQEGUU
'ZCORNGHQTC&%%RQYGTRNCPV
CP[QVJGTGPIKPGEQPIWTCVKQPKURQUUKDNG
0QCPFGPIKPGV[RG 85KPINGE[ENGPGVRNCPVQWVRWV M95KPINGE[ENGPGVGHEKGPE[ 5VGCOVWTDKPGIGPUGVRQYGT M9&%%PGVRNCPVQWVRWV M9&%%PGVRNCPVGHEKGPE[ 9CVGTEQQNGFEQPFGPUGT
Chimney
Condensate pre-heater
To radiator From radiator
Silencer
ed water tank
LP feed water pumpHP feed water pump
LP steam drumHP steam drum
Condensate tankCondensate pump
EngineHT cooling water
LP steam
HP steamAlternator
Gearbox
Steam turbine
Exhaust steam duct
Air cooled condenser
Boiler bypassExhaust gas boiler
&%%4GHGTGPEG#VNCU2QYGT
4GHGTGPEG2TQLGEV
%WUVQOGT #VNCU2QYGT#RRNKECVKQP $CUGNQCFRQYGTRNCPV&KGUGN%QODKPGF%[ENG.QECVKQP .CJQTG2CMKUVCP0QCPFGPIKPGV[RG 8UVGCOVWTDKPG2NCPVQWVRWV /9(WGN *(1%QOOKUUKQPKPI &GEGODGT1RGTCVKQP/CKPVGPCPEG 1/EQPVTCEVHQT[GCTU
Internal Combustion Engines 83
Diesel Combined Cycle (DCC)
Source: MAN Diesel & Turbo Power Plant Programme
Load matching
Internal Combustion Engines 84
Combined Heat and Power generation (CHP)
Source: MAN Diesel & Turbo Power Plant Programme
&KUVTKEV*GCVKPI0GVYQTM
&KUVTKEV*GCVKPI9CVGT'PIKPG.WDG1KN'PIKPG,CEMGV%#%'PIKPG'ZJCWUV)CU$CEMWR%QQNKPI
$[RCUU 9*4$
*6*GCV4GEQXGT[
.WDG1KN*GCV4GEQXGT[
%#%
%#%
$CEMWR%QQNGT*6
$CEMWR%QQNGT.WDG1KN
%JKOPG[
)
'NGEVTKEKV[
*QVYCVGTIGPGTCVKQPHQTFKHHGTGPVCRRNKECVKQPU
$CUGFQP8)+51EQPFKVKQPUCPFGHEKGPEKGUXCNKFHQT 4GVWTPNKPGVGORGTCVWTG% 5WRRN[NKPGVGORGTCVWTG%
'PGTI[QYFKCITCOHQTJQVYCVGTCRRNKECVKQPU
Fuel Input 100%
Electricity toGrid 45.5%
Total CHP efciency 90%
Heat to heatconsumers 44.5%
P
l
a
n
t
a
u
x
i
l
i
a
r
i
e
s
,
t
r
a
f
o
l
o
s
s
e
s
0
.
8
%
E
l
e
c
t
r
i
c
a
l
o
u
t
p
u
t
4
6
.
3
%
H
i
g
h
t
e
m
p
e
r
a
t
u
r
e
h
e
a
t
3
9
.
5
%
L
o
w
t
e
m
p
e
r
a
t
u
r
e
L
o
s
s
e
s
9
.
2
%
h
e
a
t
5
%
Internal Combustion Engines 85
CHP systems: example of state-of-art engine performance
Load matching
GE Power & Water, J920 FleXtra Jenbacher
Installed Dimensions Length Width Height Weight
Engine 8.4 m 2.9 m 3.3 m 87 t
Generator 5.2 m 2.5 m 2.9 m 54 t
TCA Module 3 m 6.4 m 3.4 m 36 t
Key Performance DataPerformance Data J920
(50Hz / 1,000 rpm)J920 (60Hz / 900 rpm)
Electrical Output 9,500 kW 8,550 kW
Electrical Efficiency 48.7% 48.7%
Heat Rate 7,392 kJ/kWh 7,392 kJ/kWh
Thermal Output 8,100 kWth 7,300 kWth
Total Efficiency 90% 90%
Output and efficiency at generator terminals, ISO 3046, Nat. Gas MN >80, Power Factor 1.0, 500 mg/Nm3 (@ 5% O2) NOx, Efficiency at LHV
Ins
En
Ge
TC
Internal Combustion Engines 86
CHP systems: example of state-of-art engine performance
Load matching
GE Power & Water, Jenbacher Type 6 Gas Engines
1) Electrical output based on ISO standard output and standard reference conditions according to ISO 3046/I-1991 and p.f. = 1.0 according to VDE 0530 REM with respective tolerance; minimum methane number 80 for natural gas
All data according to full load and subject to technical development and modification.
