Upload
others
View
1
Download
0
Embed Size (px)
Citation preview
EVALUATION OF THE PROTECTIVE EFFECT OF MOREL’S
DISEASE VACCINE IN SHEEP
By
NASREEN OMAR MUSA OSMAN,
B.V.Sc. (1998), University of Khartoum
Supervisor: Prof. SULIEMAN MOHAMED EL SANOUSI
A thesis submitted to the Graduate College,
University of Khartoum,
in partial fulfillment of the requirements
for the Ph.D. degree
Department of Microbiology
Faculty of Veterinary Medicine,
University of Khartoum,
April 2009
ii
iii
DEDICATION
To my mother…
Brother….
and husband …
I dedicate this work
iv
PREFACE
This work has been carried out at the Department of
Microbiology, Faculty of Veterinary Medicine,
Department of Microbiology and Molecular Biology,
Institute for Promotion of Animal Export Studies
University of Khartoum, and the Institutes of Tropical
Animals Health and Applied Biotechnology in the Tropics
(IBT), University of Göttingen, Germany, under
supervision and guidance of Professor Sulieman Mohamed
El Sanousi.
v
ACKNOWLEDGEMENTS
First of all, my thanks and gratefulness are due to Almighty Allah,
for helping me to finish this work successfully.
I would like to express my indebtedness and sincere thankfulness
to my supervisor Professor Sulieman Mohamed El Sanousi for his keen
guidance, valuable assistance, advice and encouragement.
I am also grateful to Dr. Muna El Haj (my co-supervisor) for her help.
Thanks extend also to Dr. Abdulkhalig Hassan Babiker for his unlimited
help during the field investigations and guidance in the laboratory work.
I would like to express my deep gratitude to Prof. A.A. Gameel for
the invaluable help in post-mortem and for support and encouragement.
Special thanks are due to Dr. AbduAlazeem Yaseen and Prof. Salih
Ahmed Babiker Abu Salih for their unlimited help in doing the statistical
analysis.
All thanks for my small family and my husband Kamal Eldin
Hassan Ali Eltom for his unlimited help in the field investigations,
immunology, and molecular biology work and for language proof of the
thesis.
Special thanks are due to Hashim Adallah, Hassan El Tikaid, Ali
Gindeel and Gamal Tita for their patience and careful rearing of the
experimental animals during the study.
My thanks are also extended to Abdel Aziz M. Elshaikh, Abbas
Elssafi, Hatim Abdul-Wahab, Abdul-Kareem for technical assistance.
Thanks are also extended to technicians, the laboratory assistants
and labours of the Department Microbiology, particularly Fawziyah M.
Hussein, Muna Mutasim, Abdelmoneim Ramadan, Abdallah, Widad and
Mawahib for their cooperation.
vi
Nobody has been involved more closely than my family (mother,
brother and husband) whom I thank for their unlimited moral support and
encouragement during the period of the study.
Also I would like to express my deepest gratitude to my friends Dr.
Mai Ahmed and Dr. Amani M. Khair for their encouragement.
I wish to express my gratitude to the members of Institute for
Promotion of Animal Exports, especially Amal Yousuf and Kawthar H.
Eltayeb.
My thanks and appreciations are also due to family of the Institute
of Applied Biotechnology in the Tropics (IBT) and the Institute of
Tropical Animal Health of the University of Göttingen, Germany,
especially to Prof. Dr. Dr. Helge Böhnel and to P.D. Dr. Frank Gessler
for their help and support during the molecular biology work. Also I am
thankful to Christian Wagner and Sibyella Rheinmuth for help.
I am grateful and further indebted to my friends Afrah Mohmmed,
Mawahib Abda-Allah Mahasin Showk , and Mona Abda-Allah for their
moral support and encouragement.
vii
ABSTRACT
This study was carried out to assess and evaluate the effect of
Morel’s disease vaccine for sheep. One hundred and seventy pus samples
were obtained from sheep abscesses lymph node at meat inspection in
three different abattoirs and subjected to bacteriological examination.
Staphylococcus spp. were isolated from 68.8% of the pus samples, while
Corynebacterium spp. were isolated from 26.5%. Mixtures of both
organisms were isolated from the rest (4.7%) pus samples.
Isolated staphylococci were subjected to further identification by
biochemical tests and were found to be: 63.2% S. aureus subsp.
anaerobius, 21.3% S. caseolyticus, 11.9% S. aureus, and 0.9% of each of
S. simians, S. lugdunensis, S. warneri and S. epidermidis.
In outbreak of the abscess disease of sheep in Alsamra village,
Khartoum State, morbidity rate was 30%. Of the affected animals, 93.3%
had Morel’s disease, as pus cultures of which yielded S. aureus subsp.
anaerobius and the rest 6.7% had caseous lymphadentitis, as pus cultures
of which yielded Corynebacterium spp.
Comparison between the different isolates of S. aureus subsp.
anaerobius using PCR based techniques (RAPD and polymorphism of
coa and spa genes) showed that all Sudanese isolates were genetically
identical. Complete sequence of the catalase gene of one outbreak isolate
in addition to partial sequence of other two outbreak isolates, six from
two different abattoirs and one reference strain was performed. Sequence
results showed that all Sudanese isolates harbour a catalase gene which is
distinct from the catalase gene of known reference strains suggesting that
all Sudanese isolates originated from one clone. The deduce catalase-like
protein encoded by the catalase gene of local Sudanese strains was found
to be only 345 amino acids in length instead of 505 a.a. in S. aureus
viii
subsp. aureus (NCTC 8325 and Newman strains) and 445 a.a in S. aureus
subsp. anaerobius strain MVF213.
Ability of isolated staphylococci to induce abscess formation was
tested. Except S. aureus and S. aureus subsp. anaerobius, none of the
isolates was able to cause the clinical subcutaneous abscess of Morel’s
disease and only S. caseolyticus formed caseated lymph abscess detected
on post-mortem.
Morel’s disease vaccine, made according to the method of Rodwan
(1996), was injected into sheep at different doses. The animals were
challenged with S. aureus subsp. anaerobius using three times the
minimal abscess causing dose. The minimum protective dose of the
vaccine was found to be 0.5 ml boostered by 0.25 ml after two weeks.
This protocol minimized the known protective dose to the half.
The protective ability of Morel’s disease vaccine against abscesses
due to other two staphylococci was also tested. Lambs vaccinated with
Morel’s disease vaccine were able withstand challenge by S. aureus or S.
caseolyticus (no abscess formation in the sub cutis or in superficial lymph
nodes).
Assessment of the immunity of the sheep vaccinated with Morel’s
disease vaccine was carried out using the Plaque Forming Cell Assay and
by Opsonphagocytosis methods. Number of plaque antibody forming
cells from vaccinated sheep was significantly higher (P<0.05) than from
non vaccinated sheep. Bacteria opsonized for 2 hours by serum of
vaccinated animals caused smaller subcutaneous abscesses in
experimentally infected sheep when compared with that caused by non-
opsonized bacteria. Also, a sharp decrease in the number of opsonized
bacteria was observed indicating that the serum antibodies in response to
vaccination with Morel’s disease vaccine had greatly increased.
ix
68.826.5
4.7
63.221.3
11.90.9
3093.3
6.7
1 .RAPD.
2 .Polymorphism of coa and spa genes.
x
1996
0.5
0.25
P<0.05
xi
TABLE OF CONTENTS
QURAN VERSES................................................................................................................. ii
DEDICATION ..................................................................................................................... iii
PREFACE............................................................................................................................ iv
ACKNOWLEDGEMENTS ................................................................................................... v
ABSTRACT ....................................................................................................................... vii
viiii ............................................................................................................................ المستخلص
TABLE OF CONTENTS ..................................................................................................... xi
LIST OF TABLES ............................................................................................................. xvi
LIST OF FIGURES .......................................................................................................... xvii
INTRODUCTION ................................................................................................................ 1
Objectives of the study .......................................................................................................... 2
CHAPTER ONE: LITERATURE REVIEW .......................................................................... 3
1.1 Abscess disease in sheep (Morel’s disease) ...................................................................... 3
1.2 Pathology of abscess disease............................................................................................ 4
1.3 Abscess formation ........................................................................................................... 6
1.4 The causative agent of abscess disease in sheep ............................................................... 7
1.5 Staphylococci isolated from sheep abscesses in the Sudan ............................................... 8
1.6 Identification and characterization of S. aureus by molecular methods ........................... 13
1.6.1 PCR amplification of the thermonuclease (nuc) gene .................................................. 13
1.6.2 Genetic characterization of Staphylococcus aureus ..................................................... 14
1.6.2.1 Staphylococcus catalase (kat) gene ........................................................................... 14
1.6.2.2 DNA Polymorphism ................................................................................................ 16
1.6.2.3 Staphylocoagulase (coa) gene .................................................................................. 16
1.6.2.4 Staphylococcus protein A gene (spa) ........................................................................ 17
1.6.3 Pulsed-field gel electrophoresis................................................................................... 18
1.6.4 Randomly amplified polymorphic DNA (RAPD) ........................................................ 18
1.7 Molecular characterization of S. aureus subsp. anaerobius isolates from the Sudan ....... 19
1.8 Pathogenicity of Staphylococcus aureus subsp. anaerobius ........................................... 19
1.8.1 Pathogenicity to laboratory animals ............................................................................ 19
1.8.2 Pathogenicity to sheep and goats ................................................................................. 20
1.9 Vaccination against staphylococcal infections ................................................................ 21
1.9.1 Live Staphylococcus aureus vaccines ......................................................................... 21
1.9.2 Killed Staphylococcus aureus vaccines ....................................................................... 22
xii
1.9.3 Cellular components as vaccines ................................................................................. 22
1.10 Recent specific vaccine trials against Morel’s disease in the Sudan .............................. 25
1.11 The haemolytic plaque forming cell assay (PFC) ......................................................... 26
1.12 Opsonophagocytosis .................................................................................................... 26
CHAPTER TWO: MATERILAS AND METHODS ............................................................ 28
2.1 Survey ........................................................................................................................... 28
2.1.1 Collection of samples ................................................................................................. 28
2.1.2 Smears ....................................................................................................................... 28
2.1.2.1 Preparation of smears............................................................................................... 28
2.1.2.2 Gram’s stain ............................................................................................................ 28
2.1.3 Culture methods ......................................................................................................... 28
2.1.3.1 Culturing and purification ........................................................................................ 28
2.1.3.2. Culture media ......................................................................................................... 30
2.1.3.2.1 Solid media ........................................................................................................... 30
2.1.3.2.1.1 Blood Agar Base No. 2 (Oxoid) (g/l) .................................................................. 30
2.1.3.2.1.2 Nutrient agar ...................................................................................................... 30
2.1.3.2.1.3 Urea agar base (g/l) ............................................................................................ 30
2.1.3.2.1.4 Milk agar ........................................................................................................... 31
2.1.3.2.2 Liquid medium ..................................................................................................... 31
2.1.3.2.2.1 Nutrient Broth .................................................................................................... 31
2.1.3.2.2.2 Brain Heart Infusion (g/l) ................................................................................... 31
2.1.3.2.2.3 Peptone water (Oxoid) (g\l) ................................................................................ 32
2.1.3.2.2.4 MR-VP medium (Glucose phosphate medium) ................................................... 32
2.1.3.2.2.5 Peptone water sugars .......................................................................................... 32
2.1.3.2.2.6 Nitrate broth ...................................................................................................... 32
2.1.3.6 Biochemical tests ..................................................................................................... 32
2.1.3.6.1 Aerobic growth ..................................................................................................... 32
2.1.3.6.2 Haemolytic activity ............................................................................................... 33
2.1.3.6.3 Catalase test .......................................................................................................... 33
2.1.3.6.4 Oxidase test .......................................................................................................... 33
2.1.3.6.5 Colony size and colour .......................................................................................... 33
2.1.3.6.7 Coagulase test ....................................................................................................... 33
2.1.3.6.8 Sugar fermentation test ......................................................................................... 34
2.1.3.6.9 Urease test ............................................................................................................ 34
xiii
2.1.3.6.10 Novobiocin sensitivity test .................................................................................. 34
2.1.3.6.11 ß-Galactosidasetest ............................................................................................. 34
2.2 Molecular techniques for characterization of S. aureus subsp. anaerobius isolates ......... 34
2.2.1. TBE Buffer (Tris-Borate-EDTA) 10x (pH 8.3) .......................................................... 35
2.2.2 PCR Master Mix ......................................................................................................... 35
2.2.3 Agarose gel (2%) ........................................................................................................ 35
2.2.4 Isolates for the molecular characterization .................................................................. 35
2.2.5 DNA extraction .......................................................................................................... 35
2.2.6 DNA concentration ..................................................................................................... 36
2.2.7 Purification of the PCR products for sequencing ......................................................... 36
2.2.8 Primers ....................................................................................................................... 36
2.2.9 PCR reaction mixture ................................................................................................. 36
2.2.10 PCR reaction conditions ........................................................................................... 39
2.2.11Gel documentation..................................................................................................... 39
2.2.12 nuc gene detection .................................................................................................... 40
2.2.13 Catalase gene (kat gene) ........................................................................................... 40
2.2.13.1 Amplification of the catalase gene (kat gene) ......................................................... 40
2.2.13.2 Sequencing of the catalase gene ............................................................................. 40
2.2.13.3 Sequence alignment and editing ............................................................................. 40
2.2.14 RAPD-PCR .............................................................................................................. 41
2.2.14.1 RAPD optimization (Confirmatory test for MgCl2) ................................................ 41
2.2.15 Pulsed-field gel electrophoresis (PFGE) .................................................................... 41
2.2.15.1 Buffers .................................................................................................................. 41
2.2.15.1.1 Lysis buffer, pH 7.6 ............................................................................................ 41
2.2.15.1.2 Washing buffer (Tris - EDTA), pH 8.0 ................................................................ 41
2.2.15.2 PFGE Protocol ....................................................................................................... 42
2.3 Animal experiments ...................................................................................................... 43
2.3.1 Pathogenecity of S. aureus subsp. anaerobius ............................................................. 43
2.3.2 Pathogenecity of other staphylococci .......................................................................... 43
2.3.3 Vaccination and challenge .......................................................................................... 44
2.3.3.1 The vaccine ............................................................................................................. 44
2.3.3.1.2 Ingredients of the vaccine ..................................................................................... 44
2.3.3.1.3 Mixing different ingredients of the vaccine ........................................................... 45
2.3.3.2 Evaluation of the effective dose of the vaccine ......................................................... 45
xiv
2.3.3.2.1 Titration of the vaccine ......................................................................................... 45
2.3.3.2.2 Challenge ............................................................................................................. 46
2.3.3.2.2 Evaluation of the vaccine against different staphylococci ...................................... 47
2.3.3.2.2.1 Vaccination and challenge with one Staphylococcus species .............................. 47
2.3.3.2.2.2 Vaccination and challenge with two Staphylococcus species............................... 47
2.3.3.2.2.3 Post-mortem examination................................................................................... 47
2.6 Immunological tests ...................................................................................................... 48
2.6.1 Plaque forming cell assay ........................................................................................... 48
2.6.1.1 Preparation of the antigen ........................................................................................ 48
2.6.1.1.2 Sheep red blood cells (SRBCs) ............................................................................. 48
2.6.1.1.3 Effector cells......................................................................................................... 48
2.6.1.1.4 Agarose ................................................................................................................ 48
2.6.1.1. 5 Complement ........................................................................................................ 48
2.6.1.1.6 Balanced Salt Solution (BSS) ................................................................................ 49
2.6.1.2 Plaque forming cell assay mixture ............................................................................ 49
2.6.1.2 Validity of spleen cells............................................................................................. 49
2.6.2 Opsonophagcytosis tests ............................................................................................. 50
2.6.2.1 Bacterial growth ...................................................................................................... 50
2.6.2.2 Blood samples ......................................................................................................... 50
2.6.2.3Opsonization method ................................................................................................ 50
CHAPTER THREE: RESULTS .......................................................................................... 52
3.1 Survey for sheep abscess disease ................................................................................... 52
3.1.1 Isolates from lymph nodes of animals at meat inspection ............................................ 52
3.1.2 Isolates from outbreak of sheep abscess disease .......................................................... 52
3.2 Properties of staphylococci isolated from sheep abscesses.............................................. 55
3.3 Biochemical properties .................................................................................................. 57
3.9 Molecular biology results .............................................................................................. 62
3.9.1 DNA concentrations ................................................................................................... 62
3.9.2 Nuc gene detection ..................................................................................................... 63
3.9.3 Catalase gene (kat gene) ............................................................................................. 63
3.9.3.1 Detection of the catalase gene .................................................................................. 63
3.9.3.2 Sequencing results of the catalase gene .................................................................... 63
3.9.4 RAPD- PCR ............................................................................................................... 71
3.9.4.1 Optimization of the reaction mixture ........................................................................ 71
xv
3.9.4.2 RAPD- PCR amplification pattern ........................................................................... 71
3.9.5 Polymorphism of coa and spa gene markers ............................................................... 74
3.9.6 Pulsed-field gel electrophoresis (PFGE) ...................................................................... 74
3.4 Pathogenecity of S. aureus subsp. anaerobius and the abscess causing dose ................... 77
3.5 Pathogenecity of other staphylococci ............................................................................. 77
3.6 Determination of the effective dose of the vaccine ......................................................... 81
3.7 Challenge ...................................................................................................................... 83
3.7.1 Challenge using one Staphylococcus species ............................................................... 83
3.7.2 Challenge using two Staphylococcus species ............................................................... 83
3.8 Immunological tests ...................................................................................................... 88
3.8.1 Effect of vaccination with Morel’s disease vaccine on the plaque forming cell (PFCs)
count ................................................................................................................................... 88
3.8.2 Effect of vaccination with Morel’s disease vaccine on the splenic lymphocyte count ... 88
3.8.3 Validity of splenic cells .............................................................................................. 88
3.8.3. Opsonophagocytosis .................................................................................................. 93
CHAPTER FOUR: DISCUSSION ...................................................................................... 95
CONCLUSIONS AND RECOMMENDATIONS.............................................................. 104
REFERENCES ................................................................................................................. 106
APPENDIX ...................................................................................................................... 129
Poster presented at Tropentag 2007 ............................................................................... 139
Paper Submitted to Veterinary Microbiology ............................................................... 140
xvi
LIST OF TABLES
Table 1: Staphylococcus aureus subsp. anaerobius used in this study ................................. 37
Table 2: Oligonucleotides used in this study ...................................................................... 38
Table 3: PCR thermocycler protocols used in this study ...................................................... 39
Table 4: Number of the inoculated organisms per lamb for pathogenecity test ..................... 43
Table 5: Vaccination trials of groups of sheep with different doses of the vaccine against
Morel’s disease ................................................................................................................... 46
Table 6: Staphylococcus species isolated from infected superficial lymph nodes of sheep at
meat inspection in Elkadaro, Ghanawa and Alsabaloga slaughter houses in Khartoum State 55
Table 7: Colonial morphology of other staphylococci isolated from lymph node abscesses of
sheep ................................................................................................................................... 55
Table 8: Biochemical properties of staphylococci isolated from lymph node abscesses of
sheep at meat inspection ...................................................................................................... 58
Table 9: Biochemical properties of Staphylococcus aureus subsp. anaerobius isolated in this
study ................................................................................................................................... 61
Table 10: DNA concentrations of S. aureus subsp. anaerobius isolates used in the part of
molecular characterization ................................................................................................... 62
Table 11: The complete sequence of the catalase- like protein gene of S. aureus subsp.
anaerobius S10 (isolated from outbreak of Morel’s disease in Alsamra village, Khartoum
North Sudan) ....................................................................................................................... 68
Table 12: Nucleotide substitutions in the sequence of the catalase- like protein gene of S.
aureus subsp. anaerobius S10 compared with that of S. aureus subsp. anaerobius MVF 213
and S. aureus NCTC 8325 ................................................................................................... 70
Table 13: Amino acids resulted from nucleotide mutations in the sequence of the catalase-
like protein gene of S10 compared with that of S. aureus subsp. anaerobius MVF 213 and S.
aureus NCTC 832 ............................................................................................................... 71
Table 14: Postmortem lesions on non-vaccinated sheep after inoculation with some
Staphylococcus spp. ............................................................................................................ 78
Table 15: Postmortem lesions of sheep inoculated by different doses of the vaccine and
challenged by 1200 cfu of Staphylococcus aureus subsp. anaerobius ................................... 82
Table 16: Abscess size produced by inoculation of opsonized culture of S. aureus subsp.
anaerobius .......................................................................................................................... 93
Table 17: Average number of bacteria (per ml) after phagocytosis one weeks after
vaccination .......................................................................................................................... 94
Table 18: Average number of bacteria (per ml) after phagocytosis two weeks after
vaccination .......................................................................................................................... 94
xvii
LIST OF FIGURES
Fig. 1: Virulence determinants of Staphylococcus aureus .................................................... 10
Fig. 2: Sites of sample collection ......................................................................................... 29
Fig. 3: Bacteria isolated from lymph abscess of sheep at meat inspection............................. 53
Fig. 4: Staphylococcus spp. isolated from superficial lymph node abscesses of sheep at meat
inspection ............................................................................................................................ 53
Fig. 5: Sheep flock in Alsamra village, Khartoum North, Sudan, in which outbreak of abscess
disease occurred .................................................................................................................. 54
Fig. 6: Staphylococcus aureus subsp. anaerobius colonies grown on blood agar medium .... 56
Fig. 7: a and b, Agarose gel (2%) electrophoresis results of amplification of the nuc gene of S.
aureus subsp. anaerobius isolates ........................................................................................ 65
Fig. 8: Agarose gel (2%) electrophoresis results of amplification of kat gene of S. aureus
subsp. anaerobius isolates using primers 808F-1583R ......................................................... 66
Fig. 9: Agarose gel (2%) electrophoresis results of amplification of kat gene of S. aureus
subsp. anaerobius isolates using primers: 1396F-1583R, 164F and 872R. ............................ 66
Fig. 10a and b: Agarose gel (2%) electrophoresis results of amplification of kat gene of S.
aureus subsp. anaerobius isolates using primers: 164F and 1583R ...................................... 67
Fig. 11: Illustration of the amino acids substitutions in the catalase protein of S. aureus subsp.
aureus NCTC 8325 (SA) and the deduced catalase- like protein of S. aureus subsp.
anaerobius strain S10 (S10) ................................................................................................ 69
Fig. 12: Agarose gel (1%) electrophoresis results of amplification of RAPD-PCR profiles of
Staphylococcus aureus subsp. anaerobius strains using primer 786 ..................................... 72
Fig. 13: Agarose gel (1%) electrophoresis results of RAPD-PCR of Staphylococcus aureus
subsp. anaerobius isolates using primer 798 ........................................................................ 73
Fig. 14 a and b: Agarose gel (2%) electrophoresis of PCR products using primers for the spa
gene for different S. aureus subsp. anaerobius isolates …………………………………….. 75
Fig. 15 a and b: Agarose gel (2%) electrophoresis of PCR products using primers for the coa
gene for different S. aureus subsp. anaerobius isolates ........................................................ 76
Fig. 16: The inoculation site of sheep with different numbers of the bacterial cells (CFU) of
Staphylococcus aureus subsp. anaerobius ........................................................................... 79
Fig. 17: Micro-abscesses in the liver of ram experimentally inoculated with Staphylococcus
aureus subsp. anaerobius .................................................................................................... 79
Fig. 18: Abscess formation in the lung of lamb experimentally inoculated with
Staphylococcus aureus subsp. anaerobius ........................................................................... 80
Fig. 19: Hyper immune reaction, general swelling in lamb vaccinated with Morel’s disease
vaccine and challenged by S. aureus subsp. anaerobius + S. aureus ..................................... 84
xviii
Fig. 20: Swelling in the chest of lamb vaccinated with Morel’s disease vaccine and
challenged by S. aureus subsp. anaerobius + S. aureus ........................................................ 84
Fig. 21: Subcutaneous oedema in lamb vaccinated with Morel’s disease vaccine and
challenged by S. aureus subsp. anaerobius + S. aureus ........................................................ 85
Fig. 22: Congestion in the intestine of lamb vaccinated with Morel’s disease vaccine and
challenged by S. aureus subsp. anaerobius + S. aureus ........................................................ 85
Fig. 23: Congestion in the intestine of lamb vaccinated with Morel’s disease vaccine and
challenged by S. aureus subsp. anaerobius + S. aureus ........................................................ 86
Fig. 24: Congestion in the brain of lamb vaccinated with Morel’s disease vaccine and
challenged by S. aureus subsp. anaerobius + S. aureus ........................................................ 86
Fig. 25: Froth in the trachea of lamb vaccinated with Morel’s disease vaccine and challenged
by S. aureus subsp. anaerobius + S. aureus ........................................................................ 87
Fig. 26: Photomicrograph of typical Plaque Forming Cell. Note the single mononuclear
(plasma) cell in the centre of the plaque: the erythrocytes were lysed producing holes (clear
areas), 40x........................................................................................................................... 89
Fig. 27: Average count of plaques formed of groups of sheep vaccinated with Morel’s
disease vaccine .................................................................................................................... 89
Fig. 28: Average blood lymphocytes count of groups of sheep vaccinated with Morel’s
disease vaccine .................................................................................................................... 90
Fig. 29: Plaque forming cell assay (PFCA) and lymphocytes count, comparison between all
groups ................................................................................................................................. 90
Fig. 30: Viability of splenic cells when stored normally, in RPMI or in Histopaque at 4 °C
one week after vaccination .................................................................................................. 91
Fig. 31: Viability of splenic cells when stored normally, in RPMI or in Histopaque at 4 °C
two weeks after vaccination................................................................................................. 91
Fig. 32: Viability of splenic cells when stored normally, in RPMI or in Histopaque at 4 °C
three weeks after vaccination ............................................................................................... 92
Fig. 33: Viability of splenic cells when stored normally, in RPMI or in Histopaque at 4 °C
four weeks after vaccination ................................................................................................ 92
1
INTRODUCTION
Morel’s disease is a non-fatal contagious disease of sheep. It is
caused by Staphylococcus aureus subspecies anaerobius (shortly referred
to as S. aureus anaerobius) and is encountered in lambs between 4-10
months of age (Morel, 1911). The disease is endemic in nature with high
morbidity rate and frequent relapses, but no mortality has been directly
attributed to it (Bajmocy et. al., 1984).
In the Sudan, Morel’s disease causes economical losses, especially
among fattened sheep. Many shipments of exported sheep were sent back
to Sudan due to this disease.
Of 936,415 sheep returned from Saudi Arabia between 1990 and
1998, 77% were rejected on the grounds of sheep abscess or Morel’s
disease. This has initiated a discussion about producing vaccine for
Morel’s disease in Sudan. At times, the Saudis may reject the whole
shipment because of 1 or 2 abscess cases (Aklilu, 2002).
