Upload
others
View
3
Download
0
Embed Size (px)
Citation preview
Every building needs an Energy Efficiency Platform.
• Persistentcommissioning
• Rule-basedcontrols
• Advancedanalytics
• Cutenergycosts
• Reduceddowntime
• Optimizeenergyusage
SeriousEnergyManagerEnergyEfficiencyPlatform
Monitor Manage Analytics Algorithms Adaptive Learning Control
OtherSystems
Monitor Manage
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 1 of 10
Domorethanjustmonitoringandprevention.
The EnERgy EffiCiEnCy PlATfORM that drives ongoing energyefficiency&savingsincommercialbuildings.A secure web-based platform, SeriousEnergy Manager gives building owners and facility managers real-time, always-on insight and control to continuously optimize and cut energy usage in all types of commercial buildings.
TheSeriousDifference:AdvancedAnalytics&ControlsWhile other “energy management” solutions specialize in monitoring and prevention of system failures and malfunctions, SeriousEnergy Manager goes beyond this “one time tune-up” approach. SeriousEnergy Manager continuously drives savings by finding systems out of tune, running at incorrect times, or running inefficiently. The combination of persistent commissioning, proprietary algorithms, and customized settings provides customers with unmatched analytics and rule-based controls to continuously optimize and save energy usage.
getSeriousinsight™AnAlyTiCSSeriousEnergy Manager is powered by advanced SeriousInsight analytics that result in deep insight into energy usage to identify savings opportunities over time. Using adaptive learning processes, SeriousInsight is driven by proprietary algorithms that incorporate:
• Occupancy
• Weather normalization
• Historical data
• Localized tariff information
• Customer-defined baselines
gainCOMPlETECOnTROl• Fully automated, rule-based control options
• Set policies based on energy performance targets or costs
• Granular permission controls for different stakeholders
• Customizable alerts over any time-frame (real-time, daily, weekly, etc.)
Campus, Building Portfolio
Building Zone, Floor, Tenant Space
Room Equipment Component
Table of Contents:
Page 3 Dashboard - Customizable Experience
Page 4 Real-time Trends & Cost Analysis
Page 5 Equipment Capacity Management EPA Benchmarking
Page 6 Spectral Analysis Scatter Plotting
Page 7 For the CFO
Page 8 Efficiency Analyzer Peak Demand Forecasting
Page 9 Policy Manager SeriousAction Reporting
Page 10 Access Controls Administration Tools
SeriousEnergyManagergivesyoutheinsight,analytics,andpowertocontinuouslyoptimize,save,andcontrolenergyusageandcostsovertime-downtoindividualcomponentsofanysystem.Establishandcontrolbudgetsandperformancetargetsatthebuildingportfoliolevel,oracrossanysub-system.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 2 of 10 Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com
TacklethelargestSavingsOpportunitiesinyourBuildingsThe platform’s proprietary algorithms are based on the most typical, largest savings opportunities in buildings.
EnergyWasteProblem Measures SimplePayback
1Air handler is not modulating supply temperature according to demand
Add/optimize supply air temperature reset 4 months
2 Equipment left on e.g. pumps are left on when chillers are off Reduce equipment run-time (off-hours analysis) 3 months
3 The boiler is left on when there is no need for heating Add/optimize boiler lock-out 2 months
4Air handler is not modulating fan speed according to demand
Duct static pressure reset 7 months
5 Chiller is not operating according to building schedule Revise control sequence 3 months-1yr
6Low temperature difference across chiller causes it to operate inefficiently (low delta-T syndrome)
Revise control sequence 1 yr
7 Economizer is not bringing sufficient outside air Optimize air-side economizer 8 months
8 Chilled water plant is using inefficient chiller staging sequence Chiller staging 1 yr
9Cooling tower pump and fan loads are excessive relative to plant load
Add/optimize condenser reset 4 months
10 Chilled water temperature set point is too low for demand Chilled water temperature reset 1 yr
Research of energy waste problems based on Lawrence Berkeley National Laboratory studies.
SeriousROi• Track and analyze energy use and generation in real-time
• Detect, diagnose, prioritize, and control anomalies based on cost savings
• Allow facility teams to be extremely efficient operationally and save time
• Extend life of mechanical systems
• Reduce risk and high costs of potential downtime due to equipment failures
• Track ROI of retrofit measures and capital investments
• Present data to key stakeholders through customizable reports
HighlyCustomizablePolicyManager: Set policies according to energy performance or cost ranges – at building, zone, or equipment level. Policies can be based on any energy variable, cost benchmark or range (currency or percentage), and according to behavioral settings, such as occupancy.
fullyAutomatedControl: Customers have the option to set a control policy for automatic action and scheduling. Or, notifications can be set for any policy, for manual review and where automated control policies are not available.