outputs and efficiencies
technical data
1) Dimensions and weights are valid for 50 Hz applications.*J624 with 2-stage turbocharging
Dimensions l x w x h (mm)1Configuration V 60Bore (mm) 190Stroke (mm) 220Displacement/cylinder (lit) 6.24Speed (rpm) 1,500 (50 Hz); 1,500 with gearbox (60 Hz)Mean piston speed (m/s) 11 (1,500 1/min)
Scope of supply Generator set, cogeneration system, containerized package
Applicable gas types Natural gas, flare gas, biogas, landfill gas, sewage gas. Special gases (e.g., coal mine gas, coke gas,
wood gas, pyrolysis gas)
Engine type J612 GS J616 GS J620 GS J624 GS*No. of cylinders 12 16 20 24Total displacement (lit) 74.9 99.8 124.8 149.7
Containerized package J612 - J620 15,000 x 6,000 x 7,300Generator set J612 GS 7,600 x 2,200 x 2,800
J616 GS 8,300 x 2,200 x 2,800J620 GS 8,900 x 2,200 x 2,800
J624 GS* 12,100 x 2,450 x 2,900
Cogeneration system J612 GS 7,600 x 2,200 x 2,800J616 GS 8,300 x 2,200 x 2,800J620 GS 8,900 x 2,200 x 2,800
J624 GS* 12,100 x 2,450 x 2,900
J612 GS J616 GS J620 GS J624 GS*Generator set 20,600 26,000 30,700 49,900Cogeneration system 21,100 26,500 31,300 49,500
Weights empty (kg)1
Natural Gas 1,500 rpm | 50 Hz 1,500 rpm | 60 Hz
NOx < Type Pel (kW)1 el (%) Pth (kW) th (%) tot (%) Pel (kW)1 el (%) Pth (kW) th (%) tot (%)
500 mg/m3N
612 2,004 44.8 1,883 42.0 86.8 1,984 44.3 1.902 42.5 86.8616 2,679 44.9 2,510 42.0 86.9 2,652 44.4 2.535 42.5 86.9620 3,352 44.9 3,110 41.7 86.6 3,319 44.5 3.141 42.1 86.6624* 4,313 46.1 3,931 41.6 87.7
250 mg/m3N
612 2,004 43.5 1,932 42.0 85.5 1,984 43.1 1.952 42.4 85.5616 2,679 43.6 2,575 41.9 85.6 2,652 43.2 2.601 42.4 85.6620 3,352 43.7 3,211 41.8 85.5 3,319 43.2 3.244 42.3 85.5624* 4,313 44.3 4,101 42.1 86.4
Biogas 1,500 rpm | 50 Hz 1,500 rpm | 60 Hz
NOx < Type Pel (kW)1 el (%) Pth (kW) th (%) tot (%) Pel (kW)1 el (%) Pth (kW) th (%) tot (%)
500 mg/m3N
612 1,818 42.8 1,787 42.1 84.9 1,800 42.4 1,805 42.5 84.8616 2,433 42.9 2,385 42.1 85.0 2,408 42.5 2,409 42.5 85.0620 3,044 43.0 2,982 42.1 85.1 3,013 42.6 3,012 42.5 85.1
250mg/m3N
612 1,818 42.3 1,805 42.0 84.3 1,800 41.9 1,823 42.4 84.3616 2,433 42.4 2,405 42.0 84.4 2,408 42.0 2,429 42.4 84.4620 3,044 42.5 3,008 42.0 84.5 3,013 42.1 3,038 42.4 84.5
*J624 with 2-stage turbocharging
In order to make the best use of the power available on the
whole operating range, the ideal performance map requires:
o constant power output
o torque decreasing (with a hyperbolic law) with the
rotational speed
At low speeds, before reaching maximum power output, the
performance map should have the following characteristics:
o constant torque (limited by tire-ground adhesion conditions)
o power linearly increasing with rotational speed
In order to approximate the ideal characteristic as much as
possible, a gear shift (and a clutch) is needed in order to
change the speed ratio between engine shaft and wheels:
the plot on the right shows the use of a discontinuous four-
speed gearbox
Force transmitted to the wheels is proportional to torque
Internal Combustion Engines 87
Ground propulsion: ideal performance characteristics
Load matching
Image source: M. Ehsani, Y. Gao, S.E. Gay, A. Emadi, Modern Electric, Hybrid Electric, and Fuel Cell Vehicles, CRC Press LLC, New York, 2005
Vehicle resistance is caused fundamentally by
4 phenomena:
1. tire rolling resistance ( cos )
2. grading resistance ( sin )
3. aerodynamic drag ( 2)
4. acceleration ( d/d)
Taking into account constant cruising speed
conditions ( = 0), rolling and grading
resistance do not depend on vehicle speed
(at least if the influence of on is neglected),
while aerodynamic drag increases with the
square of the vehicle speed:
= + + = +
Engine power output thus depends on vehicle
speed according to the following equation:
= +
Internal Combustion Engines 88
Ground propulsion: vehicle resistance
Load matching
Image source: M. Ehsani, Y. Gao, S.E. Gay, A. Emadi, Modern Electric, Hybrid Electric, and Fuel Cell Vehicles, CRC Press LLC, New York, 2005
az
r
rd
P
P
FMoving direction
r
P
F
Px
z
Moving direction
(a) (b)
FIGURE 2.2Tire deflection and rolling resistance on a (a) hard and (b) soft road surface
Internal Combustion Engines 89
Ground propulsion: vehicle resistance
Load matching
Rolling Resistance Coefficients
Conditions Rolling resistance coefficient
Car tires on concrete or asphalt 0.013Car tires on rolled gravel 0.02Tar macadam 0.025Unpaved road 0.05Field 0.10.35Truck tires on concrete or asphalt 0.0060.01Wheels on rail 0.0010.002
Moving direction
High pressure Low pressure
Vehicle Type
Open convertible
Van body
0.50.7
0.50.7
0.40.55
0.30.4
0.20.25
0.23
0.150.20
0.81.50.60.70.30.40.60.7
Coefficient of Aerodymanic Resistance
Ponton body
Wedge-shaped body; headlampsand bumpers are integrated intothe body, covered underbody,optimized cooling air flow
Headlamp and all wheels inbody, covered underbody
K-shaped (small breakwaysection)
Optimum streamlined design
Trucks, road trainsBusesStreamlined busesMotorcycles
Aerodynamic resistance (drag)
= +
Rolling resistance =
Source: M. Ehsani, Y. Gao, S.E. Gay, A. Emadi, Modern Electric, Hybrid Electric, and Fuel Cell Vehicles, CRC Press LLC, New York, 2005
Top chart shows that with a given power
output (corresponding to a given vehicle
speed), the fuel consumption is usually
lower at low engine speed than at high
speed.