Twenty-eight ships containing 113,415 heads of sheep prepared for
exportation to the Gulf area were rejected in March 1992. However, the
rejected number of sheep increased dramatically in April 1992, (373973
heads) with a total loss of LS 7,564,600,000. The total loss of 8 years
amounted to 15,142,800,000 Sudanese Dinars (Hassan, 2001).
Morel’s disease was wrongly diagnosed in Saudi Arabia as
“caseous lymphadenitis” or "pseudotuberculosis", which is caused by
Corynebacterium ovis. Accordingly, a wrong vaccine was issued without
any success (S. M. El Sanousi, personal communication). Hamad (1989)
was the first to describe the disease in sheep in the Sudan. Rodwan (1996)
produced a specific vaccine for Morel’s disease using a local Sudanese
strain of S. aureus anaerobius. El haj (2002) produced this vaccine using
2
the IBT bioreactor technology. In this study, we tried to evaluate the
efficacy of the vaccine by using some immunological methods. Molecular
biology methods were used to see possible genetic differences between
local Sudanese isolates for the purpose of choosing a vaccine strain.
Staphylococcus species other than S. aureus anaerobius were isolated by
Noura Karamalla (1997) and Sara Bihary (2002) from some abscesses of
sheep. Verifying such isolates as additional causes of Morel’s disease was
also aimed.
Objectives of the study
1- To survey for Morel’s disease among infected animals in search of
different aetiological agents for sheep abscesses.
2- To study the synergistic action of combined aetiology agents in
causing the disease.
3- To investigate possible genetic differences among the local strains
of S. aureus anaerobius.
4- To determine and evaluate the effective dose of the vaccine.
5- To improve the potency and efficacy of Morel’s disease vaccine
and to assess the immunity in vaccinated sheep.
6- To evaluate immunity conferred by Morel’s vaccine in sheep by
the use of immunological tests.
3
CHAPTER ONE
LITERATURE REVIEW
1.1 Abscess disease in sheep (Morel’s disease)
Abscess disease is a disease of young sheep characterized by
spontaneous abscess formation in subcutaneous and occasionally
intermuscular tissue (Morel, 1911; Aynaud, 1927; Aynaud, 1928; Shirlaw
and Ashford, 1962 and Bajmocy et al., 1984). According to Morel (1911)
and Bajmocy et al. (1984), the disease is usually encountered in 8–10
months old lambs and it occurs in almost all lambs that are born in
infected flocks. De La Fuente and Suarez (1985) considered it as a
disease of young sheep of up to 4 months that rarely affected adults.
Rodwan (1996) reported that 8 months to 3 years old sheep were
generally affected, but animals around 1–5 years old were commonly
affected.
The disease was also known as Morel’s disease as it was firstly
reported by Morel in 1911 in France (Shirlaw and Ashford, 1962 and
Bajmocy et al., 1984). The disease was reported thereafter by other
French scientists (Aynaud, 1922, 1927, 1928; Carré, 1923a, 1927; Benito
and Borrel, 1957). In Hungary the disease was reported in 1983 in a flock
of sheep imported from France (Bajmocy et al., 1984). In Spain, Blanco-
Loizelier (1985) was the first to report the disease. De la Fuente and
Suarez (1985) also described an outbreak of the disease in Spain. Afnan
and Hedjazi (1978) reported the disease in Iran for the first time. The
disease was diagnosed in Kenya in a flock of sheep, which was built over
seven years from endogenous ewes crossed with pedigree Corridale rams
(Shirlaw and Ashford, 1962). In Denmark outbreak of the disease was
reported for the first time by Møler et al. (2000) in 4–5 months old sheep
4
imported from France. Hamad (1989) was the first to describe the disease
in sheep in the Sudan.
Goats are considered as naturally resistant to the disease. However,
Valenti and Bieler (1984) reported spontaneously developing abscess
disease in goats. The disease was also reported in goats in the Sudan by
El Sanousi et al. (1989) and in Saudi Arabia by Alhendi et al. (1993).
Møler et al. (2000) reported a gradual increase in the number of
affected animals that reached 40% of the flock after five months of the
outbreak. The disease was mainly diagnosed in animals of good health
kept for fattening (Aynaud, 1923). Also Hassan (1996) reported the
relationship between the onset of Morel’s disease and the fattening
process as high as 62.5%.
1.2 Pathology of abscess disease
The main pathological character and the only sign of the disease is
the abscess formation close to or within the superficial lymph nodes, and
so, the disease is known as abscess disease (Aynaud, 1927). Aynaud
(1922) and Shirlaw and Ashfford (1962) reported that the abscess
developed close to - but not within - the lymph nodes, while Bajmocy et
al. (1984) and De La Feunete and Suarez (1985) found abscesses inside
the superficial lymph nodes but not around them. Occasionally, abscesses
were found in the lungs (Aynaud 1922; Bajmocy et al., 1984 and Hamad,
1989). Møler et al. (2000) found that the abscesses were closely
associated with lymph nodes and the abscess wall was often fused with
the lymph node capsule by a connective tissue formation that was several
millimetres thick.
The most commonly affected lymph nodes are the prescapular,
popliteal, inguinal and parotid lymph nodes (Morel, 1911). Aynaud
(1927) and Joubert (1958) considered the angle of the jaw, the shoulder
5
point and the scrotum to be the predilection sites for abscesses. Shirlaw
and Ashford (1962) mentioned that abscesses occurred in the following
order of frequency: close to the prescapular, popliteal, parotid and
anterior cervical lymph nodes. Bajmocy et al. (1984) noticed that
suppuration occurred most frequently in the mandibular, prescapular and
subiliac lymph nodes. De La Fuente and Suarez (1985) observed that
abscesses most frequently located in the lymph nodes of the mandibular
region (mandibular, parotid and lateral retropharyngeal) followed by
superficial cervical, subiliac, popliteal, supramammary and scrotal lymph
nodes, respectively. Hamad et al. (1992) mentioned that the distribution
of suppurative lesions among naturally infected sheep involved the
parotid, mandibular, prescapular, popliteal and other lymph nodes
respectively. Møler et al. (2000) reported that the lesions predominantly
occurred in prescapular region or in head: 54% of the abscesses were
located in association with the superficial cervical lymph nodes followed
by the parotid lymph nodes (27%) and the popliteal lymph nodes (11%).
Naturally occuring abscess is variable in size. It could be as small
as a pigeon’s egg or as large as an orange (Morel, 1911; Shirlaw and
Ashford, 1962), two-hand fists (Aynaud, 1923), hen egg or a man’s fist
(Bajmocy et al., 1984), or in size of a football (Alhendi, 1993) or 15 cm
in diameter (Møler et al., 2000). Experimentally reproduced abscess
could reach up to 6.5x6.0 cm in diameter (Hassan, 1996) or 9.9x9.4 cm
according to Sara Bihary (2002).
Lesions usually start small and then gradually increase in size;
when ripened, the abscess ruptures expelling thin greenish yellow pus,
while healing takes place after a long time (Morel, 1911; Aynaud, 1922;
Bajmocy et al., 1984; De la Fuente and Suarez, 1985). However, Møler et
al. (2000) reported that the abscesses were rounded and gradually
6
increased in size up to 10 cm in diameter and they fistulated
spontaneously expelling a viscous white- yellow odourless mass and were
enclosed by a 0.2-0.5 cm thick connective tissue capsule. Aynaud (1922)
mentioned that ruptured abscesses might proliferate in other points
adjacent to the first site. More than two abscesses might occur
simultaneously on the same animal. However, Shirlaw and Ashford
(1962), and Bajmocy et al., (1984) noticed that adjacent lymph nodes
were usually involved a few weeks after those abscesses developing first
had ruptured and healed.
1.3 Abscess formation
The sebaceous glands in the skin secrete factors that are
bactericidal to Gram-positive bacteria. These factors include long- chain
fatty acids and monoglycerides (Christensen, 1993; Kanai et al., 1978;
Shryock et al., 1992 and Engler et al., 1992). Fatty acids metabolizing
enzyme (FAME) has the ability to inactivate some of these fatty acids by
esterification to cholesterol. This may help to lower fatty acid
concentrations and possibly protect the organisms from killing
themselves in search for other sources of nutrients (Chamberlain, 1999).
FAME appears not only to function within abscesses, but also to assist in
the organism's survival in host tissues (Mortensen et al., 1992 and Karbal
et al., 1992). Lipase enzyme produced by the organism can break down
the triglycerides from sebaceous gland secretions to glycerol and fatty
acids. The fatty acids obtained from breakdown of triglycerides could be
utilized by the bacteria. If the fatty acid concentration gets too high, it
can kill the staphylococci. The lipase enzyme is less active against the
long-chain triglycerides produced in abscesses than it's against
triglycerides with shorter side chains in the molecule (Muraoka et al.,
1982).
7
1.4 The causative agent of abscess disease in sheep
Joubert (1958) isolated Gram-positive micrococci from lambs
affected with abscesses similar to those formerly described by Morel
(1911) and Aynaud (1922, 1923). Several workers (Carré, 1927; Shirlaw
and Ashford, 1962; Bajmocy et al., 1984; and De la Fuente et al., 1985)
confirmed the relation of these micrococci to abscess disease. Benito and
Borrel (1957) and Joubert (1958) proposed the name Micrococcus
pyogenes ovis and Micrococcus abscedens ovis for the organism. Blanco-
Loizelier (1985) and De la Fuente et al. (1985) demonstrated that the
aetiological agent of abscess disease was catalase and benzedine negative
Staphylococcus; they considered it to be a respiratory deficient S. aureus.
De la Fuente et al (1985) reported that this respiratory deficient S. aureus
exhibits a cell wall composition typical of S. aureus ATCC12600. DNA-
DNA hyperdization indicated that the organism was very closely related
to S. aureus at the species level, and because of biochemical
distinctiveness (catalase and benzedine negative, negative or weak growth
under aerobic conditions). De la Fuente et al. (1985) classified it as S.
aureus subsp. anaerobius, and thereafter was included in the nineth
edition of Bergey’s Manual of Determinative Bacteriology (Sneath et al.
1986). Morel (1911), Aynaud (1922) and Carré (1923a, b) mentioned that
the organism did not grow on simple media or when incubated
aerobically. Shirlaw and Ashford, 1962; Bajmocy et al., 1984 and De la
Fuente et al., 1985 mentioned that a good growth of the organism occured
when cultures were incubated anaerobically under CO2 tension, while
Aynaud (1923) reported that the organism could grow aerobically when it
was cultivated in Egg Yolk Agar. Shirlaw and Ashford (1962) showed
that the organism did not grow aerobically even after five days of
incubation, while Bajmocy (1984) noticed a pin point colonies on the
8
fifth day or later of incubation aerobically. Hamad (1989) and De la
Fuente and Suarez (1985) noticed that after few subcultures on sheep
blood agar under microaerophilic or anaerobic incubation, the organism
can be adopt aerobic growth on. Møler et al. (2000) isolated S. aureus
subsp. anaerobius in pure cultures, which were microaerophilic and
appeared under aerobic condition as pin point colonies after 4–5 days.
Under 10% CO2 tension or anaerobically, 0.5–1 mm beta-haemolytic
white colonies developed after 48 hours of incubation on blood agar
plates.
1.5 Staphylococci isolated from sheep abscesses in the Sudan
Many authors described the organisms that cause abscesses in the
Sudan. They all agreed that the organism is Gram- positive cocci,
arranged in pairs, tetrads and clusters and do not grow in simple media
when incubated aerobically but they disagreed in the results of
biochemical reactions, especially in the haemolysin production,
coagulase, pigment production and colony size.
Noura Karamalla (1997) isolated twelve different Staphylococcus
spp. from suppurating lymph node abscesses of 85 sheep at meat
inspection in Alkadaro abattoir and from subcutaneous abscesses of 15
fattened animals, viz; S. aureus subsp. anaerobius (26%), S. hyicus
(22%), S. caseolyticus (20%), S. aureus (5%), S. hominis (4%), S.
dolphini (5%), S. sciuri (4%), S. cohnii (3%) and S. xylosus (2%), while
Sara Bihary (2002) isolated other different Staphylococcus spp., from
lymph node abscesses of sheep at meat inspection in Omdurman abattoir,
viz; S. aureus subsp. anaerobius (24%), S. sacchrolyticus (19%), S.
aureus (10%), S. caseolyticus (10%), S. hyicus (10%), S. simulans (5%),
S. carnosus (5%), S. caprae (5%), S. auricularis (5%), S. pulvereri (5%),
S. lugdunensis (5%) and S. simians (5%).
9
S. aureus: mainly associated with gangrenous mastitis, dermatitis and
pyaemia (Timoney et al., 1988). Ewes are very sensitive to experimental
infection with S. aureus by the intramammary route; fewer than 100
bacteria are sufficient to produce clinical mastitis. In man, S. aureus
causes a variety of suppurative (pus-forming) infections and toxaemia
(Watson, 1988). It causes superficial skin lesions such as boils, styes and
furunculosis; more serious infections such as pneumonia, mastitis,
phlebitis, meningitis, and urinary tract infections; and deep-seated
infections, such as osteomyelitis and endocarditis. S. aureus is a major
cause of hospital acquired (nosocomial) infections of surgical wounds
and infections associated with indwelling medical devices (Zierdt et al.,
1982; Kenneth Todar University, 2008). Also it causes food poisoning by
releasing enterotoxins into food, and toxic shock syndrome by release of
superantigens into the blood stream.
Staphylococcus aureus expresses many potential virulence factors
such as surface proteins that promote colonization of host tissues;
invasins that promote bacterial spread in tissues (leukocidin, kinases,
hyaluronidase); surface factors that inhibit phagocytic engulfment
(capsule, protein A); biochemical properties that enhance their survival in
phagocytes (carotenoids, catalase production); immunological disguises
(protein A, coagulase, clotting factor); and membrane-damaging toxins
that lyse eukaryotic cell membranes (haemolysins, leukotoxin,
leukocidin); exotoxins that damage host tissues or otherwise provoke
symptoms of disease (SEA-G, TSST, ET); inherent and acquired
resistance to antimicrobial agents. S. aureus can express proteases, lipase,
deoxyribonuclease (DNase) and fatty acid modifying enzyme (FAME).
The first three probably provide nutrients for the bacteria, and it is
unlikely that they have anything but a minor role in pathogenesis.
10
However, the FAME enzyme may be important in abscesses, where it
could modify anti-bacterial lipids and prolong bacterial survival (Kenneth
Todar University, 2008).
Fig. 1: Virulence determinants of Staphylococcus aureus (from Kenneth
Todar University, 2008).
- Staphylococcus hyicus: Originally described by Sompolinsky (1950). It
is a causative agent of exudative epidermitis in pigs, an infectious skin
disease characterised by exfoliation of the skin, excessive sebaceous
secretion, and formation of a brownish coat of exudate that may cover the
entire body (Jones, 1956; Underdahl et al., 1965; Devriese, 1977; Jubb et
al., 1993; Jonsson and Wadstrom, 1993). The organism is less frequently
found on the skin or in the milk of cattle (Brown et al., 1967)
- Staphylococcus caseolyticus: It has been reclassified as Micrococcus
caseolyticus (Kloos et al., 1998). It may be found in milk and dairy
products (Kloos and Schleifer, 1986).
- Staphylococcus hominis: Found living on human skin (Kloos and
Musselwhite, 1975 and Kloos, 1990). Klesser et al. (1998) reported
infective endocarditis caused by S. hominis after vasectomy. Although it
is found on human skin, it has also been isolated as a cause of
11
bacteraemia in cancer patients (Bowman et al., 1984).
- Staphylococcus delphini: It causes purulent skin lesions in dolphins
(Varaldo et al., 1988). It was also isolated from human abscess by Hind
Ali (1997) and from sausage (Samia Ismail, 1997). Devriese et al (2005)
isolated it from clinical and necropsy specimens from a cat, a dog, a horse
and a parrot.
- Staphylococcus sciuri: widespread in nature, and they can be isolated
from a variety of farm animals, pets, and wild animals, as well as from
various food products of animal origin (Kloos et al.,1997; Garcia et al.,
2002 and Hauschild et al., 2003).
- Staphylococcus cohnii: Isolated as normal skin flora (Shleifer and
Kloos, 1975) and in human skin it produces small and transient
population (Kloos and Musselwhite, 1975).
- Staphylococcus xylosus: Schleifer and Kloos (1975) isolated it from
human skin. Carrillo et al. (2000) described S. xylosus as a coagulase
negative staphylococcal species that is emerging as a new nosocomial
pathogen. Also S. xylosus was isolated from animal products such as
milk, cheese, sausage and so forth. Some times it causes nasal dermatitis
in gerbils (Solomon et al., 1990) and acute pyelonephritis in humans
(Tselenis-Kotsowilis et al., 1982). It has also been shown to be associated
with epizootic fatal dermatitis in athymic nude mice (Bradfield et al.,
1993)
- Staphylococcus saccharolyticus: An anaerobic species, previously
called Peptococcus saccharolyticus. Its transfer to the genus
Staphylococcus was based on oligonucleotide analysis of 16S rRNA
(Kilpper-Blaz and Schleifer 1981). It is found on human mucous
membranes. Westblom et al. (1990) reported a single case of endocarditis
caused by this organism.
12
- Staphylococcus simulans: Found on the skin and in urethras of healthy
women. S. simulans has been isolated as a cause of septicemia,
osteomyelitis and septic arthritis following open reduction of fractured
fibula (Males et al., 1985), as a cause of native valve endocarditis (Jansen
et al., 1992; McCarthy et al., 1991).
- Staphylococcus auricularis: This species is found in the human
external auditory canal, but it is rarely implicated in infections (Kloos and
wolfsohl, 1983).
- Staphylococcus carnosus: was isolated from dry sausages (Kloos and
Schleifer, 1986).
- Staphylococcus caprae: was originally isolated from goat milk (Poutrel,
1984 and Nuha Elsayed, 2001). It has been recently found on human skin
and in human clinical specimens (Kanda et al., 1991).
- Staphylococcus pulvereri: was isolated from hip infection in human
(Zakrzewska-Czerwinska et al., 1995).
- Staphylococcus lugdunensis: Occurs commonly on human skin
(Herchline and Ayers, 1991). Obeidat (1997) isolated the organism from
human nose. It causes endocarditis (Walsh and Mounsey, 1990). It has
also been associated with native and prosthetic valve endocarditis, skin
and soft tissue cellulites, peritonitis, infected hip prostheses,
osteomyelitis, vascular line infections and breast abscesses (Freney et al.,
1988; Etienne et al., 1989; Barker et al., 1991; Cormican et al., 1992;
Vandenesch et al., 1993 and Waghorn, 1994).
Staphylococcus simians: was isolated from beef burger (Samia Ismail,
1997) and from mastitic milk from goat and sheep (Nuha Elsayed, 2001).
13
1.6 Identification and characterization of S. aureus by molecular
methods
The use of nucleic acid targets with their high sensitivity and
specificity may provide an alternative means of accurately identifying
Staphylococcus species (Drancourt and Raoult, 2002).
Recently, several investigators have described DNA-based
techniques for typing strains (Cuny et al., 1996; Gurtler and Barrie,
1995). Several molecular taxonomic
methods, including DNA–DNA
hybridization and 16S rRNA sequencing, as well as various PCR-based
techniques, have been reported for the identification and phylogenetic
study of staphylococci (De Buyser et al., 1992 and Freney et al., 1999).
The molecular targets have been exploited for the molecular identification
of Staphylococcus species including: the 16S rRNA gene (Bialkowska-
Hobrzanska et al., 1990 and De Buyser et al., 1992), the tRNA gene
intergenic spacer (Maes et al., 1997), the heat shock protein 60b (HSP60)
gene (Goh et al., 1996) and the femA gene (Vannuffel et al., 1999), and
many other molecualar targets.
1.6.1 PCR amplification of the thermonuclease (nuc) gene
Staphylococcus aureus strains produce an extracellular
thermostable nuclease (thermonuclease or nuc gene) with a frequency
similar to that at which they produce coagulase (Madison et al., 1983).
The TNase protein has been well characterized (Thiele, 1990), and its
gene (nuc gene), has been cloned and sequenced (Kovacevic et al., 1985).
The TNase is a protein with a molecular mass of 17,000 Da (Tucker et
al., 1978). It is an endonuclease, degrading both DNA and RNA, and its
enzymatic activity can resist up to 100 °C for at least 1 hour (Lachica et
al., 1972). An enzymatic test for TNase production was used in many
laboratories for the identification of S. aureus isolates (Lachica et al.,
14
1971). Brakstad and Maeland (1989) developed a monoclonal antibody-
based sandwich enzyme-linked immunosorbent assay for detection of the
S. aureus TNase and obtained results which indicated its specificity for S.
aureus. These results accord with the supposition that the S. aureus
TNase has species-specific sequence. This supposition was supported by
the findings of Liebl et al. (1987) who used a 518-bp fragment of the
cloned S. aureus TNase gene which specifically recognized S. aureus
strains in a membrane-based DNA hybridization test.
Brakstad et al. (1992) developed a PCR test based on amplification
of part the nuc gene for the identification of S. aureus. The nuc primer set
could recognize all staphylococci identified as S. aureus by conventional
methods, but not the other bacteria. This nuc-PCR could detect viable S.
aureus cells or correspondingly low levels (0.69 pg) of extracted DNA in
saline. The sensitivity of this test accords with that described for PCR
with other bacteria, being between 1 and 20 CFU (Van Ketel et al., 1990
and Lebech et al., 1991) and thus it has potential for the rapid diagnosis
of S. aureus infections by direct testing of clinical specimens, including
specimens from patients with on going antimicrobial therapy.
1.6.2 Genetic characterization of Staphylococcus aureus
1.6.2.1 Staphylococcus catalase (kat) gene
The main phenotypic differences between S. aureus and S. aureus
subsp. anaerobius are the weak or negative aerobic growth and the lack
of catalase activity in the latter (De la Fuente et al., 1985). In S. aureus, a
correlation between catalase activity and virulence has been observed
(Mandell, 1975; Kanafani and Martin, 1985), suggesting the role of
catalase as a defensive mechanism against the oxygen radicals produced
by macrophages. S. aureus subsp. anaerobius, however, shares with S.
aureus the ability to produce extracellular toxins and enzymes (De la
15
Fuente and Suarez, 1985; De la Fuente et al., 1985), which traditionally
have been related to staphylococcal pathogenicity.
Catalase is a haem- containing enzyme involved in dismutation of
hydrogen peroxide generated during cellular metabolism to water and
molecular oxygen. Most of the catalases characterized can be classified
into one of two types based on their enzymological
properties:
monofunctional or typical catalases, and bifunctional catalase-peroxidases
(Loewen, 1992). In many bacteria, both types of catalase are present and
each enzyme is encoded by a different gene (e.g. in Escherichia coli, katE
and katG code
for monofunctional and bifunctional catalases,
respectively). Monofunctional catalases have been described as proteins
with molecular masses of approximately 220–350 kDa and
are normally
formed by four identical subunits, each containing one (proto-) haem
group (Haas and Brehm, 1993). Their active centre and NADPH-binding
site were described in detail
by Fita and Rossmann (1985a, b).
Comparison of the deduced amino acid sequences of these enzymes
indicates that typical catalases share regions that are highly conserved
among microbial, plant and mammalian enzymes (Switala et al., 1990;
Von Ossowski et al., 1993).
In S. aureus, a typical catalase with high levels of enzymatic
activity and formed of four identical subunits of approximately 60 kDa
has been described (Rupprecht and Schleifer, 1979; Ruiz Santa- Quiteria
et al., 1992).
Sanz et al. (2000) conducted comparative studies between the
catalase genes of S. aureus subsp. aureus and S. aureus subsp.
anaerobius (katA and katB, respectively). They found that katA consists
of 1518 base pairs open reading frame coding for a protein of 505 amino
acids, while katB consists of 1583 nucleotides long and encodes for 455
16
a.a. protein. These results showed that katA had undergone mutations,
which led to generation of katB. These mutations were a deletion of one
base pair located at 1338 bp from the initation codon, in addition to 8
silent and 6 mis-sense mutations. The deletion resulted in shift of the
reading frame and premature termination of translation with subsequent
generation of katB. Four of
the 6 mis-sense mutations present in katB
lead to non-conservative amino acid replacements, the most significant
being that located at residue 317 (Prolin in katA Serin in katB) because
the affected amino acid is involved in determining the proximal haem-
binding site. Lack of the catalase activity of S. aureus subsp. anaerobius
is mainly attributed to these mutations (Sanz et al., 2000). Similarly, loss
of the catalase enzyme activity in a methicillin resistant S. aureus strain
was also attributed to mutations of the catalase. These mutations were
deletion of five successive base pairs, which led to shift in the reading
frame and premature termination of translation (Grüner et al., 2007).
1.6.2.2 DNA Polymorphism
The sequencing of the S. aureus genome indicated the presence of
several variable number of tandem repeats (VNTR) loci, including coa,
and spa (Sabat et al., 2003), which have been used for analysis of
polymorphism and genetic relationship in epidemiological studies.
1.6.2.3 Staphylocoagulase gene (coa)
Coagulase is an extracellular protein that binds prothrombin to
form a complex with thrombin-like activity which coverts fibrinogen to
fibrin (McDevitt et al., 1992). Coagulase is produced by all strains of S.
aureus (Kloos and Schleifer, 1986.) and it is a major phenotypic species
determinant in S. aureus. Its production is the principal criterion used in
the clinical microbiology laboratory for the identification of S. aureus in
human infections (Goh et al., 1992), and it is thought to be an important
17
virulence factor (Hookey et al., 1998). Within the encoding gene of coa,
repeats of 81 nucleotides can be observed, which are clearly polymorphic
in both number and sequence (van Belkum et al., 1998). The sizes and
DNA restriction endonuclease site polymorphisms at the 3´ coding region
of the coagulase gene have been utilized in PCR-based restriction
fragment length polymorphism (RFLP) analysis of S. aureus (Hookey et
al., 1998) and so, typing by PCR-RFLP of this gene can be used to
monitor relatedness among S. aureus strains (Grzegorczyk et al., 2006).
Particular PCR products of coa gene were found in some studies of
approximate lengths of 600, 700, 750 and 800 base pairs (Grzegorczyk et
al., 2006).