AlertsandReporting: Notifications can be delivered via SMS or email, delivering alerts and straightforward recommendations to optimize and cut energy usage. Customers can set notifications for any frequency – real-time, daily, weekly, monthly – and per individual users.
getseriousanalysisandcontrolsformoresavings–todayandtomorrow.
Typical simple paybacks range between 3-24 months based on energy savings alone.*
*Payback period varies based on customer’s specific building systems, system demands, and conditions such as location, platform configuration, purchase scenarios, and
other factors.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 3 of 10
DashboardThe dashboard is the always-on control panel that provides a personalized, real-time view of a building’s energy usage and costs. Fully customizable, you can select your favorite information to be displayed on the dashboard for easy, at-a-glance views.
SeriousEnergy widgets give simple, powerful insight into the real-time information you need most, such as:
• Cost comparison
• Energy comparison
• Worst / best performing assets
• BMTD demand gauge
• BMTD consumption
• BMTD energy & cost
• MTD peak demand summary
• Weather
• Alerts
• Today’s kWh performance
• Microgrid state
• Circuit demand
• EPA benchmark tracking
yourTailoredViewintoyourBuilding’sEnergyUsageThe dashboard can be configured for an unlimited number of unique users of your SeriousEnergy Manager. You can customize the dashboard to display the most important information according to each users’ roles and responsibilities immediately upon log on.
Easy-to-Use,CustomizableExperience
fortheCfOThe CFO’s dashboard can be configured to give immediate, real-time access into cost information that impacts the bottom-line. The CFO may choose widgets such as Billing Month-to-Date (BMTD) Cost, BMTD Energy Cost, Month-to-Month Cost Comparison, and Cost Projection, amongst many others, for improved control of energy costs, budgets, and NPV.
fortheDirectorofSustainabilityExample widgets tailored for the responsibilities of Directors of Sustainability include the EPA Benchmark, Today’s Carbon Performance, Month-to-Date (MTD) Water, and MTD Gas.
forthePropertyManagerProperty Managers get an immediate view into the least performing assets, also by percentage and/or kWh, as well as handy widgets such as Today’s kWh Performance.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 4 of 10 Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com
SeriousEnergyManager:PowerfulAnalysis
SeriousEnergyTrendsAnalysisSeriousEnergy Manager gives you the power to drill into your building’s energy usage over any time period. Identify not only any abnormalities, but also sensor issues throughout a building that may lead to missing data points or errors in meter readings. In these cases, SeriousEnergy Manager automatically corrects these values for accurate interpolated values you can count on.
Real-TimeCostAnalysisPerBuilding,PerAssetQuickly determine the areas of highest energy consumption and cost, so you can focus energy savings measures where savings impact will be the greatest - by zone, load, or over any time period.
See energy usage for any building or asset, according to any energy variable you choose. Select variable to plot against. For example, plotting outside temperature and energy demand (kw) can identify if economizers are set to maximize use of free cooling. Customers are alerted to check on stuck dampers
preventing economizer function.
Drill Down: Identify your most costly buildings, floors, tenant areas, and
equipment – quickly and easily.
View energy costs per time of use
Exporting: Save the graph in PDF or Excel formats for use in reports or presentations.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 5 of 10
SeriousEnergyManager:PowerfulAnalysis
EquipmentCapacityManagementSet capacity thresholds for individual equipment, monitor as nearing capacity, and compare month-to-month energy usage – all within one single view. Alerts can be set according to thresholds, making it easier to manage equipment capacity and avoid overage.
Compare Total Energy Costs: Powerful performance reporting compares total energy cost per square foot.
DatacentersFor datacenters within office buildings or universities, SeriousEnergy Manager includes the same comprehensive functionality to identify ‘hot spots’ and optimize and control cooling - no additional hardware or software required.