The bottom chart shows the operating
points of an engine at constant vehicle
speed, with the highest gear and the second
highest gear.
The engine has a much lower operating
efficiency in low gear than in high gear.
Therefore, the fuel economy of a vehicle
can be improved with more gear
transmission or continuous variable
transmission.
Internal Combustion Engines 90
Ground propulsion: specific consumption at constant speed
Load matching
Image source: M. Ehsani, Y. Gao, S.E. Gay, A. Emadi, Modern Electric, Hybrid Electric, and Fuel Cell Vehicles, CRC Press LLC, New York, 2005
Pollutant formation and control
Internal Combustion Engines 91
SI engines: formation mechanisms
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Oil layers absorb HC
COMPRESSION COMBUSTION EXPANSION EXHAUST
Deposits
absorb HC
Unburned mixture
forced into
crevices
NO forms in high-temperature
burned gas
CO present at high T
or with fuel-rich mixtures
Outflow of HC
from crevices;
some HC
burns
As burned gases cool,
first NO chemistry, then CO chemistry
freezes
Deposits desorb HC
Piston
scrapes HC
off walls
Oil layers
desorb HC
Entrainment of
HC from wall into
bulk gas
Carbon monoxide (CO) increases rapidly
as the excess air decreases (rich mixtures);
it is very low for lean mixtures.
Unburned hydrocarbons (HC) too are high
for rich mixtures, and decrease as the
air/fuel ratio increases even beyond the
stoichiometric ratio, up to a threshold level
beyond which a fraction of the HC are not
oxidized during the final part of the working
cycle due to the decrease in temperature.
The formation of nitrogen oxides (NOx)
is facilitated by high temperatures and high
oxygen content: maximum emissions are
found for slightly lean mixtures ( 0,9).
Internal Combustion Engines 92
SI engines: influence of air/fuel ratio
Pollutant formation and control
Image source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Air equivalence ratio
Air/fuel ratio
Nitro
gen o
xid
es [ppm
as N
O]
Unburn
ed h
ydro
carb
ons [ppm
as C
1]
Carb
on m
onoxid
e C
O [%
]
Fuel consum
ption [g/M
J]
Rich
mixture
Lean
mixture
Nitrogen
oxides
Fuel
consumption
Unburned
hydrocarbons
Carbon monoxide
Internal Combustion Engines 93
SI engines: typical emissions with no control system
Pollutant formation and control
Operating mode -> Idle Acceleration Constant speed Deceleration
CO2 [%] 9,5 10,5 12,5 9,5
CO [%] 2,0 2,0 0,4 2,0
HC [ppm as C1] 4000 2500 2000 20000
NOx [ppm as NO] 100 1500 1000 100
Values given as volume fractions on a dry basis.
All main pollutants are emitted in significant quantities in all operating modes.
Therefore, a pollutant control system that can operate at the same time on CO, HC, NOx is needed.
Source: G. Ferrari, Motori a combustione interna, Il Capitello, Torino, 1996
Exhaust gas recirculation (EGR)
It allows to control NOx formation by
diluting the mixture with inert gases,
thus achieving the same result given
by an increase in air/fuel ratio
without the corresponding increase
in oxygen available.
Three-way catalytic converter
It performs the oxidization of CO, HC and
the reduction of NOx at the same time,
thanks to catalysts (noble metals such as
platinum for oxidization or rhodium for
reduction) capable to promote chemical
reactions even at relatively low
temperature.
Internal Combustion Engines 94
SI engines: pollutant emission control
Pollutant formation and control
Image source: G. Ferrari, Motori a combustione interna, Il Ca