1.6.2.4 Staphylococcus protein A gene (spa)
Staphylococcal protein A is a bacterial cell wall product that binds
immunoglobulin G (IgG) and impairs opsonisation by serum complement
and phagocytosis by polymorphonuclear leukocytes (Colburn et al., 1980
and Musher et al., 1981). The decrease of protein A on the cell surface of
S. aureus results in a greater number of free receptor sites for complement
C3b and an increase in phagocytosis (Gemmell and O’Dowd, 1983). The
spa gene is composed of approximately 2,150 bp and harbors a number of
functionally distinct regions: an Fc-binding region, the so-called X
region, and, at the C terminus, a sequence required for cell wall
attachment (Frénay et al., 1994). The repetitive region X of the spa gene
includes a variable number of 24-bp repeats. The number and sequence of
individual repeats may differ among strains. Frénay et al. (1994) reported
that the number of repeats has been related to the dissemination potential
of S. aureus: strains with more than seven repeats in the X region tended
to be epidemic, while the presence of seven or less repeats was indicative
of a non-epidemic methicillin-resistant S. aureus (MRSA) strain. Spa
18
typing has been shown to be an effective and rapid method for typing
MRSA. Thus, spa typing is used for outbreak investigation, and it may
prove useful as a practical method for describing a natural population of
S. aureus organisms (Shopsin et al., 1999 and Moodley et al., 2006).
1.6.3 Pulsed-field gel electrophoresis
Pulsed-field gel electrophoresis (PFGE) is based on the whole gene
by restriction endoneuclease digestion. It was recognized as being one of
the most discriminatory method for gene typing strains of S. aureus, and
it has been used to investigate nosocomial outbreaks. PFGE was shown to
be a useful method for investigating the source, transmission and spread
of nosocomial infections and for epidemiological typing and
determination of the genetic relatedness of methicillin resistant S. aureus
strains (De Lencastre et al., 1996; Lemaitre et al., 1998 and Shimuizu et
al., 1999).
1.6.4 Randomly amplified polymorphic DNA (RAPD)
Randomly amplified polymorphic DNA (RAPD) assays use short
primers with an arbitrary sequence to amplify genomic DNA in a low-
stringency PCR. These primers randomly hybridize with chromosomal
sequences that vary among different strains that produce different
amplification products. These products can be separated by gel
electrophoresis to produce fingerprints or patterns characteristic of
different epidemiological types. The method is attractive because it is
simple to perform and, theoretically, can be applied to any organism
(Power, 1996).
The RAPD assay, also called arbitrarily primed PCR, is rapid and
technically simple (van Belkum et al., 1993 and Tambic et al., 1997).
It is an effective method for the epidemiological investigation of the
outbreaks, and performance of typing by this method is simpler and less
19
time-consuming than that of typing by Pulsed-field gel electrophoresis
(Tambic et al., 1997).
1.7 Molecular characterization of S. aureus subsp. anaerobius isolates
from the Sudan
A recent study in Sudan to compare between local isolates of S.
aureus subsp. anaerobius has been carried out by El Haj (2002). She
mentioned that all local isolates were genetically identical; they have the
same DNA restriction pattern and they almost simulate each other in their
fatty acids composition, but with regard to protein profiles she reported
little differences in the number of bands which ranged from 19 to 24, with
molecular masses ranging from 53.35 to 113.84 kDa.
1.8 Pathogenicity of Staphylococcus aureus subsp. anaerobius
1.8.1 Pathogenicity to laboratory animals
Laboratory animals were found resistant to experimental infection
by different researchers. Aynaud (1928) found that guinea pigs injected
intramuscularly or subcutaneously were refractory to experimental
infection. Also he found mice to be resistant. Joubert (1958) and Shirlaw
and Ashford (1962) found mice and guinea pigs were refractory to
experimental infection irrespective of the route or dose administered. De
la Fuente and Suarez (1985) inoculated four groups of mice
intraperitoneally or subcutaneously with increasing doses, and by
intramuscular and intradermal routes. They found that mice are resistant
to the disease regardless of the dose or inoculation route. Aynaud (1928)
and Joubert (1958) found rabbits resistant to experimental infection
through all routes of administration. However, Shirlaw and Ashford
(1962) obtained cellulitis at the inoculation sites in two out of four rabbits
from which the organism was recovered in pure culture. Hamad (1989)
also found the same findings.
20
1.8.2 Pathogenicity to sheep and goats
Staphylococcus aureus subsp .anaerobius is pathogenic for sheep,
causing the abscess disease, and experimentally for goats (Aynaud, 1923,
1927, and 1928). Goats seem to have strong natural resistance to abscess
disease, although they are sensitive to experimental infection (Aynaud,
1923, 1927, 1928; El Sanousi et al., 1989). Aynaud (1927) found that the
organism was pathogenic for sheep and goats when administered by the
intramuscular, subcutaneous, intraperitoneal and intratesticular routes.
Abscesses developed at the inoculation sites, but following
intraperitoneal injection of the organism, abscesses developed in the
abdominal muscles. The organism is not pathogenic when given by the
oral or the intratracheal routes (Aynaud, 1927).
Shirlaw and Ashford (1962) obtained the disease in sheep when the
organism was administered by the intradermal or subcutaneous routes.
Abscesses developed after two days on animals infected intradermally
and after 12 days on those infected subcutaneously. Abscesses were
observed in adjacent lymph nodes at post-mortem six weeks following
infection. They noticed that inoculation of the organism into animals by
scarification did not reproduce the disease in sheep. However, Bajmocy et
al., (1984) were able to reproduce the disease by scarification, as well as
by intramuscular and intravenous inoculation. Hamad (1989) observed
that sheep inoculated with a culture suspension of the organism
developed a local abscess, which ruptured on the ninth day of inoculation.
On autopsy seven weeks following infection, he noticed thickening and
cording of lymphatic vessels from the skin lesion to the adjacent
prescapular lymph node. Hassan (1996) found that most of the abscesses
opened by day eight after subcutaneous inoculation of sheep with viable
S. aureus subsp. anaerobius. Also, he found scarification to cause
21
multiple microabscesses in liver with involvement of mediastinal lymph
node, but no evidence of abscess formation in the superficial lymph
nodes. He noticed that the internal organs of fattened sheep inoculated
intravenously with viable S. aureus subsp. anaerobius, showed no
apparent lesions.
1.9 Vaccination against staphylococcal infections
There is an increasing need for a safe and effective vaccine to
prevent staphylococcal infections in the field. In Veterinary practices, live
staphylococcal vaccines appear to be more effective than killed vaccines
(Watson and Lee, 1978; Watson, 1987).
1.9.1 Live Staphylococcus aureus vaccines
It has been known for many years that live S. aureus vaccines,
given subcutaneously, provide a considerable degree of protection from
staphylococcal mastitis (Bridre, 1907 and Derbyshire, 1961). Vaccination
with live S. aureus vaccine induces a small abscess at the injection site,
which is grossly and microscopically quite different from the granuloma
resulting from injection of killed staphylococci (Watson and Kennedy,
1981). Ruminal neutrophils appear to be membrane receptors for the Fc
portion of the IgG2 molecules (Watson, 1976). Immunoglobulin G2 is the
only immunoglobulin isotype, which binds cytophilically to ruminant
neutrophils (Watson, 1975). Following immunization with live S. aureus
vaccine, ruminants mount a strong IgG2 anti-S. aureus antibody response
(Watson, 1987). Recent studies showed that systemic vaccination of
sheep with a live S. aureus vaccine induced an immune response which
was characterized by polymorphnuclear neutrophils possessing enhanced
phagocytic capacity in vitro assay when compared with neutrophils from
ewes given killed S. aureus vaccine intramuscularly (Watson, 1975,
1976). Furthermore, results of challenge experiments suggest that live S.
22
aureus vaccines provided stronger protection of the mammary gland than
killed vaccines when both were administered systemically to sheep
(Watson and Lee, 1978). However, the problem of reversion to
pathogenicity, which is common among Staphylococcus species, led to
lesser use of live vaccines (Ahmed et al., 1990).
1.9.2 Killed Staphylococcus aureus vaccines
Killed S. aureus vaccines have generally stimulated long IgG1 but
poor IgG2 responses and afforded relatively less protection in
experimental staphylococcal mastitis models (McDowell and Watson,
1974 and Watson, 1989;). Many attempts at vaccination with bacterins
and toxoids have been largely ineffective (Anderson, 1978).
Immunization by the intramammary infusion of antigen during
pregnancy was partially successful in conferring protection from
homologous challenge (McDowell and Watson, 1974). Systemic
administration of killed vaccine proved unsuccessful (Derbyshire, 1962).
1.9.3 Cellular components as vaccines
Other potentially protective immunogenic procedures against S.
aureus infection include the utilization of capsular components,
particularly polysaccharides (CPS) as vaccines. A few strains of S. aureus
produce a true capsule (Wilkinson, 1983). However, when growing in
vivo, S. aureus produces an extracellular glycocalyx comprised largely of
hydrated polysaccharides (Mayberry-Carson et al., 1984; Speers and
Nade, 1985). Expression of glycocalyx usually ceases when S. aureus is
grown in conventional laboratory media and could be lost on subculture
(Opdebeeck et al., 1987; Sutra et al., 1990).
Surface polysaccharide capsules formed by pathogenic bacteria are
important virulence factors, and immunity directed towards capsular
antigens is often protective (Foster, 1991). Combination of
23
polysaccharide with a protein carrier has been shown to enhance
immunogenicity and to stimulate a T-cell response (Fattom et al., 1990).
It has been difficult to study capsules in S. aureus because of poor
capsule expression when bacteria are grown in conventional laboratory
media, and because of the tendency of the phenotype to be lost on
subculture (Rather et al., 1986). This phenomenon was shown in mastitis
isolates, the majority of which formed diffuse colonies in serum soft agar
(Yoshida and Ekstedt, 1968). Only 50% of S. aureus strains retained
diffuse morphology after growth in brain heart infusion medium but more
than 80% developed diffuse morphology after growth in a high
carbohydrate medium (Opdebeeck and Norcross, 1983; Yoshida and
Ekstedt, 1968). Rajab (1997) reported expression of the S. aureus subsp.
anaerobius capsule in serum charcoal medium developed for that
purpose. Some strains of S. aureus permanently form mucoid colonies.
They form a thick capsule called a macrocapsule, which can be visualized
by light microscopy with Indian ink staining (Wilkinson, 1983 and Lee et
al., 1987). Mucoid strains are rarely isolated from human or ruminant
infections while the most natural isolates form a microcapsule which is
too thin to be detected by light microscopy (Wilkinson, 1983). The
macrocapsule associated with mucoid colony morphology is known to
increase the virulence of S. aureus for laboratory animals (Yoshida and
Eskstedt, 1968; Koenig and Melly, 1965; Wiley and Maverakis, 1974).
The enhanced virulence of the mucoid strains is almost certainly due to
impaired phagocytosis (Wiley and Maverais, 1974; Lee et al., 1988;
Wilkinson et al., 1979). There is also strong evidence indicating that anti-
capsular polysaccharide (CPS) antibodies promote phagocytosis and
killing of bacteria with microcapsule (Fattom et al., 1990).
Adhesion to host cells or to tissue components is an important first
24
step in infection by many pathogenic bacteria. Attachment of bacteria to
mammary gland epithelial cells appears to be promoted by two surface
associated proteins (Lindahl et al., 1990). One binds to the glycocalyx
fibronectin (Forman et al., 1987) which is present on the surface of these
cells while the other is haemoagglutinin, which promotes binding to
epithelial cells and to milk fat globules (Lindahl et al., 1990). Several
pathogenic Gram-positive bacteria express cell-bound proteins, which are
exposed, on the cell surface. These proteins include protein A (Uhlen et
al., 1984) and the fibrnectin-binding proteins of S. aureus (Signäs et al.,
1989) and M proteins. These proteins have several features in common
including an extended structure, a hydrophobic carboxy terminus, a
proline rich region and surface-exposed repeated domains which interact
with host proteins (Foster, 1991).
Protein A is a major component of the cell wall of S. aureus
(Forsgren et al., 1983). It has five tenderly repeated domains, which bind
to the Fc region of mammalian IgG (Moks et al., 1986). This interaction
inhibits phagocytosis in the presence of normal serum (Peterson et al.,
1977) presumably by blocking attachment of opsnins to the macrophage.
Immunization with protein A might be expected to reverse the inhibition
of opsonophagocytosis. In this regard, some protection against bovine
mastitis was obtained with a protein A vaccine (Nickerson et al., 1985),
whereas passive immunization of infant rats with rabbit anti-protein-A
serum did not protect against staphylococcal infection (Greenberg et al.,
1989).
Protection against lethal gangrenous mastitis in rabbits was
conferred by immunization with a toxoid derivative, but no protection
was obtained against the chronic form of the disease (Adlam et al., 1977).
Derbyshire (1960) recorded only a mild transient reaction in the form of
25
neutrophil in the mammary glands of cows vaccinated with a toxin
preparation after challenge with staphylococci, while non-vaccinated
cows developed a gangrenous mastitis with complete loss of udder
function. Aydin and Canbazoglu (1987) vaccinated cows against S.
aureus mastitis using a bacterin and bacterin toxoid mixture. Bacterin
(with Aluminum hydroxide) elicited 100% protection for up to six
months and 50% protection for eight month. The bacterin toxoid mixture
elicited 50% protection up to the third and sixth months, but no protection
was obtained during the eight month. Nickerson et al., (1991) evaluated a
commercially available bacterin that was administered systematically to
10 cows. Protein A administered in the area of the supramammary lymph
node was also evaluated in 10 cows, which were boostered every 6
months and were challenged latter with S. aureus. After three lactation
trials, there was also reduction in the number of new infections with S.
aureus in vaccinated animals. However, the number of resolved
infections was significantly higher in cows vaccinated with the protein-A
vaccine or a bacterin (83 and 73 percent, respectively) compared with the
non-vaccinated.
1.10 Recent specific vaccine trials against Morel’s disease in the
Sudan
Rodwan (1996) produced a vaccine containing capsule, whole
culture and toxoid. Two doses of this vaccine (1.0 ml and 0.5 ml) given
two weeks a part protected lambs challenged one months later with three
times the minimum abscess causing dose (Hassan, 1996).
El Haj (2002) tested three combinations of vaccines: 60% cells
with 40% toxoid; 50% cells with 50% toxoid and formalized whole
culture. The culture was cultivated by the IBT bioreactor technology.
Vaccinated sheep were challenged with S. aureus subsp. anaerobius. She
26
found the best protection when the vaccine constituted 60% cells with
40% toxoid. Also, she found that the vaccine produced by the IBT
bioreactor technology was better than the vaccine produced earlier by
Rodwan (1996).
1.11 The haemolytic plaque forming cell assay (PFC)
The direct plaque forming assay was initially developed by Jerne
and Nordin (1963), and since then has become a mainstay of routine
cellular immunology research, primarily acsessing humoral IgM antibody
responses to antigen (Roitt and Delves, 1992). Briefly, B and T lineage
lymphocyte populations previously presented in vivo with heterologous
erythrocytes are agar plated in combination with the identical erythrocyte
suspensions used for immunization. During incubation, the B cells secrete
IgM antibody to antigenic determinants present on the surface of the
erythrocytes often with T-cell help, resulting in antibody-erythrocyte
binding. The presence of an adequate complement source allows
complement-mediated lysis of the antibody-coated erythrocytes, resulting
in the formation of clear zones or "plaques" in the agar. Located within
the centre of each plaque is a single, antibody producing plasma cell. As a
lytic site can be produced by a single IgM molecule fixing one C1q
complement molecule, high sensitivity is a major advantage of the PFC
assay (Smith et al., 1999). In the Sudan PFC was tried for first time by
Hassan (2001).
1.12 Opsonophagocytosis
When the pathogen enters the underlying tissues, the
innate
immune response components including macrophages play a primary
defence role. Macrophages and other lymphocytes use toxic reactive
oxygen species (ROS) such as the superoxide anion, hydrogen peroxide
27
and hydroxy radicals to support killing phagocytosed bacteria (Clements
and Foster, 1999).
Opsonization, or enhanced attachment, refers to the antibody
molecules IgG, IgE and the complement proteins C3b and C4b attaching
antigens to phagocytes. This results in much more efficient phagocytosis.
Optimal phagocytosis generally requires the presence of complements
and specific antibodies that recognize the bacterium through Fab regions
and bind the receptors on the phagocyte (Howard et al., 1980).
Hyperimmune serum or monoclonal antibodies directed towards surface
components (e.g., capsular polysaccharide or surface protein adhesins)
could theoretically prevent bacterial adherence and promote phagocytosis
by opsonization of bacterial cells. Also, human hyperimmune serum
could be given to hospital patients before surgery as a form of passive
immunization (Kenneth Todar University, 2008).
28
CHAPTER TWO
MATERILAS AND METHODS
2.1 Survey
2.1.1 Collection of samples
One hundred and seventy enlarged superficial lymph nodes were
taken from sheep at meat inspection in Alkadaro, Ghanawa and
Alsabaloga slaughter houses. Thirty pus samples were taken from sheep
affected with abscess disease in outbreak of the disease in a flock of
sheep at Alsamra village, Khartoum North. Fig. 2 shows the locations of
these sampling areas in the map of Khartoum State. Pus samples were
collected from affected lymph nodes as follows: lymph nodes surfaces
were disinfected with a piece of cotton soaked in 70% alcohol followed
by hot spatula, small incisions were made using sterile blades, the pus
was collected aseptically in sterile universal bottles and stored at -20 ºC
until cultured. Pus from live animals was taken from incised abscess into
sterile bottles after shaving and disinfection with alcohol.
2.1.2 Smears
2.1.2.1 Preparation of smears
Direct smears were prepared from pus samples in clean glass
slides, dried, fixed by heating and stained.
2.1.2.2 Gram’s stain
Gram's stain was done according to the method described by
Barrow and Feltham (1993).
2.1.3 Culture methods
2.1.3.1 Culturing and purification
Pus samples were streaked on 10% sheep blood agar plates and
incubated in candle jars at 37 ºC for 48 h. Subcultures were made for
further purification of mixed cultures.
29
Fig. 2: Sites of sample collection
30
2.1.3.2. Culture media
2.1.3.2.1 Solid media
2.1.3.2.1.1 Blood Agar Base No. 2 (Oxoid), (g/l)
Proteose Peptone 15
Liver digest 2.5
Yeast extract 5
Sodium chloride 5
Agar No. 3 12
pH 7.4
Forty grams were suspended in one litre of distilled water, steamed
to dissolve completely and sterilized by autoclaving at 121 ºC for 15 min.
Defibrinated sheep blood was added to a final concentration of 10% after
the agar being cooled to 50 ºC, mixed gently and dispensed onto sterile
Petri-dishes.
2.1.3.2.1.2 Nutrient agar
Twenty eight grams of nutrient agar (Oxoid CMR32) were dissolved
in 1000 ml of distilled water, mixed and sterilized by autoclaving at
121˚C for 15 min. The medium was then poured into sterile universal
bottles and set in a slope position to solidify.
2.1.3.2.1.3 Urea agar base (g/l)
Peptone 1
Dextrose 1
Sodium Chloride 5
Disodium Phosphate 1.2
Potasium Dihydrogen Phosphate 0.8
Phenol Red 0.012
Agar no. 3 15g
pH 6.8
31
An amount of 2.4 g of urea agar base were suspended in 95 ml of
distilled water, steamed to dissolve completely, sterilized by autoclaving
at 115 ºC for 20 min and added aseptically to 5 ml of 40% urea solution
after cooling to 45 ºC. After being mixed well, the medium was
distributed into 10 ml sterile MacCarteny bottles and set in a slope
position to solidify.
2.1.3.2.1.4 Milk agar
Oxoid skimmed milk L31 was used. A volume of 50 ml of 10% of
milk solution was added to 100 ml of nutrient agar, mixed well, sterilized
at 110 ˚C for 5 min, cooled to 50 ˚C and distributed onto sterile Petri-
dishes in portions of 15 ml each.
2.1.3.2.2 Liquid medium
2.1.3.2.2.1 Nutrient Broth
Thirteen grams of nutrient broth (Oxoid M1) were added to 1000
ml of distilled water. The medium was distributed into 10 ml in universal
bottles and then sterilized by autoclaving at 121 ºC for 15 min.
2.1.3.2.2.2 Brain Heart Infusion (g/l)
Calf brain infusion solid 12.5
Beef heart infusion 5.0
Proteose peptone 10.0
Glucose 2.0
Sodium chloride 5.0
Di-Sodium phosphate 2.5
pH 7.4
Thirty seven grams were suspended in one litre of distilled water,
boiled to dissolve completely and distributed into 20 ml bottles and
sterilized by autoclaving at 120 ˚C for 15 min.
32
2.1.3.2.2.3 Peptone water (Oxoid) (g\l)
Peptone 10
Sodium chloride 5
pH 7.2
Fifteen grams were added to one litre of distilled water, mixed
well, distributed into sterile test tubes and autoclaved at 121 ˚C for 15
min.
2.1.3.2.2.4 MR-VP medium (Glucose phosphate medium)
Five grams of peptone and five grams of K2HPO4 were dissolved in
1000 ml of distilled water by steaming and filtered; the pH was adjusted
to 7.5. Five grams of glucose were added; the medium was then
distributed in 1.5 ml volumes into test tubes and sterilized by autoclaving
at 110 ºC for 10 min.
2.1.3.2.2.5 Peptone water sugars
Peptone water 900 ml
Andrade’s indicator 10 ml
The pH of the peptone water was adjusted to 7.1 - 7.3 before
adding the Andrade’s indicator. Ten grams of the appropriate sugar
dissolved in 90 ml of distilled water were added to the mixture and mixed
thoroughly, distributed in five ml portions into sterile test tubes and
sterilized by autoclaving at 110 ˚C for 10 min.
2.1.3.2.2.6 Nitrate broth
KNO3 was dissolved in the broth, distributed in sterile test tubes,
and sterilized by autoclaving at 115 ˚C for 10 min.
2.1.3.6 Biochemical tests
2.1.3.6.1 Aerobic growth
Test organisms were inoculated on blood agar plates, incubated
aerobically at 37 ˚C for 48 h and then checked for growth.
33
2.1.3.6.2 Haemolytic activity
Blood agar plates were inoculated with the test organisms,
incubated at 37 ˚C for 48 h, put at 4 ˚C for 24 h. The haemolysis was read
thereafter to perform hot cold haemolysis test.
2.1.3.6.3 Catalase test
A drop of 3% aqueous solution of hydrogen peroxide (H2O2) was
placed on a clean microscopic slide, then with glass or wood loop a
colony of the test organism was added to it. The test is considered
positive when gas bubbles appear on the surface.
2.1.3.6.4 Oxidase test
Strips of filter papers soaked in 1% solution of tetramethylene-p-
phenylene diamine dihydrochloride were used in this test. Young colonies
were picked with sterile bent glass rods and rubbed on the filter paper.
Reactions were considered positive when dark purple colour appeared
within 5-10 seconds.
2.1.3.6.5 Colony size and colour
Milk agar plates containing fresh colonies were placed on the
bench for overnight at room temperature. The size of a single colony was
measured, and the colour was noticed.
2.1.3.6.6 Coagulase slide test
To detect bound coagulase (clumping factor), a drop of
physiological saline was placed on a slide. A few colonies were
emulsified in the drop to make a thick suspension. A drop of undiluted
human plasma was placed at the end of the slide and then mixed gently
with the bacterial suspension. Clumping of the organism within 10
seconds was considered as a positive reaction.
2.1.3.6.7 Coagulase test
Equal amounts of diluted human plasma (1% in normal saline) and
34
48 h culture in nutrient broth were mixed carefully, and examined after 1,
2 and 6 hours. Negative tubes were further incubated overnight and then
re-examined.
2.1.3.6.8 Sugar fermentation test
The ability to ferment seven sugars was tested. The sugars were
mannitol, maltose, lactose, xylose, trehalose, fructose, mannose, raffinose
and sucrose. Each isolate was inoculated in a set of the seven sugars. The
tubes were then incubated and examined for up to 7 days. Change of
colour to pink indicated positive results.
2.1.3.6.9 Urease test
Urea agar slope was heavily inoculated with the test culture and
then incubated at 37 ˚C for 48 h. Positive reaction was indicated by
change of colour of the medium to the pinkish.
2.1.3.6.10 Novobiocin sensitivity test
The test organisms were spread on the surface of the blood agar
using a swab. Discs containing 5 µg of novobiocin were applied on the
plates using sterile forceps. The plates were incubated at 37 ˚C for 24 h.
Positive results showed a clear zone around the discs.
2.1.3.6.11 ß-Galactosidase test
A loop full of colonies was streaked on a filter paper placed into a
plate and 20 µl of ß-Galactasidase were added to it. The plate was
covered with aluminium foil and incubated at 37 °C for 1 h. A volume of
20 µl of NaOH was added before being read under UV light. Positive
results were indicated by the development of a fluorescent blue colour.
2.2 Molecular techniques for characterization of S. aureus subsp.
anaerobius isolates
Molecular biology techniques were used to confirm and to compare
the local isolates with the reference strains. Representative isolates were
35
randomly selected for these tests.
2.2.1. TBE Buffer (Tris-Borate-EDTA) 10x (pH 8.3)
Tris base 108 g
Boric acid 55 g
Na4EDTA 9.3 g
ddH2O 1000 ml
pH 8.3 (without adjustment).
2.2.2 PCR Master Mix
Super Hot Master Mix of Bioron (Bioron, Ludwigshafen,
Germany). This mixture contained: Taq DNA polymerase in reaction
buffer 0.1 unit/µl, antibodies to Taq DNA Polymerase, (NH4)2SO4 32
mM, Tris HCl, pH 8.8 at 25 °C, 130 mM, 0.2% Tween 20, MgCl2 3mM
and dNTP (dATP, dCTP, dGTP, dTTP) 0.4 mM of each.
2.2.3 Agarose gel (2%)
For small size gels, 2.4g of agarose were added to 120 ml of 1x
TBE buffer; heated in microwave to melt, mixed well before addition of
50 µl of ethidium bromide; the mixture was poured into the appropriate
plate and left to solidify after insertion of the appropriate comb.
2.2.4 Isolates for the molecular characterization
Twenty two isolates of S. aureus subsp. anaerobius (Table 1)
obtained from lymph node abscesses of sheep at different 3 areas (7 from
outbreak of sheep abscess in Alsamra village, 9 from Alkadaro slaughter
house and 6 from Ghanawa slaughter house).
2.2.5 DNA extraction
Genomic DNA was extracted using Axy Prep Bacterial Genomic
DNA Miniprep Kit of Axygen (Bioron, Ludwigshafen, Germany) with
some modifications of the manufacturer’s protocol:
- 3-5 colonies of S. aureus subsp. anaerobius obtained from 48 h blood
36
agar culture were suspended in 150 µl of the recommended buffer (after
adding the RNase).
- 10 l of Lysostaphin (Sigma, Taufkirchen, Germany) 1mg/ml were
added to the mixture and incubated at 37 °C for 1 h.
- 2 l of 10% Proteinase K (Bioron) was added and incubated at 56 °C for
2 h.
2.2.6 DNA concentration
For all samples, the DNA concentration was measured by a
spectrophotometer (Nanodrop ND1000, Peqlab, Erlangen, Germany).
2.2.7 Purification of the PCR products for sequencing
Montage PCR Centrifugal Filter Devices (Millipore, Bedford,
USA) were used to purify PCR products prior to sequencing.