EPABenchmarkingandEnERgySTAR®RatingKnowyourreal-timeranking&trackprogressTrack and manage whole building energy performance targets critical to receiving and maintaining EPA recognition for superior energy performance. You can monitor your real-time EPA ranking, identify under-performing buildings, and verify efficiency improvements that will further your EPA target goals.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 6 of 10 Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com
SpectralAnalysisEasilyidentifyanomaliesandinconsistenciesinenergyusageovertimeThe spectral analysis generates a ‘heat map’ view, allowing you to quickly identify high and low energy usage according to day of week and time of day, so you can quickly spot anomalies. For instance, inconsistent periods of high and low energy usage might indicate short-cycling or scheduling errors. To create spectral view, SeriousEnergy Manager feeds energy data through custom statistical models to determine the color ranges for the energy intensity. You can easily identify off-hour energy usage and, therefore, straight-forward savings opportunities.
SeriousEnergyManager:AdvancedAnalytics
Color-coded key indicates the energy intensity range and associated value for any given day, week, or month-to-month
period.
Detect&ControlEquipmentMalfunctioninReal-timeScatterPlottinginteractiveAppletGain flexible, detailed insight into any equipment to maintain performance. Set up alerts to be notified of any anomalies if equipment performs out of set ranges or establish rule-based automated controls. Alerts will identify and give straight-forward action recommendations to adjust the malfunctioning components within the equipment.
Facility managers can track real-time performance of any equipment by plotting any combination of two
energy variables.
Fan VFD (variable frequency drive) is locked at full speed,
wasting energy.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 7 of 10
SeriousEnergyManager:TotalCostControl
SeriousEnergyfortheCfOCFOs know that maximizing energy efficiency can be considered permanent energy savings, with the potential of providing cost savings well into the future. In many cases, few areas in a firm’s expense structure have as much cost savings opportunity as energy efficiency. Investments in programs like energy management are evaluated by a CFO, just like any other investment. SeriousEnergy Manager results in direct savings and more efficient use of energy dollars. The platform is also a powerful solution to help evaluate and measure the financial merits of energy efficiency projects such as simple payback period, ROI, and NPV. SeriousEnergy Manager continuously identifies opportunities for profit improvements through cost savings – with better energy accountability, visibility, and management.
ManageyourBudgetSet your budget for a particular building, tenant area, or across your entire building portfolio, and easily track budget vs. actual vs. forecasted energy usage over time. Actual budget is based on the current rate of consumption, localized and accurate tariff information, and the total projected budget based on current consumption. The projected budget bar on the graph will change from blue to red if it exceeds the planned budget.
CustomChargebackControlSeriousEnergy Manager enables the CFO to more easily and accurately account for and chargeback energy usage to individual business units, departments, or building tenants, allowing for powerful control over custom allocation of energy costs that improves the bottom line.
SeriousEnergy Manager can take into account totalenergycosts for all energy demand and supply sources.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 8 of 10 Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com
PeakDemandforecastingPrioritizeload-sheddingandbettermaximizeincentivesfromdemandresponseprogramsForecast energy demand based on historical data, scheduled occupancy, and external temperature data. You can also simulate “what if” scenarios of the impact of higher or lower temperature predictions by increasing or decreasing predicted temperature.
SeriousEnergyManager:Baselining&forecasting
EfficiencyAnalyzerAccuratelymeasurethesavingsimpactofenergyefficiencyimprovementsThe Efficiency Analyzer compares actual energy consumption against your custom baseline model to continuously monitor and determine whether buildings or individual equipment are increasing or decreasing energy performance. You can more efficiently measure and verify whole building performance and the energy savings impact of your efficiency improvements. SeriousInsight proprietary algorithms incorporate historical energy, temperature, and occupancy scheduling to create highly accurate baseline models for dependable measurement and verification.
Indicates maximum demand predictions exceed the maximum demand for the billing month already incurred on this day.
OptionalPublicDashboardAs an additional feature, customers can easily enable a Public Dashboard, displaying limited, real-time energy performance data. Schools and universities use the Public Dashboard to engage students in practical energy efficiency, while offices and brands leverage the dashboard to engage employees and stakeholders in company-wide sustainability efforts.
See energy waste compared to a normalized baseline
Real-time ranking: compare your worst-to-best performing buildings based on energy
savings %
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 9 of 10
PolicyManagerConfigurepoliciesandnotificationstomakeefficiencyandsavingseasyandachievableThe Policy Manager gives you custom, comprehensive control over equipment and building operations to keep your building and operations as efficient as possible. Policies can be set per building, down to individually metered equipment or energy-source system. For example, administrators use the Policy Manager to:
• Establishbaselinesperasset: over any time period for any metered equipment, you can set energy usage parameters for any individual asset, including EPA rating targets
• Controltemperaturesetpoints: establish rules per equipment to turn off or turn down at certain set points
• Manage your own demand response: over any period of time, based on occupancy or temperature, establish policies to automatically turn systems on or off
For any policy, facility managers can assign privileged access for users to manually over-ride set controls. Where automated controls cannot be assigned for a policy, alerts and notifications can be assigned to unique SeriousEnergy users.