2.2.8 Primers
Primers used in this part are listed in table (2). All primers were
synthesised by ThermoFisher Scientific, Germany (Thermo Electron,
Oberhausen, Germany).
2.2.9 PCR reaction mixture
For 25 l PCR reaction mixture, the following were mixed:
Master Mix 12.5 µ
Primer 1 0.5 µ
Primer 2 0.5 µ
ddH2O 11.5 µ
A volume of 23 µl of the PCR mixture was added to 2 µ of the
DNA template.
37
Table 1: Staphylococcus aureus subsp. anaerobius used in this study
No. Code Source
1 K1 Alkadaro slaughterhouse
2 K8 Alkadaro slaughterhouse
3 K10 Alkadaro slaughterhouse
4 K11 Alkadaro slaughterhouse
5 K17 Alkadaro slaughterhouse
6 K18 Alkadaro slaughterhouse
7 K22 Alkadaro slaughterhouse
8 K41 Alkadaro slaughterhouse
9 G2 Ghanawa slaughterhouse
10 G35 Ghanawa slaughterhouse
11 G40 Ghanawa slaughterhouse
12 G42 Ghanawa slaughterhouse
13 G58 Ghanawa slaughterhouse
14 G97 Ghanawa slaughterhouse
15 S7 outbreak in Alsamra village
16 S8 outbreak in Alsamra village
17 S9 outbreak in Alsamra village
18 S10 outbreak in Alsamra village
19 S14 outbreak in Alsamra village
20 S16 outbreak in Alsamra village
21 S18 outbreak in Alsamra village
22 S19 outbreak in Alsamra village
23 Reference strain ATCC35844, DSM no. 20714*
24 Reference strain IBT Culture Collection Göttingen
no.9199/2628
*DSM: Deutsche Sammlung von Microorganismen und Zelkulturen,
Braunschweig, Germany.
38
Table 2: Oligonucleotides used in this study
Primer
name
Sequence Reference
nuc 1 5´GCGATTGATGGTGATACGGTT 3´ Brakstad et al. (1992)
nuc 2 5´AGCCAAGCCTTGACGAACTAAAGC 3´ Brakstad et al. (1992)
3 F 5 ́GCTTTTTAAGTGTACTATTC 3´ This study
164 F 5 ́TATAAATTGTGGAGGGATGAC 3´ Sanz et al. (2000)
808 F 5 ́CTCCATTTTAGAACGCAACAA 3´ Sanz et al. (2000)
1396 F 5 ́GATGGATACGGCTATGAATA 3´ This study
872 R 5 ́GCTATAATTTCAGCAGCTTC 3´ This study
1583 R 5 ́TGGGTCAGCTTTGTAACA 3´ Sanz et al. (2000)
1726 R 5 ́TCATAAACTGCTCAACTACGC 3´ Sanz et al. (2000)
786 5´GCGATCCCCA 3´ Pereira etal.(2002)
798 5 ́TGACCCGCC 3´ Pereira etal.(2002)
spa 1 5 ́CAAGCACCAAAAGAGGAA 3´ Frénay et al. (1994)
spa 2 5 ́CACCAGGTTTAACGACAT 3´ Frénay et al. (1994)
coa 1 5 ́CGAGACCAAGATTCAACAAG 3´ Goh et al. (1992)
coa 2 5 ́AAAGAAAACCACTCACATCA 3´ Goh et al. (1992)
39
2.2.10 PCR reaction conditions
PCR reaction conditions used for the amplification of different
genes targeted in this study are shown in Table 3.
Table 3: PCR thermocycler protocols used in this study
Step/ Nuclease Catalase RAPD Polymorphism
Protocol °C min °C min °C min °C min
First 94 5 94 10 - - - -
Denaturation 94 1 94 1 94 1 95 0.5
Annealing 55 0.5 52 1 36 1 55 2
Extension 72 1.5 72 1.5 72 2 72 4
Final 72 3.5 72 10 72 7 72 5
Cycles 37 30 30 40
2.2.11 Gel documentation
PCR-amplification products were subjected to electrophoresis in
agarose gel (section 2.2.2) in lx TBE buffer using horizontal electro-
phoresis system (Power N PAC 3000, BioRad, Munich, Germany). PCR
products (18 or 9 μl) were mixed with 1 or 2 l of bromphenol blue stain
before being applied to wells. Seven µl of the molecular weight standard
(λ DNA-Hind III/ФXHae III (Finnzymes, Espoo, Finland) was included
in each gel. One hundred constant volts were applied to the gels for 1 h.
DNA amplified segments were visualized by UV illuminator (MWG,
Ebersberg, Germany) connected to a PC and a monitor.
40
2.2.12 nuc gene detection
PCR amplification of the nuclease (nuc) gene was done so as to
confirm the biochemical identification of the isolates as S. aureus. The
primers designed by Brakstad et al. (1992) were used for this purpose
(Table 2).
2.2.13 Catalase gene (kat gene)
2.2.13.1 Amplification of the catalase gene (kat gene)
Many segments of the catalase gene were amplified using many
sets of primers (Table 2). The primers were designed in this study based
on the sequences of the catalase genes of S. aureus strain MVF213
(GenBank accession no. AJ000471) and S. aureus strain ATCC12600
(GenBank accession no. AJ000472).
2.2.13.2 Sequencing of the catalase gene
PCR amplification products of some segments of the catalase gene
were sequenced in this part. Sequencing of the whole catalase gene of
isolate S10 was achieved by partial sequencing using sets of primers as
follows: 808F and 1583R; 164F and 1396R; 1396F and 1726 R; 3F and
872R. Partial sequencing of about 990 bp of other five (K22, K41, G2,
G35 and S19), and about 700 bp of three (K1, G97 and S7) local isolates
in addition to one reference strain (ATCC35844, DSM no. 20714) was
done using primer 1583R.
Purified PCR products plus the diluted primers (10 pM) were sent
to in a commercial company (SeqLab, Göttingen, Germany) in an ABI
sequencer.
2.2.13.3 Sequence alignment and editing
The sequences of the PCR products were edited by BioEdit
Sequence Alignment Editor, version 7.05.3 (10/28/05).
41
2.2.14 RAPD-PCR
Randomly amplified polymorphic DNA PCR (RAPD) was used to
detect possible differences between the strains. Two primers (786 and
798) designed by Pereira et al. (2002) were used (Table 2). Amplification
conditions are shown in Table 3.
2.2.14.1 RAPD optimization (Confirmatory test for MgCl2)
When the PCR reaction mixture mentioned by Pereira et al. (2002)
was used, no clear amplicons were seen. So, two additional MgCl2
concentrations (4.5 mM, and 6 mM) in the PCR reaction mixture were
evaluated.
2.2.15 Pulsed-field gel electrophoresis (PFGE)
2.2.15.1 Buffers
2.2.15.1.1 Lysis buffer, pH 7.6
Tris 6 mM
NaCl 1 mM
EDTA 10 mM.
Brij-58 5 g.
Sodium deoxycholate 2 g.
Sodium lauroylsarcosine 5 g.
Lysozyme 5 g.
Lysostaphin 5000 units
dd H2O 1000 ml
2.2.15.1.2 Washing buffer (Tris - EDTA), pH 8.0
TrisHCl 10 mM
EDTA 1 mM
dd H2O 1000 ml
42
2.2.15.2 PFGE Protocol
-Overnight cultures of bacterial cells were harvested and resuspended in
10 mM Tris-EDTA after washing in TE buffer (l0 mM Tris-HCl, 50 mM
EDTA; pH 7.5).
- The bacterial suspension was adjusted to a concentration of 1x109
cfu/ml by using Mc Farland tube No. 4 turbidity.
-200 µl of the bacterial suspension was added to an equal volume of 2%
low-melting point agarose, 6 µl of lysostaphin were added and mixed
well before being allowed to solidify in a plug mold (Bio-Rad).
-Each agarose block was removed from the mold and suspended in the
lysis solution. The bacterial cells were lysed by subsequent incubation of
the blocks in 100 µl lysis buffer at 37 °C for 6 h.
-The gel plugs were incubated overnight at 55 °C in 2 ml of proteinase K
(10 mg/ ml), with gentle shaking.
-The plugs were washed 3 times with a cold TE buffer for 20 minutes.
Slices of the plug were cut and digested with 40 U of restriction
endonuclease SmaI (Bioron) in the recommended restriction enzyme
buffer (supplied by the manufacturer) and incubated overnight at 30 °C.
-The plugs were then loaded into 1% agarose gel wells, and sealed with
2% low-melting point agarose.
-The contourclamped homogeneous electric field apparatus from Bio-Rad
was used to separate the DNA fragments.
-The gel was subjected to electrophoresis for 24 h at 15 °C with a voltage
of 175 V and pulse times of 15 to 30 s in 0.05 M Tris-borate-EDTA
buffer.
-The pulse times used were 5 s to 15 s for 8 h followed by 15 s to 25 s for
10 h.
43
-The gel was then visualized and photographed using a UV Trans-
illuminator (MWG, Esberg, Germany) connected to a PC and a monitor.
2.3 Animal experiments
2.3.1 Pathogenecity of S. aureus subsp. anaerobius
Blood agar culture of S. aureus subsp. anaerobius was inoculated
in brain heart infusion broth and incubated at 37 °C for 48 h. The culture
was counted according to Miles and Misra (1938), and different dilutions
were made.
Each of five Hamari lambs (about 10 months old) was inoculated
with six different doses of the organism as shown in Table 4. The
inoculums were injected subcutaneously after shaving and proper
disinfection.
Table 4: Number of the inoculated organisms per lamb for pathogenecity
test
Dose no. No. of organisms (CFU) Site of inoculation
1 480 Right (upper neck)
2 2400 Right (middle neck)
3 4800 Right (lower neck)
4 24000 Left (upper neck)
5 48000 Left (middle neck)
6 480000 Left (lower neck)
2.3.2 Pathogenecity of other staphylococci
I) Five 8-12 months old Hamary male sheep were kept for 15 days as
adaptation period, during which they were given doses of anthelmentics
and antibiotics. Each of five different Staphylococcus species (S. aureus
subsp. anaerobius, S. aureus, S. caseolyticus, S. lugdenensis and S.
simians), which were isolated in this study, was inoculated in one animal.
Blood agar cultures of the organisms were inoculated into Brain Heart
44
Infusion broth, incubated at 37 °C for 48 h before being inoculated to the
animals. Each animal was noculated with 1200 cfu of each organism in
right middle of the neck after shaving, cleaning with cotton soaked in
70% alcohol and drying with sterile gauze.
II) Each of other four animals, prepared as mentioned above, was
inoculated using one mixture of two isolates:
-S. aureus subsp. anaerobius + S. aureus
-S. aureus subsp. anaerobius +S. caseolyticus,
-S. aureus subsp. anaerobius +S. lugdenensis
-S. aureus subsp. anaerobius + S. simians
A fifth ram was inoculated with S. aureus subsp. anaerobius alone
as control.
2.3.3 Vaccination and challenge
2.3.3.1 The vaccine
The vaccine used in this study was originally prepared by Rodwan
(1996). It was prepared from broth cultures of S. aureus subsp.
anaerobius supplemented with 2% horse serum. The cultures were
incubated under anaerobic conditions, at 37 °C for 48-72 h. The media
were constantly adjusted to pH 7.2.
2.3.3.1.2 Ingredients of the vaccine
The vaccine consisted of the following mixtures of antigens:
(i) Whole formalinized culture.
(ii) Toxoid.
(iii) Capsule.
These components were prepared by the following procedures:
(i) Toxoid
The supernatant of broth cultures (on brain heart infusion broth and
RCM) of S. aureus subsp. anaerobius (Isolate no. 11) were filtered
45
through a 0.4 µm Seitz filter and then concentrated twice using
polyethylene glycol; pH of the concentrated toxin was adjusted to 7.0;
formaline was added to a final concentration of 0.5% (v/v) to inactivate
the toxin.
(ii) Capsular antigen
The capsular antigen was prepared by culturing S. aureus subsp.
anaerobius on a special solid medium containing peptone, beef and yeast
extracts, Na, Mn, K, salts in addition to horse serum, glucose and
charcoal according to Rajab (1997).
The vaccine strain of the organism was cultured on this medium,
incubated in 10% CO2 tension at 37 °C for 24 h. Cultures were
subsequently washed with 4 ml of 1% phenol and then kept at 4 °C for at
least two weeks before use.
2.3.3.1.3 Mixing different ingredients of the vaccine
Thirty millilitres of the double concentrated toxoid were added to
45 ml of formalinized 48 h culture in brain heart infusion broth, pH of the
mixture was adjusted to pH 7.0, 25 ml of the medium containing capsule
were added. All ingredients were added while gentlely shaking; the pH
was maintained at pH 7.0. Formaldehyde was added to a final
concentration of 0.5 % v/v. The final vaccine was further diluted by
addition of 75% of the mixture and 25% sterile normal saline.
2.3.3.2 Evaluation of the effective dose of the vaccine
2.3.3.2.1 Titration of the vaccine
Eighteen, 8-12 months old, Hamari male sheep were purchased
from the local market. The animals were kept for adaptation period,
during which they were given prophylactic doses of anthilmentics, and
antibiotics and were sprayed with acaricides. The animals were divided
into 6 groups. Each one of the 5 groups received a different dose of the
46
vaccine, while the sixth group served as a control non-vaccinated. The
vaccine was diluted with sterile normal saline and completed to one
millilitre as shown in Table 5. The doses were 0.25, 0.75, 0.5, 1 and 0.5
m. The last group received a booster dose of another 0.25 ml after 2
weeks. The vaccine doses were injected subcutaeonusly at the right side
in the middle crest of the neck after shaving. The sites of injection were
examined daily for up to 21 days and the rectal temperature was recorded,
whole blood for haemogram was collected weekly. Injection sites of the
vaccine and challenge were examined daily and palpated for post-
vaccinal tissue reaction.
2.3.3.2.2 Challenge
After 21 days, animals of all groups (the previous section) were
challenged with 1200 cfu of S. aureus subsp. anaerobius as in section
2.3.1. The sites of inoculation were examined daily for up to 14 days for
development of abscesses. Rectal temperature was recorded. Whole blood
for haemogram was collected weekly. The diameter of the inoculation
sites were recorded in mm. Pus samples were collected from the
discharging abscesses in sterile containers and cultured in the same day
on blood agar.
Table 5: Vaccination trials of groups of sheep with different doses of the
vaccine against Morel’s disease
Group A B C D E Control
Dose of vaccine (ml)
0.25
0.50
0.75
1.00
initial booster
0 0.50 0.25
Diluent (Sterile
Normal Saline), ml 0.75 0.50 0.25 0 0.50 0.75 1.0
Total (ml) 1.0 1.0 1.0 1.0 1.0 1.0 1.0
47
2.3.3.2.2 Evaluation of the vaccine against different staphylococci
This experiment was conducted to evaluate the ability of Morel’s
disease vaccine to protect against abscess formation caused other
staphylococci.
2.3.3.2.2.1 Vaccination and challenge with one Staphylococcus species
Five, 8-12 months old male Hamary sheep were kept for adaptation
period of one week after receiving prophylactic doses of anthilmentic,
antibiotic and being sprayed with acaricides. The animals were
vaccinated with 0.5 ml of the vaccine and boostered after 15 days with
0.25 ml.
The sheep were challenged after one month from the first dose of
the vaccine with 4,800 cfu of one species of staphylococci isolated in this
study. Animals were daily examined for up to 21 days.
2.3.3.2.2.2 Vaccination and challenge with two Staphylococcus species
Ten 8-12 months old Hamary male sheep were kept for a period of
adaptation of one week after being given prophylactic doses of
anthilmentic, antibiotic and sprayed with acaricide. All animals were
vaccinated with 0.5 ml of the vaccine and boostered after 15 days using
0.25 ml. The animals were divided into two groups; each group was
challenged- one month after vaccination- with a mixture of S. aureus
subsp. anaerobius (1200 cfu) and 0.5 of neat culture (about 2,400,000
cfu) of either of S. aureus and S. caseolyticus. Two animals of each group
received one species as control.
2.3.3.2.2.3 Post-mortem examination
All animals were slaughtered three weeks after challenge.
Macroscopic findings were recorded in control sheets. Samples were
taken for both bacteriology and histopathology in addition to impression
smears. One spleen from each group was taken for plaque forming cell
48
assay test.
2.6 Immunological tests
2.6.1 Plaque forming cell assay
2.6.1.1 Preparation of the antigen
Sheep blood was collected in Alsever’s solution (10%). The red
blood cells (RBCs) were washed 3 times with phosphate buffer saline
(PBS), pH 7.4. Equivalent volumes of 10% RBCs and tannic acid
solution (5 mg tannic acid in 100 ml PBS) were mixed and incubated at
37 °C for 20 min. The Ag (vaccine) was dissolved in PBS pH 6.4 at
concentration of 0.2-mg/ ml. Equivalent volumes of Ag, with tanned
sheep RBCs were mixed well and incubated at 37°C for 20 minutes. The
combination was then washed three times in normal saline containing
0.5% heat inactivated normal rabbit serum (at 56°C).
2.6.1.1.2 Sheep red blood cells (SRBCs)
Sheep blood was washed twice in Phosphate Buffered Saline (PBS)
and once in Balanced Salt Solution (BSS)- “Hank’s Solution”-, then the
blood was diluted to 1 in 3 with BSS. RBCs were washed three times
with PBS and then re-suspended as 20% volumes.
2.6.1.1.3 Effector cells
The splenic cells were collected from the four groups of sheep:
before vaccination, one week after vaccination, two weeks after
vaccination and one week after the booster dose of the vaccine. The cells
were washed three times in BSS and re-suspended as 10% in BSS
2.6.1.1.4 Agarose
The agarose was dissolved in BSS at 0.5% in a 100 °C water bath
and then held at 47 °C until used.
2.6.1.1. 5 Complement
Freeze-dried Guinea pig serum (Wellcome, UK) was used as
49
complement source. The contents were reconstituted in 2 ml sterile
distilled water and then diluted to 1 in 3 with BSS.
2.6.1.1.6 Balanced Salt Solution (BSS)
The following ingredients were dissolved:
Phenol 10 mg
CaCl2 140 mg
NaCl 800 mg
KCl 100 mg
MgSO4.7H2O 200 mg
MgCl2.6H2O 200 mg
The salts were added to one litre of distilled water, the pH was
adjusted to 7.0-7.2 and the solution was stored at -20 °C until used.
2.6.1.2 Plaque forming cell assay mixture
Small test tubes were placed in 47 °C water bath; to each tube the
following items were added:
Agarose 300 μl
RBCs 20 μl
Spleen cell suspension 100 μl
Complement (dil. 1:3, added while whirl mixing) 40 μl
All components were mixed rapidly on a whirl-mixer, poured on a
slide and allowed to set. The slides were incubated at 37 °C in humidity
chamber, examined after one hour by the naked eye and low power lens
of the microscope (10x) and also after overnight incubation.
2.6.1.2 Validity of spleen cells
Viable spleen cells count was done every day untill all cells were
dead, using trypan blue staining method. The cells were stored in either
RPMI; Histopaque solution or were left without storage solution.
50
2.6.2 Opsonophagcytosis tests
Phagocytosis of S. aureus by ovine polymorphnuclear cells
(neutrophils) in the presence or absence of opsonin was measured using a
modification of the method of Verhoef et al. (1977) as below.
2.6.2.1 Bacterial growth
S. aureus subsp. anaerobius were grown in 5 ml nutrient broth at
37 °C for 48 h and used at a concentration equivalent to McFarland’s
opacity tube No. 4, which is equivalent to 1.2 X 109 cell/ml, according to
Baron et al. (1994).
2.6.2.2 Blood samples
Fresh sheep blood was collected from the jugular vein of healthy
sheep using sodium citrate as anticoagulant. A volume of 0.9 ml of sterile
PBS was pipetted into each of four test tubes under aseptic conditions;
0.1 ml S. aureus subsp. anaerobius culture was added to the first tube and
serially diluted. Dilution 1/1000 was used in this test.
2.6.2.3 Opsonization method
The test was performed in three eppendorf tubes. In the first tube
0.2 ml of the diluted culture of S. aureus subsp. anaerobius was added to
0.1 ml of the vaccinated sheep serum; in the second eppendorf tube 0.2
ml of the diluted culture of S. aureus and 0.1 ml normal sheep serum; the
third and fourth eppendorf tubes served as controls containing 0.2 ml of
diluted cultures (S. aureus or S. aureus subsp. anaerobius) and 0.6 ml
sheep blood. The tubes were incubated for 30 min with mixing every 10
min. After incubation, 0.5 ml of fresh sheep blood was added to each
tube.
Phagocytosis assay was carried out by incubation of the eppendorf
tubes at 37 °C with frequent mixing for 1 h. One ml of the mixture of
each tube was then inoculated subcutaneously into experimental animals
51
(Hamary sheep) at 0 and 120 min and spread at the same time on blood
agar plates by dropping 10 μl into blood agar plates. Each experiment was
done in duplicates. The plates were incubated at 37 °C for 24 h under
10% increased CO2 tension, growing colonies were counted.
52
CHAPTER THREE
RESULTS
3.1 Survey for sheep abscess disease
3.1.1 Isolates from lymph nodes of animals at meat inspection
From 170 pus samples of infected lymph nodes collected from
sheep at meat inspection at Alkadaro, Ghanawa and Alsabaloga slaughter
houses, 117 (68.8%) were Staphylococcus spp., 45 (26.5%)
Corynebacterium spp. and 8 samples (4.7%) yielded both Staphylococcus
spp. and Corynebacterium spp. Fig. 3.
Staphylococcus aureus subsp. anaerobius was the most prevalent
among staphylococci isolates (63.2%) followed by S. caseolyticus
(21.3%), S. aureus (11.9%) and S. simians, S. lugdunensis, S. warneri, S.
epidermidis (each 0.9%) as shown in Fig. 4 and Table 6.
3.1.2 Isolates from outbreak of sheep abscess disease
The outbreak occurred in a flock of sheep in Alsamra village in
Khartoum State. The animals were freely raised in natural grazing area
during the day and they used to reside to pen in the evenings, where they
received some type of feed supplementation. The morbidity among herd
was 30%. Two females were infected and lambs of about 2 months of age
were also infected. The commonly infected lymph nodes were
prescapular, parotid and submandibular (Fig. 5). From 28 animals
(93.3%) of the pus samples yielded pure cultures of S. aureus subsp.
anaerobius, while the rest two animals (6.7%) yielded Corynebacterium
spp.
53
Fig. 3: Bacteria isolated from superficial lymph abscess of sheep at meat
inspection
Fig. 4: Staphylococcus spp. isolated from superficial lymph node
abscesses of sheep at meat inspection
63 % 12 %
21 %
1 % 1 %
1 % 1 %
Staphylococcus aureus subsp. anaerobius
S. aureus
S. caseolyticus
S. simians
S. lugdunensis
S. warneri
S. epidermidis
54
Fig. 5: Sheep flock in Alsamra village, Khartoum North, Sudan,
in which outbreak of abscess disease occurred. A, C, abscesses in
the parotid lymph node; B, abscesses in the parotid and
submandibular lymph nodes; D, abscesses in the parotid and
prescapular lymph nodes; E: part of the flock in natural grazing
area.
55
Table 6: Staphylococcus species isolated from infected superficial lymph
nodes anscesses of sheep at meat inspection in Alkadaro, Ghanawa and
Alsabaloga slaughter houses in Khartoum State
No. Staphylococcus spp. Total no. %
1 S. aureus subsp. anaerobius 74 63.2
2 S. caseolyticus* 25 21.3
3 S. aureus 14 11.9
4 S. simians 1 0.9
5 S. lugdunensis 1 0.9
6 S. warneri 1 0.9
7 S. epidermidis 1 0.9
* Staphylococcus caseolyticus has been renamed Macrococcus caseolyticus
3.2 Properties of staphylococci isolated from sheep abscesses
All isolates grew well under anaerobic conditions after 48 h
incubation at 37 °C. S. aureus subsp. anaerobius colonies were smooth,
glistening, convex, about 1 mm in diameter (Fig. 6). Colony properties of
other staphylococci are shown in Table 7.
Table 7: Colonial morphology of staphylococci isolated from superficial
lymoh node abscesses of sheep
No. Staphylococcus spp. Total no. %
1 S. aureus subsp. anaerobius 74 63.2
2 S. caseolyticus* 25 21.3
3 S. aureus 14 11.9
4 S. simians 1 0.9
5 S. lugdunensis 1 0.9
6 S. warneri 1 0.9
7 S. epidermidis 1 0.9
* Staphylococcus caseolyticus has been renamed Macrococcus caseolyticus
56
Fig 6: Staphylococcus aureus subsp. anaerobius colonies grown on blood
agar medium.
57
3.3 Biochemical properties
The biochemical properties of bacteria isolated in this study are
shown in Tables 8 and 9.
All S. aureus subsp. anaerobius isolates were anaerobic, 95% grew
as pin point colonies after 4-5 days of aerobic incubation, all were
haemolytic; catalase, oxidase, manniol, and B-galactosidase negative; all
were positive for the clumping factor and coagulase.
58
Table 8: Biochemical properties of staphylococci isolated from lymph
node abscesses of sheep at meat inspection and with Morel’s Disease
59
Table 8: continued
60
Table 8: continued
61
Table 9: Biochemical properties of Staphylococcus aureus subsp.
anaerobius isolated in this study
No. Test
No. of
positive
isolates
No. of
negative
isolates
No. of
doubtful
isolates
1 Anaerobic
growth 74 - -
2 Aerobic growth1 - 4 70
3 Haemolysis2 74 - -
4 Oxidase - 74 -
5 Catalase 74 - -
6 Coagulase3 74 -
7 Mannitol
(anaerobic)
- 74 -
8 ß- galactosidase - 74 -
9 Clumping factor 74 - -
10 VP - 72 2
1: very small colonies after 4-5 days, 2: double zoon, hot cold
haemolysis, 3: after 1 hour and also after 24 overnight incubation.
62
3.9 Molecular biology results
3.9.1 DNA concentrations
DNA concentrations extracted from the isolates used in molecular
characterization are shown in Table 12.
Table 10: DNA concentrations of S. aureus subsp. anaerobius isolates
used in the part of molecular characterization
No. Isolate code DNA concentration (ng/µl)
1 K1 3.6
2 K8 6.3
3 K10 2.3
4 K11 2.9
5 K17 2.1
6 K18 1.6
7 K22 1.1
8 K41 0.7
9 G2 0.8
10 G35 1.2
11 G40 1.4
12 G42 2.3
13 G58 2.4
14 G97 1.4
15 S7 2.7
16 S8 3.1
17 S9 3.0
18 S10 3.0
19 S14 7.3
20 S16 2.3
21 S18 8.9
22 S19 15.5
23 Reference strain ATCC35844,
DSM no. 20714
4.2
24 Reference strain IBT-Göttingen
Culture Collection No. 9199/2628
1.3
DSM: Deutsche Sammlung von Zellkulturen und Mikroorganismen
63
3.9.2 Nuc gene detection
All S. aureus subsp. anaerobius isolates yielded amplicons of the
nuc gene as shown in Fig.7.