SeriousActionReportingSeriousAction Reporting prioritizes actions for facility managers and property managers, helping them to focus on what really matters to optimize efficiencies – the biggest opportunities for savings. As an added service, SeriousEnergy Manager generates monthly reports of top action items. Our SeriousEnergy specialists consult with customers to optimize straight-forward, prioritized savings opportunities, understand whole building efficiency impacts, and evaluate any capital requests or proposals as they relate to energy consumption.
SeriousEnergyManager:PolicyEngines&ActionableReporting
Real Savings
Policy Violation
Event Filtering
Periodic SeriousAction Reports deliver straight-forward, actionable recommendations for your to optimize systems and save energy
Actionable recommendations
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com Page 10 of 10
SeriousEnergyManager:EasyAdministration&AccessControls
SeriousAdministrationAdvancedsettingsforcomprehensiveanalysisandcontrolsSimple set-up screens allow for easy input of data that are fed into SeriousInsight™ analytics engine and provide for granular user settings, alerts management, and policy settings.
Occupancy Scheduler: Specify occupancy of a building and specific areas within each, such as tenant spaces or departments, over time. This information is used for off-hour analysis to identify anomalous energy usage
and other trending and analysis.
ManageUsersandAlertSettingsAdministrators set and manage privileged controls for unique users of SeriousEnergy Manager, as well as easily configure alerts notifications, such as via phone, email, text message, and for unique types of notifications, so that the people who need to act on SeriousInsight analytics and controls get the information they need, how they need it. Alerts and reporting can be configured to be sent over any time frequency, whether real-time, daily, weekly, etc.
Tariff Scheduler: Browse available tariff plans that can be used to describe their energy costs. Tariffs are applied to assets and are based on local utility rates.
Settings for data output ensure accurate monthly and yearly thresholds, baselining, and localized data
output such as currency and carbon calculations.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com
TheEnergyEfficiencyPlatformthatdrivesongoingenergyefficiency&savingsincommercialbuildings.
RapidROiTypical simple paybacks range between 3-24 months based on energy savings alone.*
Real-time,Always-onSeriousEnergy Manager is a software-as-a-service (SaaS) platform. There is no software and no servers to install, manage or maintain. Gain always-on access to the critical information you need to manage and ensure the energy savings in your building from anywhere, anytime. With SeriousEnergy Manager, energy savings is not only possible, it’s easy and cost-effective.
lowCost,Easy-to-installSolutionSeriousEnergy Manager centralizes control of existing building systems and integrates with all major building management systems and legacy protocols. Hardware agnostic, the platform works with any gateway device and seamlessly integrates with Cisco Mediator and Echelon SmartServer. Set up costs vary depending on already installed building management systems and the number of devices to be metered. In some instances, there are no set up fees. With remote integration and configuration, site visits may not be required.
“We know that people tend to use less energy when they know how much of it they’re using. We’ll be able to provide information now.”
– Scot Horst, USGBC LEED Senior Vice President
© 2011 Serious Energy, Inc. All rights reserved. Serious Energy, the Serious Energy logo, SeriousEnergy, SeriousInsight, SeriousEnergy Manager, SeriousEnergy Manager
logo are trademarks or registered trademarks of Serious Energy, Inc. in the United States and other countries. Information subject to change without notice. P/N: 102-00030-022211
*Payback period varies based on customer’s specific building systems, system demands, and conditions such as location, platform configuration, purchase scenarios, and
other factors.
“Simple to install, simple to manage, simple to leverage, and simple to reap the benefits. Partnering with Serious Energy to integrate our Energy Control Networking technology and their energy efficiency platform
delivers a powerful energy-saving solution that everyone understands – from students to veteran facility managers to the CEO.”
– Anders Axelsson, Echelon’s senior vice-president, commercial markets
SeriousEnergy Manager is the preferred energy management service partner of Echelon’s Building
Energy Management solution
SavemoreEnERgyandmoreMOnEyinyourbuildings.
Calltoday:877-797-1205|+1-408-541-8000|www.SeriousEnergy.com