3.9.3 Catalase gene (kat gene)
3.9.3.1 Detection of the catalase gene
All S. aureus subsp. anaerobius isolates yielded positive
amplification results of the catalase gene. Amplicons of the catalase gene
using different sets of primers are shown in Figs. 8, 9 and 10.
3.9.3.2 Sequencing results of the catalase gene
The complete sequence of the catalase gene of S10, isolated from
the outbreak in Alsamra village, is shown in Table 11 and Appendix 1.
The whole amplified part of the putative catalase gene of strain S10
(katS10) was 1725 nucleotides in length. The open reading frame starts at
base 164 (ATG, the initiation codon), and ends at base 1999 (TGA, the
stop codon). This sequence was deposited in the GenBank under
accession no. EU281993 (Appendix 2).
Catalase gene sequence of S. aureus subsp. anaerobius strain S10
(outbreak isolate) showed 99% identity to that of S. aureus subsp.
anaerobius MVF213 (GenBank accession no. AJ000471), S. aureus
subsp. aureus NCTC8325, S. aureus subsp. aureus strain Newman
(GenBank accession nos.CP000253 and AP00935.1, respectively) as
shown in Appendices 2 and 3.
Comparison of this sequence with the sequence of katB (the
catalase-like protein of S. aureus subsp. anaerobius MVF214) revealed
mismatches of only three bases, but in comparison with katA gene
sequence of S. aureus subsp. aureus strains (NCTC 8325 and strain
Newman), 15 bases substitutions occurred within the coding region for
katA, six of which were mis-sense mutations while the others were silent
64
mutations (Fig. 11, Tables 12 and 13). The substitution occurred at
position no. 1099 of katS10 gene from “C”, in katA and katB genes to “T”
resulted in a stop codon. The predicted protein encoded by katS10 is 345
amino acids in length (Appendix 4).
The partial sequence of the catalase gene of other two isolates from
the same disease outbreak in Alsamra village (S7, S19) in addition to 3
isolates from each of Ghanawa (G1, G11) and Alkadaro (K1, K35)
slaughter houses were 100% identical to that of the corresponding region
of katS10.
The partial sequence of the refrence strain, S. aureus subsp.
anaerobius ATCC35844, DSM no. 20714, was 100% identical to that of
MVF213.
The sequence results of the other nine strains: K41, S19, G2 and
the reference strain are shown in Appendices 6, 7, 8 and 9, respectively.
65
MW G2 G35 G40 G97 k10 k11 k17 k18 k22 k41 S9 S10 S14 S16S18S19Ref1-ve
Fig. 7: a and b, agarose gel (2%) electrophoresis results of amplification
of the nuc gene of S. aureus subsp. anaerobius isolates.
G2, G35, etc…, isolates obtained from Ghanawa Slaughter House
K1, K2, etc…, isolates obtained from Alkadaro Slaughter House
S7, S8, etc…, isolates of the outbreak of Morel’s disease in Alsamra
village.
Ref1= ATCC35844/DSM no. 20714,
Ref2= IBT-Göttingen Culture Collection no.9199/2628.
MW= molecular mass marker: λ DNA-Hind III/ФXHaeIII (Finnzymes,
Espoo, Finland).
66
MW k1 k8 k10 k11 k17 k18 k22 k41 G2 G35 G40 G58 -ve
Fig. 8: Agarose gel (2%) electrophoresis results of amplification o f kat
gene of S. aureus subsp. anaerobius isolates using primers 808F and
1583R. Abbreviations as in Fig. 7.
MW Ref1 Ref
2 G97 S10 k1 -ve Ref
1 Ref
2 G97 S10 k1 -ve
Fig. 9: Agarose gel (2%) electrophoresis results of amplification of kat
gene of S. aureus subsp. anaerobius isolates using primers 1396F and
1583R (lanes 2, 3, 4, 5, 6, 7), 164F and 872R (lanes 8, 9, 10, 11, 12, 13).
Abbreviations as in Fig. 7.
67
a)
MW k1 k8 k10 k11 k17 k18 k22 k41 G2 G35 G40 G42 -ve
b)
MW G58 G97 S7 S8 S9 S10 S14 S16 S18 S19 Ref1 Ref2 -ve
Fig. 10 a and b: Agarose gel (2%) electrophoresis results of amplification
of kat gene of S. aureus subsp. anaerobius isolates using primers 164F
and 1583R. Abbreviations as in Fig. 7.
68
Table 11: The complete sequence of the catalase-like protein gene of S.
aureus subsp. anaerobius strain S10 (isolated from outbreak of Morel’s
disease in Alsamra village, Khartoum North Sudan)
GCTTTTTAAGTGTACTATTCAATAACTATTTAGTACTGTAAAGCGAAAAAA
ATAAAATTTTCTGATTTTTTAATCATCTTGAGCATGTTTAATTGTAATTCTG
ATGGGGTTAAATTATAATATGTATTAAATTATAATTATTATAAATTGTGGA
GGGATGACTATGTCACAACAAGACAAAAAGTTAACTGGTGTTTTTGGGCA
TCCAGTATCAGATCGAGAAAATAGTATGACAGCAGGGCCTAGGGGACCTC
TTTTAATGCAAGATATTTACTTTTTAGAGCAAATGTCTCAATTTGATAGAG
AAGTAATACCAGAACGTCGAATGCATGCCAAAGGTTCTGGTGCATTTGGG
ACATTTACTGTAACTAAAGATATAACAAAATATACGAATGCTAAAATATT
CTCTGAAATAGGTAAGCAAACCGAAATGTTTGCCCGTTTCTCTACTGTAGC
AGGAGAACGTGGTGCTGCTGATGCGGAGAGTGACATTCGAGGATTTGCGT
TAAAGTTCTACACTGAAGAAGGAAACTGGGATTTAGTAGGGAATAACACA
CCAGTATTCTTCTTTAGAGATCCAAAGCTATTTGTTAGTTTAAATCGCGCG
GTGAAACGAGATCCTAGAACAAATATGAGAGATGCACAAAATAACTGGG
ATTTCTGGACGGGGCTTCCAGAAGCATTGCACCAAGTAACGATCTTAATG
TCAGATAGAGGGATTCCTAAAGATTTACGTCACATGCATGGGTTCGGTTC
ACACACATACTCTATGTATAATGATTCTGGTGAACGTGTTTGGGTTAAACT
CCATTTTAGAACGCAACAAGGTATTGAAAACTTAACTGATGAAGAAGCTG
CTGAAATTATAGCAACAGGTCGTGATTCATCTCAACGCGATTTATTCGAAG
CCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATG
ACTGAGGAACAAGCTAAAAACCATAAAGATAATCCATTTGATTTAACAAA
AGTATGGTATCACGATGAGTATCCTCTAATTGAAGTTGGAGAGTTTGAATT
AAATAGAAATCCAGATAATTACTTTATGGATGTTGAACAAGTTGCGTTTGC
ACCAACTAATATTATTCCAGGATTAGATTTTTCTCCAGACAAAATGCTGCA
AGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATTGATTAGGAGTTA
ATCATTGGCAGATTCCTGTAAACCAACCTAAAGGTGTGGGTATTGAAAAT
ATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGACAATAACCAA
GGTGGAGGAACACATTATTATCCAAATAACCATGGTAAATTTGATTCTCA
ACCTGAATATAAAAAGCCACCATTCCCAACTGATGGATACGGCTATGAAT
ATAATCAACGTCAAGATGATGATAATTATTTTGAACAACCAGGTAAATTG
TTTAGATTACAATCAGAGGGCGCTAAAGAAAGAATTTTTACAAATACAGC
AAATGCAATGGAAGGCGTAACGGATGATGTTAAACGACGTCATATTCGTC
ATTGTTACAAAGCTGACCCAGAATATGGTAAAGGTGTTGCAAAAGCATTA
GGTATTGATATAAATTCTATTGATCTTGAAACTGAAAATGATGAAACATA
CGAAAACTTTGAAAAATAAATTTGATATGTAGTTTCTATATTGCGTAGTTG
AGCAGTTTATGA
ATG: initiation codon.
TGA: stop codon
69
108
S10 AGERGAADAESDIRGFALKFYTE
SA AGERGAADAERDIRGFALKFYTE
215 238
S10 MYNDSGERVWVKLHFRTQQGIENLTDEEAAEIIATGRD
SA MYNDSGERVWVKFHFRTQQGIENLTDEEAAEIIATDRD
313
S10 RNPDNYFMDVEQVAFAPTNII
SA RNPDNYFMDVEQAAFAPTNII
346
S10 FSYGDAQRY*LGVNHWQIPVNQPK
SA FSYGDAQRYRLGVNHWQIPVNQPK
440
S10 QDDDNYFEQPGKLFRLQSEGAKERIFTNTANA
SA QDDDNYFEQPGKLFRLQSEDAKERIFTNTANA
Fig. 11: Illustration of the amino acids substitutions in the catalase
protein of S. aureus subsp. aureus NCTC 8325 (SA) and the deduced
catalase- like protein of S. aureus subsp. anaerobius strain S10 (S10).
The figures indicate the position of the amino acids.
70
Table 12: Nucleotide substitutions in the sequence of the catalase-like
protein gene of S10 compared with that of S. aureus subsp. anaerobius
MVF 213 and S. aureus NCTC 8325
No. Nucletoide
position
S10 MVF213 NCTC 8325
1 52 A T
2 61 T G T
3 101 C T
4 217 T C
5 485 A C
6 529 A G
7 584 C T
8 604 C T
9 670 G T
10 739 C T
11 757 A T
12 806 C T
13 871 A T
14 876 G A
15 1101 T C
16 1112 C T C
17 1199 T C C
18 1249 G T
19 1482 G A
20 1501 T Deletion T
71
Table 13: Amino acids resulted from nucleotide mutations in the
sequence of the catalase like protein gene of S10 compared with that of S.
aureus subsp. anaerobius MVF 213 and S. aureus NCTC 832
Nucletoide
position
S10 MVF213 NCTC 8325
485 R (Arginine)
(AGT)
S (Serine) (CGT)
806 L (Leucine)
(CTC)
F (phenylalanine)
(TTC)
876 G (Glycine)
(GGT)
D (Aspartic
acid)(GAT)
1101 V (Valine)
(GTT)
A (Alanine) (GCT)
1112 P(Proline)
(CCA)
S (Serine)
(TCA)
P (Proline) (CCA)
1199 STOP CODON
(TGA)
R (Arginine)
(CGA)
R (Arginine)
(CGA)
3.9.4 RAPD- PCR
3.9.4.1 Optimization of the reaction mixture
The optimum MgCl2 concentration for the RAPD-PCR test was
found to be 0.75 µl per reaction and it was used for all reactions.
3.9.4.2 RAPD- PCR amplification pattern
All local isolates plus one reference strain (ATCC35844/DSM no.
20714) had identical RAPD patterns with the two primers used, but they
were different from the other reference strains. Primer 786 yielded two
clear bands of about 1350 and 700 bp, while primer 798 yielded 5-8
bands. A clear band was about 500. Other bands were 400, 800, 900,
1000 and 1350 bp (Fig. 12 and 13).
72
a)
MW k1 k8 k10 k11 k17 k18 k22 k41 G2 G35 G40 G42 G58 Ref2
b)
MW G97 S7 S8 S9 S10 S14 S16 S18 S19 Ref1 Ref2 -ve
Fig. 12: Agarose gel (1%) electrophoresis results of amplification
of RAPD-PCR profiles of Staphylococcus aureus subsp.
anaerobius strains using primer 786. Abbreviations as in Fig. 7
73
a)
MW k1 k8 k10 k11 k17 k18 k22 k41 G2 G35 G40 G42 G58 Ref2
b)
MW S18 S19 G97 S7 S8 S9 S10 S14 S16 Ref1 Ref2 -ve
Fig. 13: Agarose gel (1%) electrophoresis results of RAPD-PCR of
Staphylococcus aureus subsp. anaerobius isolates using primer 798.
Abbreviations as in Fig. 7
74
3.9.5 Polymorphism of coa and spa gene markers
With primers for protein A encoding gene (spa) all local strains in
addition to one reference strain (DSM no. 20714, ATCC35844) yielded
amplicons of ~100 bp, while the other reference strain yielded a band of
~300 bp (Fig. 14).
With primers the coagulase gene (coa) all local isolates, yielded
one band of about 550 bp, while one of the two reference strains yielded a
band of about 600 and the other a band of about 700 bp (Fig. 15).
3.9.6 Pulsed-field gel electrophoresis (PFGE)
Pulsed-field gel electrophoresis of genomic DNA from the local
strains, after digestion with restriction endonuclease SmaI, revealed
identical restriction pattern, which was distinct for the restriction pattern
of the reference strain.
75
a)
MW k1 k8 k10 k11 k17 k18 k22 k41G2G35 G40 G42 G58 G97 S7 S8 S9S10 MW
b)
MW S14 S16 S18 S19 Ref1 Ref2
Fig. 14 a and b: Agarose gel (2%) electrophoresis of PCR products using
primers for the spa gene for different S. aureus subsp. anaerobius
isolates.
Abbreviations as in Fig. 7.
76
a)
MW k1 k8 k10 k11 k17 k18 k22 k41 G2 G35 G40 Ref1 Ref
2 -ve
B)
G42 G58 G97 S7 S8 S9 S10 S14 S16 S18 S19 MW
Fig. 15 a and b: Agarose gel (2%) electrophoresis of PCR products using
primers for the coa gene for different S. aureus subsp. anaerobius
isolates. Abbreviations as in Fig. 7.
77
3.4 Pathogenecity of S. aureus subsp. anaerobius and the abscess
causing dose
The aim of this experiment was to confirm the ability of S. aureus
subsp. anaerobius isolates to cause abscess formation in sheep before
conducting the vaccination and challenge experiments. All tested
inoculum sizes of S. aureus subsp. anaerobius were able to cause abscess
formation. The minimum dose used was 480 cfu. Abscess formation at
the site of inoculation is shown in Fig. 16.
3.5 Pathogenecity of other staphylococci
I) All animals inoculated with one species of Staphylococcus showed
visible swellings at the sites of inoculation followed by abscess formation
only in animals inoculated with S. aureus subsp. anaerobius and S.
aureus. The size of the abscess reached up to 6.4x4.5 cm in diameter.
Animals inoculated with the other species (i.e. S. caseolyticus, S.
lugdunensis, S. epidermidis and S. simians) showed no abscesses
formation, neither at the sites of inoculation nor in the superficial lymph
nodes, but enlargement of some of these lymph nodes. In animals
inoculated with S. caseolyticus, the right prescapular lymph node showed
focal areas of caseation. Except those inoculated with S. epidermidis and
S. lugdunensis, all animals showed infiltration of micro abscesses in the
liver and abscesses in the lung of the animal inoculated with S. aureus
subsp. anaerobius (Fig. 17 and 18, respectively). Post-mortem results of
sheep inoculated with Staphylococcus spp. are shown in the Table 14.
II) All animals inoculated with mixture of S. aureus anaerobius and one
of the other staphylococci showed abscesses at the inoculation sites and
in the prescapular lymph nodes. While S. aureus anaerobius was
recovered from abscesses of all animals, the other inoculated organism
was recovered only from those inoculated with S. aureus and S.
78
caseolyticus.
Table 14: Postmortem lesions on non-vaccinated sheep after inoculation
with some Staphylococcus spp. S. aureus
subsp.
anaerobius
S.
lugdunensis
S.
caseolyticus
S. aureus S.
epidermidis
S. simians
Inoculation
Site
Pus,
swelling
- - Pus,
swelling
- -
Prescapular
L.N.
R/enlarged
L/Haem.
R/L
enlarged
R/ enlarged,
caseated.
L/ enlarged
- R/ enlarged L/ Haem.
Parotid L.N. - - - - R/ L
enlarged
R/L
enlarged
Submandibular
L.N.
- - - - - L/ enlarged
Mesenteric
L.N.
- Corded - - - Enlarged
and corded
Precrural - - - R/L Haem. - -
Popliteal L.N. - - - - - -
Liver micro-
abscesses,
adhesion
of liver and
pluera
- Micro-
abscesses
Focal area
of
calcification
- Micro-
abscesses
Lung Abscess - - - - -
79
Fig 16: The inoculation site of sheep with different numbers of the
bacterial cells (CFU) of Staphylococcus aureus subsp. anaerobius.
Fig.17: Micro-abscesses in the liver of ram experimentally inoculated
with Staphylococcus aureus subsp. anaerobius.
80
Fig. 18: Abscess formation in the lung of lamb experimentally inoculated
with Staphylococcus aureus subsp. anaerobius
81
3.6 Determination of the effective dose of the vaccine
All vaccinated animals showed visible swellings at the sites of
injection followed by increase in temperature, which dropped two days
after challenge. In all vaccinated and challenged animals, except those
vaccinated with 0.5 ml and boostered with 0.25 ml, some postmortem
lesions could be observed in superficial lymph nodes, lung or liver (Table
15).
82
Table 15: Postmortem lesions of sheep inoculated with different doses of
the vaccine and challenged by 1200 cfu of Staphylococcus aureus subsp.
anaerobius
Animal
group
Liver
Lung
Lymph nodes
Pre-
scapular
Mes-
enteric
Popliteal
A - Micro
abscesses
Haemo-
rrhagic
Enlarged -
B - - R/L
Haemo-
rrhagic
- R/L
Haemo-
rrhagic
C Congestion,
calcification,
micro-
abscesses
- - Cording -
D - - R/
Inflammed
- -
E - - - - -
F Adhesion
between
pleura and
liver,
calcification,
necrotic foci
Abscessat
-ion,
Adhesion
Inflamed
with pus
Enlarged
and
corded
-
A: 0.25 ml of vaccine, B: 0.50 ml, C: 0.75 ml, D: 1.00 ml, E: 0.50 ml then
0.25 ml and F: Control
83
3.7 Challenge
3.7.1 Challenge using one Staphylococcus species
All vaccinated sheep that challenged with one species showed
slight increase in temperature. The temperature increased slightly, and
dropped two days after challenge. All animals showed neither abscess
formation at the inoculation sites nor in the internal organs. However,
animals inoculated with S. aureus subsp. anaerobius and S. aureus
showed swelling at the sites of inoculation which decreased after 2-3
days.
Hematological parameters showed increase in neutrophils and
slight decrease in PCV in all challenged groups.
3.7.2 Challenge using two Staphylococcus species
In animals challenged with two species of Staphylococcus, no
abscesses formed; neither in superficial lymph nodes nor in internal
organs.
Animals challenged with S. aureus subsp. anaerobius + S. aureus
showed signs of hyper sensitivety reaction: generalized swellings and
death after one day. At post-mortem, there was froth in the nostrils and
mouth, subcutaneous oedema (Fig. 24, 25 and 26), congestion in the
intestines (Figs. 27 and 28), brain (Fig. 29), lung, kidneys and in all
lymph nodes, froth in the trachea (Fig. 30) hydroprecardium, clots in both
ventricles (fibrin clot), increased synovial fluid and very flat spleen with
fibrin clot.
84
Fig. 19: Hyper immune reaction, general swelling in lamb
vaccinated with Morel’s disease vaccine and challenged by S.
aureus subsp. anaerobius + S. aureus
Fig. 20: Swelling in the chest of lamb vaccinated with Morel’s disease
vaccine and challenged by S. aureus subsp. anaerobius + S. aureus
85
Fig. 21: Subcutaneous oedema in lamb vaccinated with Morel’s disease
vaccine and challenged by S. aureus subsp. anaerobius + S. aureus
Fig.22: Congestion in the intestine of lamb vaccinated with Morel’s
disease vaccine and challenged by S. aureus subsp. anaerobius + S.
aureus
86
Fig. 23: Congestion in the intestine of lamb vaccinated with Morel’s
disease vaccine and challenged by S. aureus subsp. anaerobius + S.
aureus
Fig. 24: Congestion in the brain of lamb vaccinated with Morel’s disease
vaccine and challenged by S. aureus subsp. anaerobius + S. aureus
87
Fig. 25: Froth in the trachea of lamb vaccinated with Morel’s disease
vaccine and challenged by S. aureus subsp. anaerobius + S. aureus
88
3.8 Immunological tests
3.8.1 Effect of vaccination with Morel’s disease vaccine on the plaque
forming cell (PFCs) count
Plaques (Fig. 31) formed were counted as measure of the level of
immunity conferred by immunization of sheep with Morel’s disease
vaccine. Significant increase (p<0.05) in the average number of plaques
formed occurred one and two weeks after vaccination and a significantly
higher (p<0.01) number of plaques formed one week after the booster
dose (Fig. 32).
3.8.2 Effect of vaccination with Morel’s disease vaccine on the splenic
lymphocyte count
Splenic lymphocytes count showed slight increase (p>0.05) one
week after vaccination, and it increased significantly (p<0.05) two weeks
after vaccination. Booster dose of the vaccine resulted in very high
increase of lymphocyte count (Fig. 3). Plaques formed were positively
correlated with the lymphocytes count.
3.8.3 Validity of splenic cells
The purpose of this experiment was to determine for how long the
splenic cells can remain viable before conducting the PFC assay. The
splenic cells were stored normally and in two different solutions: RPMI
and Histopaque at 4°C. Results are shown in Figs 35-38. While splenic
cells taken from animals one week after vaccination could not remain
viable more than one day, they remained viable more than 19 days when
taken from animals 4 weeks after vaccination. Viability of cells was
better without storage solution one week after vaccination, but it was best
when stored in RPMI two weeks after vaccination. While viability was
almost equal in RPMI and histopaque three weeks, it increased in
Histopaque four weeks after vaccination.
89
Fig. 26: Photomicrograph of typical Plaque Forming Cell. Note the single
mononuclear (plasma) cell in the centre of the plaque: the erythrocytes
were lysed producing holes (clear areas), 40x.
Fig. 27: Average count of plaques formed of groups of sheep vaccinated
with Morel’s disease vaccine
b a
c
d
* Values with different letters are significantly different
(p>0.05)
90
Fig. 28: Average blood lymphocytes count of groups of sheep
vaccinated with Morel’s disease vaccine
Fig. 29: Plaque forming cell assay (PFCA) and lymphocytes count,
comparison between all groups
a a
b
c
* Values with different letters are significantly different
(p>0.05)
91
Fig. 30 Viability of splenic cells when stored normally, in RPMI or
in Histopaque at 4 °C one week after vaccination
Fig. 31: Viability of splenic cells when stored normally, in RPMI
or in Histopaque at 4 °C two weeks after vaccination
92
Fig. 32: Viability of splenic cells when stored normally, in RPMI
or in Histopaque at 4 °C three weeks after vaccination
Fig. 33: Viability of splenic cells when stored normally, in RPMI
or in Histopaque at 4 °C four weeks after vaccination
93
3.8.3. Opsonophagocytosis
This experiment was conducted to evaluate the ability of
hyperimmune serum against S. aureus subsp. anaerobius to prevent
abscess formation and to opsonize bacteria to help phagocytosis by
PMNs. Subsutaneously inoculated bacteria two hours after opsonization
produced the smallest abscess size compared with that produced by
imoculation immediately after opsonization and by the control (original
culture) as seen in Table 16.
Phagocytosis of opsonized bacteria by PMNs was assessed by the
bacterial count. Bacterial count of that opsonized by serum taken two
weeks after vaccination was lower compared with that opsonized with
serum taken one week after vaccination (Tables 17 and 18). The viable
count of both S. aureus and S. aureus subsp. anaerobius decreased after
opsonization, the last count was obtained when opsonized for 2 h.
Table 16: Abscess size produced by inoculation of opsonized culture of
S. aureus subsp. anaerobius
Bacterial inoculum Abscess size (cm)
Original culture (control) 3.92x3.75
Opsonized for 0 min 2.40x2.50
Opsonized for 2 hours 1.54x1.63
94
Table 17: Average number of bacteria (per ml) after phagocytosis one
weeks after vaccination
Opsonization time
(min) S. aureus subsp. anaerobius S. aureus
Control Uncountable Uncountable
0 Uncountable Uncountable
30 Uncountable Uncountable
60 4.02 x104 6.08 x10
4
120 9.85 x103 3.34 x10
4
Table 18: Average number of bacteria (per ml) after phagocytosis two
weeks after vaccination
Opsonization time
(min) S. aureus subsp. anaerobius S. aureus
Control Uncountable Uncountable
0 Uncountable Uncountable
30 2.35x103 1.1 x10
3
60 1.8 x103 8.5 x10
2
120 9.5 x102 3.5 x10
2
95
CHAPTER FOUR
DISCUSSION
In the survey conducted in this study, Staphylococcus spp. were
isolated in pure cultures from 68.8% of lymph nodes abscesses of sheep
at meat inspection, Corynebacterium spp. from 26.5% and mixture of
both organisms were isolated from the rest (4.7%) samples. These results
suggest that staphylococci are the most prevalnt organisms that can be
isolated from lymph node abscesses at meat inspection. These results are
in general agreement with those obtained by Noura Karamalla (1997) and
Sara Bihary (2002). Noura Karamalla (1997) isolated Staphylococcus
spp. from 96% of the samples of lymph node abscesses of sheep at meat
inspection in Alkadaro abattoir, while the rest 4% yielded mixed cultures.
Sara Bihary (2002) isolated 48.7% Staphylococcus spp., 38.7%
Corynebacterium spp. and 12.6% mixed culture of both Staphylococcus
spp. and Corynebacterium spp. from lymph node abscesses of sheep at
meat inspection in Omdurman abattoir. Among staphylococci isolated in
this study, S. aureus subsp. anaerobius was the most prevalent (63.2%).
This percentage of isolation is higher than those of Noura Karamalla
(1997) and Sara Bihary (2002), 26% and 24%, repectively. Other
staphylococci isolated were S. caseolyticus (21.3%), S. aureus (11.9%)
and S. simians, S. lugdunensis, S. warneri, S. epidermidis (each 0.9%).
Other than S. aureus anaeroboius, only two species viz: S. caseolyticus
and S. aureus were among the isolates of both Noura Karamalla (1997)
and Sara Bihary (2002); S. simians and S. lugdunensis were among the
isolates of Sara Bihary (2002).
In outbreak of abscess disease at Alsamra village, Khartoum State,
with morbidity rate of 30%, S. aureus subsp. anaerobius was isolated
from 28 out of 30 (93.3%) affected sheep, while Corynebacterium spp.
96
was isolated from the rest two (6.7%) animals. These results agree with
the results of previous investigators on abscess disease of sheep in the
Sudan (Hamad et al., 1992) and earlier reports of Morel (1911), Ayuand
(1923) in France in addition to a recent report made by Møller etal.
(2000) in Denmark, who described S. aureus subsp. anaerobius as the
cause of abscess disease of sheep. These results show that Staphylococcus
aureus subsp. anaerobius is the most probable bacterium that can be
isolated from superficial lymph node abscesses of sheep at meat
inspection and the most likely cause of abscess disease of sheep in
pasture.
Nuc gene encodes for the thermonuclease (TNase) enzyme
produced by Staphylococcus aureus strains. This gene (nuc) has species
specific sequence as was indicated by polyclonal and monoclonal
antibodies to detect S. aureus TNase in addition to DNA hybridization
test (Liebl et al., 1987). A primer set for the detection of the gene
encoding this enzyme was designed by Brakstad et al. (1992), which
generates a PCR product of approximately 270 bp. This primer set was
used in this study in a PCR test to confirm biochemical identification of
22 representative local isolates of S. aureus subsp. anaerobius. All tested
isolates were positive for this gene.
On PCR amplification of staphylococcal catalase gene (kat) using
several primers, these local isolates also gave positive results. But, this
confirmed the identification of these isolates to the species level only, not
the subspecies level, i.e., they are S. aureus. Staphylococcus aureus
subsp. anaerobius differs from S. aureus subsp. aureus in that it is
catalase and benzidine negative. So, genes coding for one of these two
proteins should be targeted for differentiation between the two
subspecies. Catalase gene of S. aureus subsp. anaerobius (katB) was
97
found by Sanz et al. (2000) to have sequence differences from the
prototype gene (katA) of S. aureus subsp. aureus. So, to confirm the
identification of the local isolates, the complete catalase gene of one
outbreak strain (S10) isolated in this study was sequenced.
Sequence of the putative catalase gene of S. aureus subsp.
anaerobius strain S10 (SaanS10) showed 99% identity to katB gene of S.
aureus subsp. anaerobius MVF213 (GenBank accession no. AJ000471),
katA gene of S. aureus subsp. aureus strains NCTC 8325 and Newman
(GenBank accession nos.CP000253 and AP00935.1, respectively). In
comparison with katA, 15 bases substitutions occurred within the coding
region of katA, six of which were mis-sense mutations while the others
were silent mutations. An important substitution occurred at position no.
1099 (1036 bases upstream the initiation codon) of katS10 gene. In
katS10 the base is “T”, while in katA and katB it is “C”. This substitution
resulted in the code "TGA" instead of "CGA". This stop codon formula
for termination of translation rendered the predicted protein to be only
345 amino acids in length. In S. aureus subsp. aureus (NCTC 8325 and
Newman strains) the protein of katA is 505 a.a. long. Sanz et al. (2000)
found that in S. aureus subsp. anaerobius strain MVF213, which is
catalase negative, the catalase-like protein of katB is 445 a.a. long. Loss
of the catalase activity of S. aureus subsp. anaerobius is attributed to
deletion of one base 1338 nucleotides upstream the initiation codon,
which resulted in shift in the reading frame and premature termination of
translation 30 bases later (Sanz et al., 2000). In katS10 this deletion did
not occur, a feature of similarity to katA. The third mismatching of katS10
and katB is that the substitution which occurred at base 949 upstream the
initiation codon leading to serine in katB instead of proline in katA (Sanz
et al., 2000), did not happen in katS10. Interestingly, all mutations
98
occurred in katA gene leading to the generation of katB, except the above
mentioned ones, also occurred in katS10. This suggests that katA
underwent mutations in at least two steps leading to the generation of
katB and katS10.
To see if these mutations of katS10 are unique features of the local
strain (S10) or common to all local isolates of S. aureus subsp.
anaerobius, partial sequence (about 990 bp) of the catalase gene of other
eight local isolates in addition to one reference strain was performed. The
segment of the gene chosen for this partial sequence targeted a region that
contained most of the mutations seen in katS10 including position 1099
of the gene. The sequence of the catalase gene of all of the Sudanese
isolates was 100% identical to that of katS10 gene, while that of the
reference strain was 100% identical to katB sequence. These results
suggest that the mutations of katS10 may be widely present in Sudanese
strains of S. aureus subsp. anaerobius, and that the strains tested could
have a common origin. To confirm this assumption, further molecular
characterization of the local isolates was performed. Twenty two local
isolates in addition to two reference strains were analysed by RAPD-PCR
and PCR amplification of two genetic markers: spa (staphylococcal
protein A) and coa (colagulase) genes. With primers used for RAPD-PCR
and spa gene all local strains in addition to one of the refrence strains was
identical in the amplification pattern. But, with primers for the coa gene
all local isolates gave similar amplification patterns, which were distinct
from at least one of the reference strains. Furthermore, DNA restriction
patterns in pulsed field gel electrophoresis (PFGE) of 6 local isolates and
one reference strain yielded the same results. These results in conjunction
with the catalase gene sequence results suggest that all Sudanese S.
aureus subsp. anaerobius isolates originated from one clone. These
99
results are in agreement with the results obtained by El Haj and El
Sanousi (2005) who reported that the local strains had similar PFGE
restriction patterns and they were genetically identical.
Subcutaneous injection of non vaccinated sheep with a dose of
1.2x103
cfu of S. aureus subsp. anaerobius formed abscesses reached up
to 6.4x4.5 cm in size; the size measured by Hassan (1996) reached up to
6.5x6.0 cm while Sara Bihary (2002) found that the size of the formed
abscesses reached 9.9x9.4 cm. This variation can be due to the
differences in the inoculums sizes. However, the sizes obtained in these
experimental infections was smaller from some natural cases: Møller
(2000) found that it reached 15 cm in diameter, Aynaud (1927) described
the size of the abscess as a size of two-hand fist, Alhendi et al. (1993)
described it as a size of a football.
Ability to form abscesses by other staphylococci isolated in this
study was also tested. Sheep inoculated with S. aureus formed pus
discharging abscessses at the inoculation sites, haemorrhage in the left
and right precrural lymph nodes. In the experiment of Sara Bihary (2002),
inoculation of S. aureus resulted in small size subcuaneous abscess and
haemorrhagic precrural lymph node. Animals inoculated with the other
species (S. caseolyticus, S. lugdunensis and S. simians) showed no
abscesses formation at the sites of inoculation. Sara Bihary (2002)
described different sizes of abscesses formed at the sites of inoculation
when she used these species for experimental infection. S. caseolyticus
produced caseated abscess at the prescapular lymph node. Sara Bihary
(2002) described abscess formation in the prescapular lymph node.
Haemorrhage, enlargement of the submandibular, parotid and mesenteric
lymph nodes were seen in the sheep inoculated with S. simians. Sara
Bihary (2000) found only haemorrhagic prescapular lymph node in
100
animals inoculated with S. simians. Animals inoculated with S.
lugdunensis showed enlargement and cording of the mesenteric lymph
nodes. Sara Bihary (2002) found haemorrhagic prescapular lymph node
and abscesses in the liver. Sheep inoculated with S. epidermidis showed
enlargement of the prescapular and parotid lymph nodes. However,
infiltration with micro abscesses was seen in the livers of animals
inoculated with S. caseolyticus and S. simians. Failure of staphylococci
(other than S. aureus and S. aureus subsp. anaerobius) to produce
subcuataneous abscesses in sheep in this study suggests that they can not
cause clinical abscess disease, but only inflammation of lymph nodes or
micro abcesses in some internal organs that can be detected at meat
inspection. Thes results contradict the results of Sara Bihary (2002), who
showed abscesses formation in sheep inoculated with 10 different
Staphylococcus spp. (other than S. aureus and S. aureus anaerobius)
including three species isolated in this study. This may be due to the
difference of inoculum sizes used in the two experiments: while the
inoculum size used in this study was 1200 cfu (three times the minimum
in vitro abscess causing dose of S. aureus anaerobius), Sara Bihary used
inoculum size equal to Brown’s opacity tube no. 4 (equivalent to about
109 cfu), which means one million times the minimum abscess causing
dose.
Experimental inoculations of S. aureus anaerobius plus one of the
other staphylocci isolated in this study was conducted on the assumption
that there is synergistic action between S. aureus anaerobius and these
staphylococci. This assumption was made because some of these
staphylococci were isolated form abscess in mixtures with S. aureus
anaerobius. Except in the cases of S. aureus and S. caseolyticus, none of
the other staphylococci could be recovered from the abscesses developed
101
(at the inoculation sites and prescapular prescapular lymph nodes).
Results of this experiment can augment this assumption of synergism to
cause clinical abscess disease only to some extent and for only these two
organisms. S. aureus was able to cause clinical abscess disease, and S.
caseolyticus formed only lymph node abscess when inoculated alone.
In the present investigation, the effective dose of Morel’s disease
vaccine was evaluated. A dose of 0.5 ml of the vaccine boostered with
0.25 ml after fifteen days gave protection against challenge with three
times the minmum abscess causing dose, as indicated by prevention of
development of any lesion. Also, 1 ml of the vaccine gave protection, but
prescapular lymph node was enlarged. With doses of 0.25, 0.50 and 0.75,
prevention of abscess formation could occur, but inflammation of many
lymph nodes had also occured. Rodwan (1996) reported that the effective
dose of the vaccine was 1 ml boostered with 0.5 ml after fifteen days.
These results proved the possibility of minimizing the dose to the half and
giving the same protection. The positive economic impact on production
of the vaccine of these results is that the same production size can be used
for the double number of animals without additional costs.
When vaccinated sheep were challenged with a mixture of both S.
aureus anaerobius and S. aureus, signs indicative of hyper immune
reaction were seen (generalized oedema of both challenged animals and
death of one animal). The protein content of Morel’s disease vaccine is
high (Hassan, 2000) and it is expected that it provokes both humoral and
cell mediated immunity against a large number proteomes comprising its
protein in vaccinated animals. Since S. aureus anaerobius and S. aureus
belong to one species, it is expected that lots of antigens are shared
against which immune response is elicited in animlas vaccinated with
Morel’s disease vaccine. The delayed type of hypersensitivity reaction
102
occurred in challenged lambs is thus can be attributed to the very big
number of organisms used in the challenge (2,400,000 cfu), and of course
the high protein concentration thereof. This reaction can not be expected
to happen in nature in vaccinated animals because naturally occurring
infections are caused by a very small number of organisms.
The plaque-forming cell (PCF) assay is an in vitro enumeration of
antibody (mainly IgM) secreting cells. Hassan (2000) used this assay to
compare between immune responses against S. aureus anaerobius in
sheep vaccinated with Morel’s disease vaccine and non vaccinated sheep.
He found that the percetage of PFCs ranged from 75-81.59% and 0.42-
2.0% for the vaccinated and non-vaccinated lambs, respectively. Hassan
(2000) found this assay to be the best choice to study immunity against S.
aureus anaerobius. So, the PFC assay was used in this study to monitor
immunity against S. aureus anaerobius in sheep vaccinated with Morel’s
disease vaccine. Results of this study in PFC assay were in agreement
with the findings of Hassan (2000). Furthermore, although significant
increase in the number of plaques formed by spelnic cells of all groups of
vaccinated sheep was seen, the number of plaques was the highest in the
group given a booster dose. This result accords with the challenge
experiment results, in which animals given a booster dose of the vaccine
were more protected. Splenic lymphocytes also increased significantly
two weeks after vaccination and the highest increase was seen one week
after the booster dose. The positive correlation between the splenic
lymphocyte and plaque forming cells counts indicates proliferation of
cells secreting antibodies against S. aureus anaerobius, which conferred
immunity against Morel’s disease.
In practical, PFC has many limitations, one of which is the time
elapse before conducting the assay after taking the spleens from animals.
103
To see if this assay can be conducted in another day of taking the spleens
from animals, viablitiy of spleenic cells was tested when stored in two
different solutions; RPMI and Histopaque at 4 °C and compared with the
original buffer. Although there were differences in the ability of the
solutions to keep the spelnic cells alive, and there were also differences in
vibilty of splenic cells taken at different times after vaccination, but it can
generally be concluded that it is better not to use storage solution for the
splenic cells and to conduct the assay in the same day of taking spleens
when dealing with animals one week after vaccination; to use RPMI as
storage solution when dealing with animals two or three weeks after
vaccination; to use Histo as storage solution when dealing with animals
three or four weeks after vaccination, and to conduct the assay in the
second day in when using either RPMI and Histopaqe.
Another measure of immunity against S. aureus anaerobius in
sheep vaccinated with Morel’s disease vaccine used in this study was the
opsonizating ability of the hyperimmune sera to promote phagocytosis
and/or killing by the complement. This was assessed by two indicatiors:
viable count of bacteria after opsonization and ability of opsonized
bacteria to cause abscess formation in experimental infection. The
abscess size caused by inoculation of opsonized bacteria was smaller than
that caused by the non-opsonized. Also, the bacterial count decreased
sharply after opsonization, which positvely correlated with the time of
opsoniztion. Furthermore, immune serum taken two weeks after
vaccination gave better opsonization than serum taken one week after
vaccination. These results are in agreement with Hassan (2000) who
found significant increase in opsonizating antibodies in sera of vaccinated
lambs.
However, both PFC assay and opsonophagocytosis experiments
104
were indicative of increased antibodies against different antigenic
components of Morel’s disease vaccine in sera of vaccinated animals.
While this is so, a better method for detection of immunity of
vaccinated sheep against virulant staphylococci warrants future
investigation.
Conclusions and recommendations
S. aureus subsp. anaerobius is the major cause of clinical abscess
disease of sheep.
Other staphylococci can cause superficial lymph node abscesses
that can be detected at meat inspection (subclinical abscess
disease), but they are likley not able to cause the classical clinical
subcutaneous abscess syndrome of Morel’s disease.
All Sudanese strains of S. aureus subsp. anaerobius seem to have
originated from one clone and thus any one of the local stains can
be used for vaccine production.
The minimum protecting dose of Morel’s disease vaccine is 0.5 ml
boostered with 0.25 ml after fifteen days. Also, a single dose of 1
ml of the vaccine is effective.
Vaccination of sheep with Morel’s disease vaccine increases the
concentration of antibodies raised against both S. aureus
anaerobius and S. aureus.
Although the plaque forming cell assay served as a good
immunological test to monitor immunity conferred by vaccination
with Morel’s disease vaccine by enumerating antibody secreting
cells against S. aureus subsp. anaerobius, it can not be performed
effectively in live animals.
105
Findig reliable immunological test(s) for the assessment of
immunity level of live animals remains a challenge of future
studies.
106
REFERENCES
Adlam, C., Ward, P. D., McCartney, A. C., Arbuthnott, J. P. and Thorley,
C. M. (1977). Effect of immunization with highly purified alpha-
and beta-toxins on Staphylococcal mastitis in rabbits. Infect. Immun.
17: 250-256.
Afnan, M. and Hedjazi, M. (1978). Studies on Micrococcus strains
isolated from an outbreak of Morel's micrococcosis in sheep. Refuah
Vet. 35: 1-3.
Ahmed, A., Clarke, S., Buchan, A. and Skinner, G.R.B. (1990).
Sequential release of antigens from chloroform-treated
Staphylococcus epidermidis towards a possible vaccine. J. Appl.
Bacteriol. 69: 676-685.
Aklilu, Y. (2002). An Audit of the Livestock Marketing Status in Kenya,
Ethiopia and Sudan, (Vol. I). Community-Based Animal Health and
Participatory Epidemiology Unit. Pan African Programme for the
Control of Epizootics Organization of African Unity/Interafrican
Bureau for Animal Resources. Nairobi, Kenya.
Alhendi, A.B., S.M. El Sanousi, Y.A. Al-Ghasnawi and M. Madawi
(1993). An outbreak of abscess disease in goats in Saudi Arabia. J.
Vet. Med. (A) 40: 646-651.
Anderson, J. C. (1978). The problem of immunization against
staphylococcal mastitis. Br. Vet. J. 134: 412-420.
Ayanud, M. (1928). La botryomycose due mouton (abces du mouton,
maladie caseeuse). Annales del’ Institut Pasteur. 42: 256-281.
Aydin, N. and Canbazoglu, M. (1987). Sigirlarin stafilokok mastitislerine
karsi asi hazirlanmasi uzerinde calismalar. Etlik Vet. Microb. Derg.
6: 69-88.Aynaud, M. (1922). La botryomycose du mounton.
107
Comptes rendus de I’Academie des Sciences, 175: 1170-1172.
Aynaud, M. (1922). La botryomycose du mounton. Comptes rendus de
I’Academie des Sciences, 175: 1170-1172.
Aynaud, M. (1923). La botryomycose (suppuration caseeuse) du mouton
et de la chevre. Comptes rendus de seances de La Societe de
Biologie, 89: 215-217.
Aynaud, M. (1927). La botryomycose des ovins (suppuration caseeuse,
maladie de abces). Revue Genera le de Medecine Veterinarie, 36:
500-506.
Aynaud, M. (1927). La botryomycose des ovins (suppuration caseeuse,
maladie de abces). Revue Genera le de Medecine Veterinarie. 36:
500-506.
Bajmocy, E, Fazekas, B. and Tanyi, J. (1984). An outbreak of Morel’s
disease (a contagious sheep disease accompanied by abscess
formation) in Hungary. Act. Vet. Hung. 32: 9-13.
Bajmocy, E, Fazekas, B., Tanyi, J. (1983). Occurrence of Morel’s disease
with abscess formation in sheep Hungary. Magyar Allatorvosok
lapjia. 38: 515-519.
Barker, K.F., J.C. O'Driscoll and A. Bhargava. (1991). Staphylococcus
lugdunensis. J. Clin. Pathol. 44: 873-874.
Baron, E.J., Peterson, L.R. and Finegold, S.M. (1994). Bailey and Scott’s
diagnostic microbiology. 9th
ed. Mosby, London, UK.
Barrow, G.L., and Feltham, R.K.A. (Editors). (1993). Cowan and Steel's
manual for the identification of medical bacteria. 3rd
ed., Cambridge
University Press, Cambridge, U.K.
108
Benito, M. and Borrel, A.J. (1957). Nouvelle etude sur I`agent causal de
la maladie des abces due mouton et dela chevre.Rev. Med. Vet. 198:
101-118.
Bialkowska-Hobrzanska, H., Jaskot, D. and Hammerberg, O. (1990).
Evaluation of restriction endonuclease fingerprinting of
chromosomal DNA and plasmid profile analysis for characterization
of multiresistant coagulase-negative staphylococci in bacteremic
neonates. J. Clin Microbiol. 28: 269-275.
Blanco-Loizelier, A. (1985): Contribucion al estudio de la Linfoadenitis
caseosa de los corderos (enfermedad de los abscesos). Rev. Biol.
Anim. 6: 73-87.
Bowman R.A. and Buck M. (1984). Staphylococcus hominis septicaemia
in patients with cancer. Med. J. Aust. 140: 26-27.
Bradfield, J. F., Wagner, J. E., Boivin, G.P., Steffen, E.K. and Russell,
R.J. (1993). Epizootic fatal dermatitis in athymic nude mice due to
Staphylococcus xylosus. Lab Anim Sci. 43: 111-113.
Brakstad, O. G. and Maeland, J. A. (1989). Generation and
characterization of monoclonal antibodies against Staphylococcus
aureus. Acta Pathol. Microbiol. Immunol. Scand. 97:166-174.
Brakstad, O. G., Aasbakk, K. and Maeland, J.A. (1992). Detection of
Staphylococcus aureus by polymerase chain reaction amplification
of the nuc gene. J. Clin. Microbiol. 30:1654-1660.
Bridre, J. (1907). La mammite gangreneuse des drebis laitieres:
Pathogenie et vaccination. Bull Soc. Cent. Med. Vet. 61: 500.
Brown, R. W., Sandvik, O., Scherer, R. K. and Rose, D. L. (1967).
Differentiation of strains of Staphylococcus epidermidis isolated
from bovine udders. J. Gen. Microbiol. 47:273-287.
Carré, H. (1923a). Sur la suppuration caseeuse du mouton. Bulletin de la
109
Societe Central de Medecine Veterinaire. 76: 402- 407.
Carré, H. (1923b). Le coccus pyogene du moton. Comptes Rendus des
Seances de la Societe de Biologie. 88: 427- 428.
Carré, H. (1927). La suppuration et les microbes pyogenes des petits
ruminants. Revue Generale de Medecine Veterinaire, 36: 241-258.
Carrillo, E.R., Morales, M.D.A.T and Ruiz, S.S. (2000). Staphylococcus
xylosus: Una bacteria emergente. Revista Medica Del Hospital
General De Mexico, S. S. 63: 107-111.
Chamberlain, N.R. (1999). Identification and partial characterisation of
an extracellular activator of fatty-acid modifying enzyme (FAME)
expression in Staphylococcus epidermidis. J. Med. Micro. 48: 245-
252.
Christensen G.C. (1993). The 'sticky' problem of Staphylococcus
epedermidis sepsis. Hosp. Pract. 28: 27-36, 38.
Clements, M.O. and Foster, S.J. (1999). Stress resistance in
Staphylococcus aureus. Trend. Microbiol. 7: 458–462
Cohn, Z.A. (1970). Lysozymes in mononuclear phagocytes. In: Van
Furth, R. (Ed.). Mononuclear phagocytes. Blackwell, Oxford. U.K.
P. 50.
Colburn, K.K., Wong, L.G., Ashman, R. F., Wistar, R. J. and Weisbart R.
H. (1980). Effect of immunoglobulin G on the responsiveness of
human neutrophils to soluble staphylococcal protein A-induced
neutrophil migration inhibition factor from T-lymphocytes. Infect.
Immun. 30: 674-677.
Cormican, M.G., el Bouri, K., Corbett-Feeney, G., Flynn, J. and Daly, K.
(1992). Staphylococcus lugdunensis endocarditis [Letter]. J. Infect.
24:335-336.
Cuny, C., Claus, H. and W. Witte (1996). Discrimination of
110
Staphylococcus aureus by PCR for r-RNA gene spacer size
polymorphism and comparison to SmaI macrorestriction patterns.
Zentralbl. Bakteriol. 283:466–476.
De Buyser, M.L., Morvan, A., Aubert, S., Dilasser, F. and el Solh, N.
(1992). Evaluation of a ribosomal RNA gene probe for the
identification of species and subspecies within the genus
Staphylococcus. J. Gen. Microbiol. 138: 889–899.
De la Fuente, R., and Suarez, G. (1985). Respiratory deficient
Staphylococcus aureus as the aetiological agent of Abscess Disease.
J. Vet. Med. B. 32: 397-406.
De la Fuente, R., Suarez, G., and Schleifer, K.H. (1985). Staphylococcus
aureus subsp. anaerobius nov., the causal agent of abscess disease
of sheep. Int. J. Sys. Bact. 35: 99-102.
De lencastre, H., De lencastre, A. and Tamasz, A. (1996). Methicillin-
resistant Staphylococcus aureus isolates recovered from a New York
city hospital: analysis by molecular fingerprinting techniques. J.
Clin. Microbiol. 34: 2121-2124.
Derbyshire, J.B. (1960). Studies in immunity in immunity to
experimental staphylococcal mastitis in the goat and cow. J. Comp.
Path. Ther. 70: 222-231.
Derbyshire, J.B. (1961). The immunization of goats against
staphylococcal mastitis by means of experimental infections of the
skin and udder. Res. Vet. Sci. 2: 12-16.
Derbyshire, J.B. (1962). Immunity in bovine mastitis. Vet. Bull. 32: 1-10.
Devriese, L. A. (1977). Isolation and identification of Staphylococcus
hyicus. Am. J. Vet. Res. 38: 787-792.
Devriese, L.A., Vancanneyt, M., Baele, M., Vaneechoutte, M., De Graef,
E., Snauwaert, C., Cleenwerck, I., Dawyndt, P., Swings, J.,
111
Decostere, A. and Haesebrouck, F. (2005). Staphylococcus
pseudintermedius sp. nov., a coagulase-positive species from
animals. Int. J. Syst. Evol. Microbiol. 55: 1569-1573.
Drancourt, M., and D. Raoult (2002). rpoB gene sequence-based
identification of Staphylococcus species. J. Clin. Microbiol.
40:1333-1338.
El Haj, M.O. (2002). Improvement of Morel’s disease vaccine and
application of the bioreactor for production. Ph.D. Thesis.
University of Khartoum, Sudan.
El Haj, M.O., and El Sanousi, S.M. (2005). Pulsed-field gel
electrophoresis for comparison of Staphylococcus aureus subsp.
anaerobius local Sudanese isolates. J. Anim. Vet. Adv. 4: 706–707.
El Sanousi, S.M., Faculty of veterinary Medicine, University of
Khartoum Sudan (personal communication).
El Sanousi, S.M., Hamad, A.A. and Gameel, A.A. (1989). (Abscess
Disease in goats in the Sudan) La maladie caseeuse chez des chevres
au Soudan. Revue Elev. Med. Vet. Pays Trop. 42: 379-382.
Engler, H.D. and Karbal, F.A. (1992). The production of a baterial
monoglyceride in Staphylococcus abscesses. J. Med. Microbial. 37:
232-234.
Etienne, J., Brun, Y. and Fleurette, J. (1989). Staphylococcus lugdunensis
endocarditis. J. Clin. Pathol. 42: 892-893.
Fattom, A., Schneerson, R., Szu, S.C., Vann, W.F., Shiloach, S.,
Karakawa, W.W. and Robbins, J.B. (1990). Synthesis and
immunologic properties in mice of vaccines composed of
Staphylococcus aureus type 5 and type 8 capsular polysaccharides
conjugated to Pseudomonas aeruginosa exotoxin A. Infec. Immun.
58: 2367-2369.
112
Fita, I. and Rossmann, M.G. (1985a). Tha NADPH binding site on beef
liver catalase. Proc Natl Acad Sci USA 82: 1604-1608.
Fita, I. and Rossmann, M.G. (1985b). The active center of catalase. J.
Mol. Biol. 185: 21-37.
Forman, G., Switalski, L.M., Speziale, P. and Hook, M. (1987). Isolation
and characterization of fibronectin receptor from Staphylococcus
aureus. J. Biol. Chem. 262: 6564-6568.
Forsgren, A. Ghetie, V. Lindmark, R. and Sjoquist, J. (1983). Protein A
and its exploitation. In: Easmon, C. S. F. and Adlam, C.: (Eds.).
Staphylococci and Staphylococcal Infections, Vol. 2. Academic
Press, London, U.K., p. 429.
Foster T.J. (1991). Potential for vaccination against infections caused by
Staphylococcus aureus. Vaccine. 9: 221-227.
Frénay H.M., Theelen J.P., Schouls L.M., Vandenbroucke-Grauls C.M.,
Verhoef J., van Leeuwen W.J. and Mooi F.R. (1994).
Discrimination of epidemic and nonepidemic methicillin-resistant
Staphylococcus aureus strains on the basis of protein A gene
polymorphism. J. Clin. Microbiol. 32: 846-847.
Freney, J., Brun, Y., Bes, M., Meugnier, H., Grimont, F., Grimont, P.,
Nervi, C. and Fleurette, J. (1988). Staphylococcus lugdunensis sp.
nov. and Staphylococcus schleiferi sp. nov., two species from human
clinical specimens. Int. J. Syst. Bacteriol. 38:168–172.
Freney, J., Kloos, W.E., Hajek, V., Webster, J.A., Bes, M., Brun, Y. and
Vernozy-Rozand, C. (1999). Recommended minimal standards for
description of new staphylococcal species. Subcommittee on the
taxonomy of staphylococci and streptococci of the International
Committee on Systematic Bacteriology. Int. J. Syst. Bacteriol. 49:
489–502.
113
Garcia, M.C., Rodriguez, M.J., Bernardo, A., Tornadijo, M.E. and
Carballo, J. (2002). Study of enterococci and micrococci isolated
throughout manufacture and ripening of San Simon cheese. Food
Microbiol. 19: 23-33.
Gemmell, C.G. and O'Dowd, A. (1983). Regulation of protein A
biosynthesis in Staphylococcus aureus by certain antibiotics: its
effect on phagocytosis by leukocytes. J. Antimicrob. Chemother. 12:
587-597.
Goh, S.H., Byrne, E.E., Zhang, J.L. and Chow, A.W. (1992). Molecular
typing of Staphylococcus aureus on the basis of coagulase gene
polymorphisms. J Clin Microbiol. 30: 1642–1645.
Goh, S.H., Potter, S., Wood, J.O., Hemmingsen, S.M., Reynolds, R.P.
and Chow, A. W. (1996). HSP60 gene sequences as universal targets
for microbial species identification: studies with coagulase-negative
staphylococci. J. Clin. Microbiol. 34: 818–823.
Greenberg, D.P., Bayer, A.S., Cheung, A.L. and Ward, J.I. (1989).
Protective efficacy of protein A-specific antibody against bacteremic
infection due to Staphylococcus aureus in an infant rat model. Infect.
Immun. 57: 1113-1118.
Grüner, B.M, Han, S.R., Meyer, H.G., Wulf, U., Bhakdi, S. and Siegel,
E.K. (2007). Characterization of a catalase-negative methicillin-
resistant Staphylococcus aureus strain. J. Clin. Microbiol. 45: 2684–
2685.
Grzegorczyk, A., Juda, M., and Malm, A. (2006). Polymorphism of coa
gene in Staphylococcus aureus. Annales Universitatis Mariae Curie -
Sklodowska Lublin – Polonia . 21, N 1, 51 SECTIO DDD: 239-242.
Gurtler, V., and Barrie, H.D. (1995). Typing of Staphylococcus aureus
strains by PCR-amplification of variable-length 16S-23S rDNA
114
spacer regions: characterization of spacer sequences. Microbiology
141:1255–1265.
Haas, A. and Brehm, K. (1993). Superoxide dismutases and catalases:
biochemistry, molecular biology and some biomedical aspects.
Genet. Eng. Biotechnol. 13: 243-269.
Hamad, A.R.A.R. (1989). The aetiology of Abscess Disease of Sheep in
the Sudan. M. V. Sc. Thesis. University of Khartoum, Sudan.
Hamad, A.R.A.R., Shigiddi, M.T., and El Sanousi, S.M. (1992). Abscess
disease of sheep in the Sudan. Sud. J. Vet. Sc. Anim. Husb. 31: 60–
61.
Hassan, A.B. (1996). Studies on the aetiology of Morel's disease and its
relationship to fattening. M.V.Sc. Thesis. University of Khartoum,
Sudan.
Hassan, A.B. (2001). Effect of vaccination against Morel’s disease on
non-pregnant and pregnant ewes and their offsprings. Ph.D. Thesis.
University of Khartoum, Sudan.
Hauschild, T. and Schwarz, S. (2003). Differentiation of Staphylococcus
sciuri strains isolated from free-living rodents and insectivores. J.
Vet. Med. (B) 50:241-246.
Herchline, T.E. and Ayers, L.W. (1991). Occurrence of Staphylococcus
lugdunensis in consecutive clinical culture and relationship of
infection. J. Clin. Microbiol.29: 419-421.
Hind M. Ali (1997). Prevalence of Staphylococcus species in man in
health and disease. M.V.Sc. Thesis. University of Khartoum.Sudan.
Hookey, J. V., Richardson, J. F., and Cookson, B. D. (1998). Molecular
typing of Staphylococcus aureus based on PCR Restriction
Fragment Length Polymorphism and DNA sequence analysis of the
coagulase gene. J. Clin. Microiol. 36: 1083-1089.
115
Howard, C.J., Taylor, G. and Brownlie, J. (1980). Surface receptors for
immunoglobulin on bovine polymorphonuclear neutrophils and
macrophages. Res. Vet. Sci. 29:128–130.
Jansen, B., Schumacher-Perdreau, F., Peters, G., Reinhold, G. and
Schonemann, J. (1992). Native valve endocarditis caused by
Staphylococcus simulans [Letter]. Eur. J. Clin. Microbiol. Infect.
Dis. 11: 268–269.
Jerne, N. K., Nordin, A. A. (1963). Plaque technique formatuion by
single antibody-producing cells. Science 140:405.
Jones, L.D. (1956): Exudative epidermitis of pigs. Am. J. Vet. Res. 17:
179-193.
Jonsson, P. and Wadstrom, T. (1993). Staphylococcus in pathogenesis of
bacterial infections in animals. In: Gyles, C.L. and Thoen, C.O.
(Eds.). 2nd
ed. Iowa State University Press. Ames, USA. Pp. 21-34.
Joubert, L. (1958). Etude bacteriologique et systematique et systématique
Micrococcus abscedens ovis (Morel, 1911) nv. Ann. Inst. Pasteur.
94: 215- 218.
Jubb, D.V.F., Kennedy, P.C. y. and Palmer, N. (1993): Pathology of
domestic animals. 4th
Edición. 3 volúmenes. Academic Press Inc.
San Diego (Estados Unidos).
Kanafani, H. and Martin, S.E. (1985). Catalase and superoxide dismutase
activities in virulent and nonvirulent Staphylococcus aureus isolates.
J. Clin. Microbiol. 21: 607-610.
Kanai, K. and Kondo, E. (1978). Antibacerial and cytotoxic aspects of
long chain fatty acids as cell surface events: selected topics (a
review). Jpn. J. Med. Sci. Biol. 32:135-174.
Kanda, K., Suzuki, E., Hiramatsu, K., Oguri, T., Miura, H., Ezaki, T. and
Yokota, T. (1991). Identification of a methicillin-resistant strain of
116
Staphylococcus caprae from a human clinical specimen.
Antimicrob. Agents Chemother. 35:174-176
Karbal, F.A., Smith, S. and Lal, D. (1992). The esterification of fatty
acids by Staphylococcus aureus fatty acid modifying enzyme
(FAME) and its inhibition by glycerides. J. Med. Microbiol. 36:235-
237.
Kenneth Todar University. (2008). Todar's Online Textbook of
Bacteriology. Kenneth Todar University of Wisconsin-Madison,
Department of Bacteriology. (http://www.textbookofbacteriology.
net/staph.html), accession date: 20.10.2008.
Kilpper-Balz, R., and Schleifer K.H. (1981). Transfer of Peptococcus
saccharolyticus Foubert and Douglas to the genus Staphylococcus:
Staphylococcus saccharolyticus (Foubert and Douglas) comb. nov.
Zentralbl. Bakteriol. Parasitenkd. Infektionskr. Hyg. Abt. 1 Reihe
Orig. C 2:324-331.
Klesser, R.B., Kimbrough, R.C. and Jones S.R. (1998). Infective
endocarditis caused by Staphylococcus hominis after vasectomy.
Clinc.Infec.Dis. 27: 216-217.
Kloos, W.E. (1990). Systemics and natural history of staphylococci-I. J.
Appl. Bacteriol. Symp. Suppl. 25S-37S.
Kloos, W.E. and Musselwhite, M.S. (1975). Distribution and persistence
of Staphylococcus and Micrococcus species and other aerobic
bacteria on human skin. Appl. Microbiol. 30: 381-395.
Kloos, W.E. and Wolfsohl, J.F. (1983). Deoxyribonucleotide sequence
divergence between Staphylococcus cohnii subspecies populations
living on primate skin. Current Microbiol. 8: 115-121.
Kloos, W.E., and Schleifer, K.H. (1986). Family I. Micrococcaceae.
Genus IV. Staphylococcus, Rosenbach 1884, 18AL, In: Sneath,
117
P.H.A., Mair, N.S., Sharpe, M.E. and Holt, J.G. (Eds.). Bergey’s
manual of systematic bacteriology. 2. Williams and Wilkins,
Baltimore, Md, USA. Pp. 1013–1035.
Kloos, W.E., Ballard, D.N. , Webster, J.A., Hubner, R.J. , Tomasz, A.,
Couto, I., Sloan, G.L., Dehart, H.P. , Fiedler, F., Schubert, K. , de
Lencastre, H., Sanches, I.S., Heath, H.E., Leblanc, P.A. and
Ljungh, A. (1997). Ribotype delineation and description of
Staphylococcus sciuri subspecies and their potential as reservoirs of
methicillin resistance and staphylolytic enzyme genes. Int. J. Syst.
Bacteriol. 47: 313-323.
Kloos, W.E., Ballard, D.N., George, C.G., Webster, J.A., Hubner, W.
Ludwig, R.J., Schleifer, K.H., Fiedler, F. and Schubert, K. (1998).
Delimiting the genus Staphylococcus through description of
Macrococcus caseolyticus gen. nov., comb. nov. and Macrococcus
equipercicus sp. nov., and Macrococcus bovicus sp. no. and
Macrococcus carouselicus sp. nov. Int. J. Syst. Bacteriol. 3:859-877.
Koenig, M.G. and Melly, M.A. (1965). The importance of surface
antigens in staphylococcal virulence. Ann. N.Y. Acad. Sci. 128:
231-234.
Kovacevic, S., Veal, L.E., Hsiung, H.M. and J.R. Miller (1985). Secretion
of staphylococcal nuclease by Bacillus subtilis. J. Bacteriol. 162:
521-528.
Lachica, R.V.F., Genigeorgis, C. and Hoeprich, P.D. (1971).
Metachromic agar-diffusion methods for detecting staphylococcal
nuclease activity. Appl. Microbiol. 21:585-587.
Lachica, R.V.F., Hoeprich, P.D. and Riemann, H.P. (1972). Tolerance
of staphylococcal thermonuclease to stress. Appl. Microbiol. 23:994-
997.
118
Lebech, A.M., Hindersson, P., Vuust, J. and Hansen, K. (1991).
Comparison of in vitro culture and polymerase chain reaction for
detection of Borrelia burgdorferi in tissue from experimentally
infected animals. J. Clin. Microbiol. 29:731-737.
Lee, J.C., Betley, M.J., Hopkins, C.A., Perez, N.E., and Pier, G.B. (1987).
Virulence studies in mice, of transposon-induced mutants of
Staphylococcus aureus differing in capsule size. J. Infect. Dis. 156:
741-750.
Lee, S.F., Progulske-Fox, A. and Bleiweis, A.S. (1988). Molecular
cloning and expression of a Streptococcus mutans major surface
protein antigen, PI (I/II), in Escherichia coli. Infect. Immun. 56:
2114-2119.
Lemaitre, N., Sougakoff, W., Masmoud, A., Fievet, M.-H., Bismuth, R.
and Jarlier, V. (1998). Characterization of gentamicin susceptible
strains methicillin-resistant Staphylococcus aureus involved in
nosocomial spreed. J. Clin. Microbiol. 36: 81-85.
Liebl, W., R. Rosenstein, F. Gotz, and K.H. Schleifer (1987). Use of a
staphylococcal nuclease gene as DNA probe for Staphylococcus
aureus. FEMS Microbiol. Lett. 44: 179-184.
Lindahl, M., Holmberg, O. and Jonsson, P. (1990). Adhesive properties
of haemagglutinating Staphylococcus aureus isolated from bovine
mastitis. J. Gen. Microbiol. 136: 935-937.
Loewen, P.C. (1992). Regulation of bacterial catalase synthesis. In
Molecular Biology of Free Radical Scavenging Systems, pp. 96-116.
Edited by J. Scandalios. Cold Spring Harbor Laboratory, Cold
Spring Harbor, NY, USA.
Madison, B.M. and Baselski, V.S. (1983). Rapid identification of
Staphylococcus aureus in blood cultures by thermonuclease testing.
119
J. Clin. Microbiol. 18: 722-724.
Maes, N., De Gheldre, Y., DeRyck, R., Vaneechoutte, M., Meugnier, H.,
Etienne, J. and Struelens, M.J. (1997). Rapid and accurate
identification of Staphylococcus species by tRNA intergenic spacer
length polymorphism analysis. J. Clin. Microbiol. 35: 2477-2481.
Males, B.M., Bartholomew W.R. and Amsterdam D. (1985)
Staphylococcus simulans septicemia in a patient with chronic
osteomyelitis and pyarthrosis. J. Clin. Microbiol. 21: 255-257.
Mandell, G.L. (1975). Catalase, superoxide dismutase and virulence of
Staphylococcus aureus. In vivo and in vitro studies with imphasis on
Staphylococcus-leucocyte interaction J. Clin. Investig. 55: 561-566.
Mayberry-Carson, K.J., Tober-Meyer, B., Smith, J.K., Lambe, D.W. and
Costerton, J.W. (1984). Bacterial adherence and glycocalyx
formation in osteomyelitis experimentally induced with
Staphylococcus aureus. Infect. Immun. 43: 825-833.
McCarthy, J.S., Stanley, P.A. and Mayall, B. (1991). A case of
Staphylococcus simulans endocarditis affecting a native heart valve
[Letter]. J. Infect. 22:211-212.
McDevitt, D., Vaudaux, P. and Foster, T.J. (1992). Genetic evidence that
bound coagulase of Staphylococcus aureus is not clumping factor.
Infect. Immun. 60: 1514-1523.
McDowell, G.H. and Waston, D.L. (1974). Immunity to experimental
staphylococcal mastitis: comparison of local and systemic
immunization. Aust. Vet. J. 50: 533-536.
Miles, A. A. and Misra, S. S. (1938). The estimation of the bactericidal
power of blood. J. Hyg. Camb. 38: 732.
Moks, T., Abrahmsen, L., Nilson, B., Hellman, U., Sjoquist, J. and Uhlen,
M. (1986). Staphylococcal protein consists of IgG-bonding domains.
120
Eur. J. Biochem. 156: 637-640.
Møler, K., Agerholm, J.S., Ahrens, P., Jensen, N.E. and Nielsen, T.K.
(2000). Abscess disease, caseous lymphadenitis, and pulmonary
adenomatosis in imported sheep. J. Vet. Med. (B) 47: 55-62.
Moodley, A., Stegger, M., Bagcigil, A.F., Baptiste, K.E., Loeffler, A.,
Loyd, D.H., Williams, N.J., Leonard, N., Abbott, Y., Skov, R. and
Guardabassi, L. (2006). Spa typing of methicillin-resistant
Staphylococcus aureus isolated from domestic animals and
veterinary staff in the UK and Ireland. J. Antimicrob. Chemotherap.
58: 1118-1123.
Morel, M.G. (1911). Contribution a l’ etude de ladenite caseeuse du
mouton, Journal de Medecine Veterinaire et de Zootechnie. 73: 513-
520.
Mortensen, J.E., Sharyock, T.R. and Karbal F.A. (1992). Modification of
bactericidal fatty acids by an enzyme of Staphylococcus aureus. J.
Med. Microbiol. 36: 293-298.
Muraoka, T., Ando, T. and Okuda, H. (1982). Purification and properties
of a novel lipase from Staphylococcus aureus. J. Biochem. 92: 1933-
1939.
Musher D.M., Verbrugh H.A., Verhoef J. (1981). Suppression of
phagocytosis and chemotaxis by cell wall components of
Staphylococcus aureus. J. Immunol. 127: 84-88.
Nickerson, S.C., Owens W.E. and Boddie, R.L. (1991). Progress in the
development of a vaccine to control mastitis. Louisiana Agriculture,
34: 20-25.
Nickerson, S.C., Pankey, J.W., and Watts, J.L. (1985). Enhancement of
the cellular immune response to the bovine udder by local and
systemic immunization against staphylococcal mastitis. Agric.
121
Practice. 6: 34-37.
Noura Karamalla M.S. (1993). Chemotaxis, Phagocytosis and
Immunoblotting of Satphylococcus aureus isolated from sheep.
M.V.Sc. Thesis. University of Kartoum, Sudan.
Noura Karamalla M.S. (1997). Taxonomy, fatty acids pattern and protein
profiles of Staphylococcus species isolated from Abscess in Sheep.
Ph.D. Thesis. University of Kartoum, Sudan.
Nuha I. Elsayed. (2001). Staphylococcus species in normal mastitic milk
of some domestic farm animals. M.V.Sc. Thesis. University of
Khartoum, Sudan.
Obeidat, R.T. (1997). Prevalence of Staphylococcus species in human
cutaneous abscesses and naso-carriers. M.V.Sc. Thesis. University
of Khartoum, Sudan.
Opdebeeck, J.P. and Norcross, N.L. (1983). Frequency of immunologic
cross-reactivity of encapsulated Staphylococcus aureus in bovine
milk in New York. Am. J. Vet. Res. 44: 986-988.
Opdebeeck, J.P., Frost s, A.J., O’Boyle, D. and Norcross, N.L. (1987).
The expression of capsule in serum-soft agar by Staphylococcus
aureus isolated from bovine milk. Vet. Microbiol. 13: 225-232.
Pereira, M.S., Leal, N.C, Leal, T.C.A., Sobreira, M., Siqueira, F.J. and
Takaki, G.C. (2002). Typing of human and bovine Staphylococcus
aureus isolated in the state of Paraíba, Brazil, by RAPD-PCR and
ribotyping. Lett. Appl. Microbiol. 35: 32-36.
Peterson, P.K., Verhoef, J., Sabath, L.D., and Quie, P.G. (1977). Effect of
protein A on staphylococcal opsonization. Infect. Immun. 15: 760-
763.
Poutrel, B. (1984). Udder infection of goats by coagulase-negative
staphylococci. Vet. Microbiol. 9:131-137.
122
Power, E.G.M. (1996). RAPD typing in microbiology: a technical review.
J. Hosp. Infect. 34: 247-265.
Rajab, M. (1997). Some studies on Satphylococcus aureus subsp.
anaerobius. Ph.D. Thesis. University of Khartoum, Sudan.
Rather, P.N., Davis, A.P. and Wilkinson, B.J. (1986). Slime production
by bovine milk Staphylococcus aureus and identification of
coagulase-negative staphylococcal isolates. J. Clin. Microbiol. 23:
858-862.
Rodwan, K. (1996). Vaccination trials against Morel’s disease in sheep.
Ph.D. Thesis. University of Khartoum, Sudan.
Roitt, I.M. and Delves, P.J. (1992). In: Encyclopedia of Immunology,
Academic Press, San Diego, USA. Pp. 1236-1238.
Ruiz Santa Quiteria, J.A., Cid, D., Bellahsene, R., Suarez, G. and De la
Fuente, R. (1992). Polyclonal antibodies against Staphylococcus
aureus ATCC 12600 catalase do not recognize any protein in
cellular extracts from staphylococcus aureus subsp. anaerobius.
FEMS Microbiol. Lett. 72: 173-176.
Rupprecht, M. and Schleifer, K.H. (1979). A comparative
immunological study of catalases from coagulase-positive
staphylococci. Arch. Microbiol. 120: 53-56.
Sabat, A., Krzyszton-Russjan, J., Strzalka, W., Filipek, R., Kosowska, K.,
Hryniewicz, W., Travis, J. and Potempa J. (2003). New method for
typing Staphylococcus aureus strains: multiple-locus variable-
number tandem repeat analysis of polymorphism and genetic
relationships of clinical isolates. J. Clin. Microbiol. 41:1801-1804.
Samia M. Ismail (1997). Staphylococcus species isolated from processed
meat and frozen milk products. M.V.Sc. Thesis. University of
Khartoum, Sudan.
123
Sanz, R., Marin, I., Ruiz-Santa-Quiteria, J.A., Orden, J.A., Cid, D., Diez,
R.M., Silhadi, K.S., Amils, R. and de la Fuente, R. (2000). Catalase
deficiency in Staphylococcus aureus subsp. anaerobius is associated
with natural loss of function mutations within the structural gene.
Microbiology 146: 465–475.
Sara O.E.M.Y. Bihary (2002). Pathogenicity of various species of
Staphylococcus isolated from lymph nodes of sheep suspected for
Morel’s disease. M.V.Sc. Thesis. University of Khartoum, Sudan.
Schleifer, K.H. and Kloos, W.E. (1975). Isolation and characterization of
staphylococci form human skin. Amended description of
Staphylococcus epidermidis and Staphylococcus saprophyticus and
description of three new species: Staphylococcus. cohnii,
Staphylococcus haemolyticus, and Staphylococcus xylosus. Int. J.
Syst. Bacteriol. 25: 50-61.
Shimuizu, A., Anzai, T., Manabu Fujita, M., Kakutani, O., Takagi, M.
and Nagase, N. (1999). Molecular Epidemiology of Staphylococcus
aureus Isolates from Horses by Pulsed Field Gel Electrophoresis. J.
Equine Sci. 10:73-77.
Shirlaw, J.F. and Ashford, W.A. (1962). The occurrence of caseous
lymphadenitis and Morel’s disease in a sheep flock in Kenya. Vet.
Rec. 74: 1025-1026.
Shopsin, B., Gomez, M., Montgomerys, S.O., Smith, D.H., Waddington,
M., Dodge, D.E., Bost, D.A., Riehman, M., Naidich, S. and
Kreiswirth, B.N. (1999). Evaluation of protein A gene polymorphic
region DNA sequencing for typing of Staphylococcus aureus strains.
J. Clin. Microbiol. 37: 3556–3563.
Shryock, T.R., Dye, E.S. and Karbal, F.A. (1992). The accumulation of
bacterial lipids in Staphylococcus abscesses. J. Med. Microbiol. 36:
124
332-336.
Signäs, C., Raucci, G., Johnson, K., Lindgren, P.E., Anantharamalah, G.
M., Hook, M., and Lindberg, M. (1989). Nucleotide sequence of the
gene for a fibronectin-binding protein from Staphylococcus aureus:
Use of this peptide sequence in the synthesis of biological active
peptides. Proc. Natl. Acad. Sci. 86: 699-703.
Smith, D.A., Schurig, G.G., Smith, S.A. and Holladay, S.D. (1999).The
hemolytic plaque-forming cell assay in Tilapia (Oreochromis
niloticus) exposed to benzo[a]pyrene: enhanced or depressed plaque
formation depends on dosing schedule. Toxicol. Mechan. Method. 9:
57-70.
Sneath, P.H.A., Mair, N. S., Sharoe, M.E. and Holt, J.G. (1986). Bergy’s
manual of systematic bacteriology, Vol. 2. William and Wilkins,
Baltimore, USA.
Solomon, H.F., Dixon, D.M. and Pouch, W. (1990). A survey of
staphylococci isolated from the laboratory gerbil. Lab. Anim. Sci.
40: 316-318.
Sompolinsky, D. (1950). Impetigo contagiosa suis. Dansk. Maanedsskr.
Dyrlaegeforen. 61: 401-453.
Speers, D.J. and Nade, S.M.L. (1985). Ultrastructural studies of
adherence of Staphylococcus aureus in experimental acute
haematogenous osteomyelitis. Infec. Immun. 49: 443-446.
Sutra, L., Mendolina, C., Rainord, P. and Poutered, B. (1990).
Encapsulation of Staphylococcus aureus isolates from mastatic milk:
relationship between capsular polysaccharide type 5 and 8 and
colony morphology in serum soft agar, clumping factor reaction
teichoic acid and protein A. J. Clin. Microbiol. 28: 447-451.
Switala, J., Triggs-Raine, B.L. and Loewen, P.C. (1990). Homology
125
among bacterial catalase genes. Can. J. Microbiol. 36: 728-731.
Tambic, A., Power, E.G., Talsania, H., Anthony, R.M. and French, G.L.
(1997). Analysis of an outbreak of non-phage-typeable methicillin-
resistant Staphlococcus aureus by using a randomly amplified
polymorphic DNA assay. J. Clin. Microbiol. 35: 3092–3097.
Thiele, D. (1990). The technique of polymerase chain reaction-a new
diagnostic tool in microbiology and other scientific fields (a review).
Zentralbl. Bateriol. Parasitenkd. Infektionskr. Hyg. Abt. Orig. 273:
434-454.
Timoney, J.F., Gillespie, J. H., Scott, F.W. and Baslough, J.E. (1988).
The staphylococci. In: Hagan and Bruner's Microbiology and
Infectious Diseases of Domestic Animals, 8th
ed. Comstock
Publishing, London, U.K. Pp. 171-180.
Tselenis-Kotsowilis, A.D., Koliomichalis, M.P. and Papavassiliou, J.T.
(1982). Acute pyelonephritis caused by Staphylococcus xylosus. J.
Clin. Microbiol. 16: 593-594.
Tucker, P.W., E.E. Hazen, and F.A. Cotton. (1978). Staphylococcal
nuclease reviewed: a prototypic study in contemporary enzymology.
I. Isolation, physical and enzymatic properties. Mol. Cell. Biochem.
22:67-77.
Uhlen, M., Guss, B., Nilson, B., Gatenback, S., Philipson, L., and
Lindberg, M. (1984). Complete sequence of the staphylococcal gene
encoding protein A. J. Biol. Chem. 259: 1695-1698.
Underdahl, N.R., O.D. Grace, M.J. Twiehaus (1965): Porcine exudative
epidermitis: characterization of bacterial agent. Am. J. Vet. Res. 26:
617-624.
Valenti, G. and Bieler, C. (1984). Cultural and biochemical
characteristics of strains of Morel’s coccus responsible for abscesses
126
in goats in the Valleys of Cunea area. Annali Della Focolta dis
Torinto 28: 286-307.
Van Belkum, A., Bax, R., Peerbooms, P., Goessens, W.H.F., Leeuwen,
N., and Quint, W.G.V. (1993). Comparison of phage typing and
DNA fingerprinting by polymerase chain reaction for discrimination
of methicillin-resistant Staphylococcus aureus strains. J. Clin.
Microbiol. 31:798-803.
Van Belkum, A., Scherer, S., van Alphen, L. and Verbrugh, H. (1998).
Shortsequence DNA repeats in prokaryotic genomes. Microbiol.
Mol. Biol. Rev. 62:275–293.
Van Ketel, R.J., B. De Wever, and L. Van Alphen. (1990). Detection of
Haemophilus influenzae in cerebrospinal fluids by polymerase chain
reaction DNA amplification. J. Med. Microbiol. 33:271-276.
Vandenesch, F., Etienne, J., Reverdy, M.E. and Eykyn, S.J. (1993).
Endocarditis due to Staphylococcus lugdunensis: report of 11 cases
and review. Clin. Infect. Dis. 17: 871-876.
Vannuffel, P., Heusterspreute, M., Bouyer, M., Vandercam, B., Philippe,
M. and Gala, J.L. (1999). Molecular characterization of femA from
Staphylococcus hominis and Staphylococcus saprophyticus, and
femA-based discrimination of staphylococcal species. Res.
Microbiol. 150: 129-141.
Varaldo, P.E., Kilpper-Blaz, R., Biavasco, F., Satta, G. and Schleifer, K.
H. (1988). Staphylococcus delphini sub sp.nov. acoagulase positive
species from dolphins. Int. J. Syst. Bacteriol, 38: 436-439.
Verhoef, J. P., Peterson, K., Kim, Y., Sabath, L. D. and Qure, P.G.
(1977). Opsonic requirements for staphylococcal phagocytosis:
heterogeneity among strains. Immunol. 33:191-197.
Von Ossowski, I., Hausner, G. and Loewen, P.C. (1993). Molecular
127
evolutionary analysis based on the amino acid sequence of catalase.
J. Mol. Evol. 37: 71-76.
Waghorn, D.J. (1994). Staphylococcus lugdunensis as a cause of breast
abscess. Clin. Infect. Dis. 19:814-815.
Walsh, B. and Mounsey, J.P. (1990). Staphylococcus lugdunensis and
endocarditis. [Letter]. J. Clin. Pathology.43: 171.
Watson, D. L. (1975). Enhancement of phagocytosis of Staphylococcus
aureus by polymorphnuclear leucocytes. Res. Vet. Sci. 19: 288-292.
Watson, D.L. (1976). The effect of cytophilic IgG2 on phagocytosis by
ovine polymorphnuclear leucocytes. Immunol. 31: 159-164.
Watson, D.L. (1987). The serological response in sheep to live and killed
Staphylococcus aureus vaccines. Vaccine. 5: 275-278.
Watson, D.L. (1988). Vaccination against experimental staphylococcal
mastitis in ewes. Res. Vet. Sci. 45: 16-21.
Watson, D.L. (1989). Ovine opsonins for Staphylococcus aureus cell wall
and pseudocapsule. Res. Vet. Sci. 46: 84-89.
Watson, D.L. and C.G. Lee. (1978). Immunity to experimental
staphylococcal mastitis: comparison of live and killed vaccines.
Aust. Vet. J. 54:374-378.
Watson, D.L. and Kennedy, J.W. (1981). Immunization against
experimental staphylococcal mastitis in sheep. Effect of challenge
with a heterologous strain of Staphylococcus aureus. Aust. Vet. J.
57: 309-313, 20.
Watson, D.L. and Lee, C.G. (1978). Immunity to experimental
staphylococcal mastitis: comparison of live and killed vaccines.
Aust. Vet. J. 54:374-378.
Westblom, T.U., Gorse, G.J., Milligan T.W. and Schindzielorz, A.H.
(1990). Anaerobic endocarditis caused by Staphylococcus
128
saccharolyticus. J. Clin. Microbiol. 28: 2818-2819
Wiley, B.B. and Maverakis, N.H. (1974). Capsule production and
virulence among strains of Staphylococcus aureus. Ann. N. Y. Acad.
Sci. 236: 221-225.
Wilkinson, B.J. (1983). Staphylococcal capsules and slime. In: Easamon,
C.S.F. and Adlom, C. (Eds.). Staphylococci and staphylococcal
infections. Academic Press, London, U.K. P. 481.
Wilkinson, B.J., Peterson, P., and Quie, P.G. (1979). Cryptic
peptidoglycan and the antiphagocytic effect of the Staphylococcus
aureus capsule: model for the antiphagocytic effect of bacterial cell
surface polymers. Infect. Immun. 23: 502-508.
Yoshida, K. and Ekstedt, R.D. (1968). Relation of mucoid growth of
Staphylococcus aureus to clumping factor reaction, morphology in
serum-soft agar, and virulence. J. Bact. 96: 902-908.
Zakrzewska-Czerwinska, J., Gaszewska-Mastalarz, B.L., Gamian, A. and
Mordarski, M. (1995). Staphylococcus pulvereri sp. Nov., isolated
from human and animal specimens. Int. J. Syst. Bacteriol. 45: 169-
172.
Zierdt, C.H., MacLowry, J.D., and Robertson, E.A. (1982). Quantitation
of pathogenic potential of Staphylococcus aureus. J. Clin. Microbiol.
16: 700-703.
129
APPENDIX
Appendix 1: The complete sequence of the catalase gene of strain (S10)
deposited in the GenBank, accession no EU 281993
My NCBI
[Sign In] [Register]
PubMed Nucleotide Protein Genome Structure PMC Taxonomy OMIM Books
Search Nuc leotide
for Go
1: EU281993. Reports Staphylococcus au...[gi:161406804] Links
Features
Sequence LOCUS EU281993 1725 bp DNA linear BCT
05-DEC-2007
DEFINITION Staphylococcus aureus subsp. anaerobius strain S10
catalase-like
protein gene, complete cds.
ACCESSION EU281993
VERSION EU281993.1 GI:161406804
KEYWORDS .
SOURCE Staphylococcus aureus subsp. anaerobius
ORGANISM Staphylococcus aureus subsp. anaerobius
Bacteria; Firmicutes; Bacillales; Staphylococcus.
REFERENCE 1 (bases 1 to 1725)
AUTHORS Musa,N.O., Eltom,K., Babiker,A., El Sanousi,S.M.,
Gessler,F. and
Boehnel,H.
TITLE Analysis of the catalase gene of a Sudanese strain of
Staphylococcus aureus subsp. anaerobius
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1725)
AUTHORS Musa,N.O., Eltom,K., Babiker,A., El Sanousi,S.M.,
Gessler,F. and
Boehnel,H.
TITLE Direct Submission
JOURNAL Submitted (14-NOV-2007) Tropical Animal Health,
Georg-August-University of Goettingen, Kellnerweg 6,
Goettingen
37077, Germany
FEATURES Location/Qualifiers
source 1..1725
/organism="Staphylococcus aureus subsp.
anaerobius"
/mol_type="genomic DNA"
/strain="S10"
/sub_species="anaerobius"
/db_xref="taxon:72759"
/country="Sudan"
CDS 164..1201
/codon_start=1
/transl_table=11
/product="catalase-like protein"
/protein_id="ABX71760.1"
/db_xref="GI:161406805"
130
/translation="MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQ
FDREVIPERRMHAKGSGAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERG
AADAESDIRGFALKFYTEEGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDA
QNNWDFWTGLPEALHQVTILMSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVKLHFR
TQQGIENLTDEEAAEIIATGRDSSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDN
PFDLTKVWYHDEYPLIEVGEFELNRNPDNYFMDVEQVAFAPTNIIPGLDFSPDKMLQG
RLFSYGDAQRY"
ORIGIN
1 gctttttaag tgtactattc aataactatt tagtactgta aagcgaaaaa aataaaattt
61 tctgattttt taatcatctt gagcatgttt aattgtaatt ctgatggggt taaattataa
121 tatgtattaa attataatta ttataaattg tggagggatg actatgtcac aacaagacaa
181 aaagttaact ggtgtttttg ggcatccagt atcagatcga gaaaatagta tgacagcagg
241 gcctagggga cctcttttaa tgcaagatat ttacttttta gagcaaatgt ctcaatttga
301 tagagaagta ataccagaac gtcgaatgca tgccaaaggt tctggtgcat ttgggacatt
361 tactgtaact aaagatataa caaaatatac gaatgctaaa atattctctg aaataggtaa
421 gcaaaccgaa atgtttgccc gtttctctac tgtagcagga gaacgtggtg ctgctgatgc
481 ggagagtgac attcgaggat ttgcgttaaa gttctacact gaagaaggaa actgggattt
541 agtagggaat aacacaccag tattcttctt tagagatcca aagctatttg ttagtttaaa
601 tcgcgcggtg aaacgagatc ctagaacaaa tatgagagat gcacaaaata actgggattt
661 ctggacgggg cttccagaag cattgcacca agtaacgatc ttaatgtcag atagagggat
721 tcctaaagat ttacgtcaca tgcatgggtt cggttcacac acatactcta tgtataatga
781 ttctggtgaa cgtgtttggg ttaaactcca ttttagaacg caacaaggta ttgaaaactt
841 aactgatgaa gaagctgctg aaattatagc aacaggtcgt gattcatctc aacgcgattt
901 attcgaagcc attgaaaaag gtgattatcc aaaatggaca atgtatattc aagtaatgac
961 tgaggaacaa gctaaaaacc ataaagataa tccatttgat ttaacaaaag tatggtatca
1021cgatgagtat cctctaattg aagttggaga gtttgaatta aatagaaatc cagataatta
1081ctttatggat gttgaacaag ttgcgtttgc accaactaat attattccag gattagattt
1141ttctccagac aaaatgctgc aagggcgttt attctcatat ggcgatgcgc aaagatattg
1201attaggagtt aatcattggc agattcctgt aaaccaacct aaaggtgtgg gtattgaaaa
1261tatttgtcct tttagtagag atggtcaaat gcgcgtagtt gacaataacc aaggtggagg
1321aacacattat tatccaaata accatggtaa atttgattct caacctgaat ataaaaagcc
1381accattccca actgatggat acggctatga atataatcaa cgtcaagatg atgataatta
1441ttttgaacaa ccaggtaaat tgtttagatt acaatcagag ggcgctaaag aaagaatttt
1501tacaaataca gcaaatgcaa tggaaggcgt aacggatgat gttaaacgac gtcatattcg
1561tcattgttac aaagctgacc cagaatatgg taaaggtgtt gcaaaagcat taggtattga
1621tataaattct attgatcttg aaactgaaaa tgatgaaaca tacgaaaact ttgaaaaata
1681 aatttgatat gtagtttcta tattgcgtag ttgagcagtt tatga
//
Disclaimer | Write to the Help Desk NCBI | NLM | NIH
131
Appendix 2: Catalase gene of strain S10 (Sudanese strain) in comparison
with the gene of the catalase-like protein of Staphylococcus aureus subsp.
anaerobius strain MVF 213
emb|AJ000471.1|SAMVFCATA Staphylococcus aureus catalase gene, strain
MVF213
Length=1758
Score = 3162 bits (1712), Expect = 0.0
Identities = 1721/1725 (99%), Gaps = 1/1725 (0%)
Strand=Plus/Plus
Query 1 GCTTTTTAAGTGTACTATTCAATAACTATTTAGTACTGTAAAGCGaaaaaaaTAAAATTT 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 3 GCTTTTTAAGTGTACTATTCAATAACTATTTAGTACTGTAAAGCGAAAAAAATAAAATTT 62
Query 61 TCTGATTTTTTAATCATCTTGAGCATGTttaattgtaattctgatggggttaaattataa 120
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 63 GCTGATTTTTTAATCATCTTGAGCATGTTTAATTGTAATTCTGATGGGGTTAAATTATAA 122
Query 121 tatgtattaaattataattattataaattGTGGAGGGATGACTATGTCACAACAAGACAA 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 123 TATGTATTAAATTATAATTATTATAAATTGTGGAGGGATGACTATGTCACAACAAGACAA 182
Query 181 AAAGTTAACTGGTGTTTTTGGGCATCCAGTATCAGATCGAGAAAATAGTATGACAGCAGG 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 183 AAAGTTAACTGGTGTTTTTGGGCATCCAGTATCAGATCGAGAAAATAGTATGACAGCAGG 242
Query 241 GCCTAGGGGACCTCTTTTAATGCAAGATATTTACTTTTTAGAGCAAATGTCTCAATTTGA 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 243 GCCTAGGGGACCTCTTTTAATGCAAGATATTTACTTTTTAGAGCAAATGTCTCAATTTGA 302
Query 301 TAGAGAAGTAATACCAGAACGTCGAATGCATGCCAAAGGTTCTGGTGCATTTGGGACATT 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 303 TAGAGAAGTAATACCAGAACGTCGAATGCATGCCAAAGGTTCTGGTGCATTTGGGACATT 362
Query 361 TACTGTAACTAAAGATATAACAAAATATACGAATGCTAAAATATTCTCTGAAATAGGTAA 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 363 TACTGTAACTAAAGATATAACAAAATATACGAATGCTAAAATATTCTCTGAAATAGGTAA 422
Query 421 GCAAACCGAAATGTTTGCCCGTTTCTCTACTGTAGCAGGAGAACGTGGTGCTGCTGATGC 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 423 GCAAACCGAAATGTTTGCCCGTTTCTCTACTGTAGCAGGAGAACGTGGTGCTGCTGATGC 482
Query 481 GGAGAGTGACATTCGAGGATTTGCGTTAAAGTTCTACACTGAAGAAGGAAACTGGGATTT 540
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 483 GGAGAGTGACATTCGAGGATTTGCGTTAAAGTTCTACACTGAAGAAGGAAACTGGGATTT 542
Query 541 AGTAGGGAATAACACACCAGTATTCTTCTTTAGAGATCCAAAGCTATTTGTTAGTTTAAA 600
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 543 AGTAGGGAATAACACACCAGTATTCTTCTTTAGAGATCCAAAGCTATTTGTTAGTTTAAA 602
Query 601 TCGCGCGGTGAAACGAGATCCTAGAACAAATATGAGAGATGCACAAAATAACTGGGATTT 660
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 603 TCGCGCGGTGAAACGAGATCCTAGAACAAATATGAGAGATGCACAAAATAACTGGGATTT 662
Query 661 CTGGACGGGGCTTCCAGAAGCATTGCACCAAGTAACGATCTTAATGTCAGATAGAGGGAT 720
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 663 CTGGACGGGGCTTCCAGAAGCATTGCACCAAGTAACGATCTTAATGTCAGATAGAGGGAT 722
Query 721 TCCTAAAGATTTACGTCACATGCATGGGTTCGGTTCACACACATACTCTATGTATAATGA 780
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 723 TCCTAAAGATTTACGTCACATGCATGGGTTCGGTTCACACACATACTCTATGTATAATGA 782
Query 781 TTCTGGTGAACGTGTTTGGGTTAAACTCCATTTTAGAACGCAACAAGGTATTGAAAACTT 840
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 783 TTCTGGTGAACGTGTTTGGGTTAAACTCCATTTTAGAACGCAACAAGGTATTGAAAACTT 842
132
Query 841 AACTGATGAAGAAGCTGCTGAAATTATAGCAACAGGTCGTGATTCATCTCAACGCGATTT 900
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 843 AACTGATGAAGAAGCTGCTGAAATTATAGCAACAGGTCGTGATTCATCTCAACGCGATTT 902
Query 901 ATTCGAAGCCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATGAC 960
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 903 ATTCGAAGCCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATGAC 962
Query 961 TGAGGAACAAGCTAAAAACCATAAAGATAATCCATTTGATTTAACAAAAGTATGGTATCA 1020
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 963 TGAGGAACAAGCTAAAAACCATAAAGATAATCCATTTGATTTAACAAAAGTATGGTATCA 1022
Query 1021 CGATGAGTATCCTCTAATTGAAGTTGGAGAGTTTGAATTAAATAGAAATCCAGATAATTA 1080
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1023 CGATGAGTATCCTCTAATTGAAGTTGGAGAGTTTGAATTAAATAGAAATCCAGATAATTA 1082
Query 1081 CTTTATGGATGTTGAACAAGTTGCGTTTGCACCAACTAATATTATTCCAGGATTAGATTT 1140
||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||
Sbjct 1083 CTTTATGGATGTTGAACAAGTTGCGTTTGCATCAACTAATATTATTCCAGGATTAGATTT 1142
Query 1141 TTCTCCAGACAAAATGCTGCAAGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATTG 1200
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |
Sbjct 1143 TTCTCCAGACAAAATGCTGCAAGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATCG 1202
Query 1201 ATTAGGAGTTAATCATTGGCAGATTCCTGTAAACCAACCTAAAGGTGTGGGTATTGAAAA 1260
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1203 ATTAGGAGTTAATCATTGGCAGATTCCTGTAAACCAACCTAAAGGTGTGGGTATTGAAAA 1262
Query 1261 TATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGACAATAACCAAGGTGGAGG 1320
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1263 TATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGACAATAACCAAGGTGGAGG 1322
Query 1321 AACACATTATTATCCAAATAACCATGGTAAATTTGATTCTCAACCTGAATATAAAAAGCC 1380
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1323 AACACATTATTATCCAAATAACCATGGTAAATTTGATTCTCAACCTGAATATAAAAAGCC 1382
Query 1381 ACCATTCCCAACTGATGGATACGGCTATGAATATAATCAACGTCAAGATGATGATAATTA 1440
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1383 ACCATTCCCAACTGATGGATACGGCTATGAATATAATCAACGTCAAGATGATGATAATTA 1442
Query 1441 TTTTGAACAACCAGGTAAATTGTTTAGATTACAATCAGAGGGCGCTAAAGAAAGAATTTT 1500
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1443 TTTTGAACAACCAGGTAAATTGTTTAGATTACAATCAGAGGGCGCTAAAGAAAGAATTTT 1502
Query 1501 TACAAATACAGCAAATGCAATGGAAGGCGTAACGGATGATGTTAAACGACGTCATATTCG 1560
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1503 -ACAAATACAGCAAATGCAATGGAAGGCGTAACGGATGATGTTAAACGACGTCATATTCG 1561
Query 1561 TCATTGTTACAAAGCTGACCCAGAATATGGTAAAGGTGTTGCAAAAGCATTAGGTATTGA 1620
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1562 TCATTGTTACAAAGCTGACCCAGAATATGGTAAAGGTGTTGCAAAAGCATTAGGTATTGA 1621
Query 1621 TATAAATTCTATTGATCTTGAAACTGAAAATGATGAAACATACGAAAACTTTGAAAAATA 1680
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1622 TATAAATTCTATTGATCTTGAAACTGAAAATGATGAAACATACGAAAACTTTGAAAAATA 1681
Query 1681 AATTTGATATGTAGTTTCTATATTGCGTAGTTGAGCAGTTTATGA 1725
|||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1682 AATTTGATATGTAGTTTCTATATTGCGTAGTTGAGCAGTTTATGA 1726
133
Appendix 3: Catalase gene of strain S10 in comparison with the gene of
the catalase of S.aureus subsp. aureus NCTC 8325 gb|CP000253.1| Staphylococcus aureus subsp. aureus NCTC 8325, complete genome
Length=2821361
Features in this part of subject sequence: catalase
Score = 3092 bits (1674), Expect = 0.0
Identities = 1708/1725 (99%), Gaps = 0/1725 (0%)
Query 1 GCTTTTTAAGTGTACTATTCAATAACTATTTAGTACTGTAAAGCGaaaaaaaTAAAATTT 60
||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||
Sbjct 1269863 GCTTTTTAAGTGTACTATTCAATAACTATTTAGTACTGTAAAGCGAAAAAATTAAAATTT 1269922
Query 61 TCTGATTTTTTAATCATCTTGAGCATGTttaattgtaattctgatggggttaaattataa 120
|||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||
Sbjct 1269923 TCTGATTTTTTAATCATCTTGAGCATGTTTAATTGTAATTTTGATGGGGTTAAATTATAA 1269982
Query 121 tatgtattaaattataattattataaattGTGGAGGGATGACTATGTCACAACAAGACAA 180
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1269983 TATGTATTAAATTATAATTATTATAAATTGTGGAGGGATGACTATGTCACAACAAGACAA 1270042
Query 181 AAAGTTAACTGGTGTTTTTGGGCATCCAGTATCAGATCGAGAAAATAGTATGACAGCAGG 240
|||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||
Sbjct 1270043 AAAGTTAACTGGTGTTTTTGGGCATCCAGTATCAGACCGAGAAAATAGTATGACAGCAGG 1270102
Query 241 GCCTAGGGGACCTCTTTTAATGCAAGATATTTACTTTTTAGAGCAAATGTCTCAATTTGA 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270103 GCCTAGGGGACCTCTTTTAATGCAAGATATTTACTTTTTAGAGCAAATGTCTCAATTTGA 1270162
Query 301 TAGAGAAGTAATACCAGAACGTCGAATGCATGCCAAAGGTTCTGGTGCATTTGGGACATT 360
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270163 TAGAGAAGTAATACCAGAACGTCGAATGCATGCCAAAGGTTCTGGTGCATTTGGGACATT 1270222
Query 361 TACTGTAACTAAAGATATAACAAAATATACGAATGCTAAAATATTCTCTGAAATAGGTAA 420
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270223 TACTGTAACTAAAGATATAACAAAATATACGAATGCTAAAATATTCTCTGAAATAGGTAA 1270282
Query 421 GCAAACCGAAATGTTTGCCCGTTTCTCTACTGTAGCAGGAGAACGTGGTGCTGCTGATGC 480
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270283 GCAAACCGAAATGTTTGCCCGTTTCTCTACTGTAGCAGGAGAACGTGGTGCTGCTGATGC 1270342
Query 481 GGAGAGTGACATTCGAGGATTTGCGTTAAAGTTCTACACTGAAGAAGGAAACTGGGATTT 540
|||| ||||||||||||||||||||||||||||||||||||||||||| |||||||||||
Sbjct 1270343 GGAGCGTGACATTCGAGGATTTGCGTTAAAGTTCTACACTGAAGAAGGGAACTGGGATTT 1270402
Query 541 AGTAGGGAATAACACACCAGTATTCTTCTTTAGAGATCCAAAGCTATTTGTTAGTTTAAA 600
||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||
Sbjct 1270403 AGTAGGGAATAACACACCAGTATTCTTCTTTAGAGATCCAAAGTTATTTGTTAGTTTAAA 1270462
Query 601 TCGCGCGGTGAAACGAGATCCTAGAACAAATATGAGAGATGCACAAAATAACTGGGATTT 660
||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270463 TCGTGCGGTGAAACGAGATCCTAGAACAAATATGAGAGATGCACAAAATAACTGGGATTT 1270522S
Query 661 CTGGACGGGGCTTCCAGAAGCATTGCACCAAGTAACGATCTTAATGTCAGATAGAGGGAT 720
||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270523 CTGGACGGGTCTTCCAGAAGCATTGCACCAAGTAACGATCTTAATGTCAGATAGAGGGAT 1270582
Query 721 TCCTAAAGATTTACGTCACATGCATGGGTTCGGTTCACACACATACTCTATGTATAATGA 780
|||||||||||||||||| ||||||||||||||||| |||||||||||||||||||||||
Sbjct 1270583 TCCTAAAGATTTACGTCATATGCATGGGTTCGGTTCTCACACATACTCTATGTATAATGA 1270642
Query 781 TTCTGGTGAACGTGTTTGGGTTAAACTCCATTTTAGAACGCAACAAGGTATTGAAAACTT 840
||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||
Sbjct 1270643 TTCTGGTGAACGTGTTTGGGTTAAATTCCATTTTAGAACGCAACAAGGTATTGAAAACTT 1270702
Query 841 AACTGATGAAGAAGCTGCTGAAATTATAGCAACAGGTCGTGATTCATCTCAACGCGATTT 900
|||||||||||||||||||||||||||||| |||| ||||||||||||||||||||||||
Sbjct 1270703 AACTGATGAAGAAGCTGCTGAAATTATAGCTACAGATCGTGATTCATCTCAACGCGATTT 1270762
Query 901 ATTCGAAGCCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATGAC 960
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270763 ATTCGAAGCCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATGAC 1270822
134
Query 961 TGAGGAACAAGCTAAAAACCATAAAGATAATCCATTTGATTTAACAAAAGTATGGTATCA 1020
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270823 TGAGGAACAAGCTAAAAACCATAAAGATAATCCATTTGATTTAACAAAAGTATGGTATCA 1270882
Query 1021 CGATGAGTATCCTCTAATTGAAGTTGGAGAGTTTGAATTAAATAGAAATCCAGATAATTA 1080
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1270883 CGATGAGTATCCTCTAATTGAAGTTGGAGAGTTTGAATTAAATAGAAATCCAGATAATTA 1270942
Query 1081 CTTTATGGATGTTGAACAAGTTGCGTTTGCACCAACTAATATTATTCCAGGATTAGATTT 1140
|||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||
Sbjct 1270943 CTTTATGGATGTTGAACAAGCTGCGTTTGCACCAACTAATATTATTCCAGGATTAGATTT 1271002
Query 1141 TTCTCCAGACAAAATGCTGCAAGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATTG 1200
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |
Sbjct 1271003 TTCTCCAGACAAAATGCTGCAAGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATCG 1271062
Query 1201 ATTAGGAGTTAATCATTGGCAGATTCCTGTAAACCAACCTAAAGGTGTGGGTATTGAAAA 1260
|||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||
Sbjct 1271063 ATTAGGAGTTAATCATTGGCAGATTCCTGTAAACCAACCTAAAGGTGTTGGTATTGAAAA 1271122
Query 1261 TATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGACAATAACCAAGGTGGAGG 1320
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1271123 TATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGACAATAACCAAGGTGGAGG 1271182
Query 1321 AACACATTATTATCCAAATAACCATGGTAAATTTGATTCTCAACCTGAATATAAAAAGCC 1380
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1271183 AACACATTATTATCCAAATAACCATGGTAAATTTGATTCTCAACCTGAATATAAAAAGCC 1271242
Query 1381 ACCATTCCCAACTGATGGATACGGCTATGAATATAATCAACGTCAAGATGATGATAATTA 1440
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1271243 ACCATTCCCAACTGATGGATACGGCTATGAATATAATCAACGTCAAGATGATGATAATTA 1271302
Query 1441 TTTTGAACAACCAGGTAAATTGTTTAGATTACAATCAGAGGGCGCTAAAGAAAGAATTTT 1500
||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||
Sbjct 1271303 TTTTGAACAACCAGGTAAATTGTTTAGATTACAATCAGAGGACGCTAAAGAAAGAATTTT 1271362
Query 1501 TACAAATACAGCAAATGCAATGGAAGGCGTAACGGATGATGTTAAACGACGTCATATTCG 1560
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1271363 TACAAATACAGCAAATGCAATGGAAGGCGTAACGGATGATGTTAAACGACGTCATATTCG 1271422
Query 1561 TCATTGTTACAAAGCTGACCCAGAATATGGTAAAGGTGTTGCAAAAGCATTAGGTATTGA 1620
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1271423 TCATTGTTACAAAGCTGACCCAGAATATGGTAAAGGTGTTGCAAAAGCATTAGGTATTGA 1271482
Query 1621 TATAAATTCTATTGATCTTGAAACTGAAAATGATGAAACATACGAAAACTTTGAAAAATA 1680
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1271483 TATAAATTCTATTGATCTTGAAACTGAAAATGATGAAACATACGAAAACTTTGAAAAATA 1271542
Query 1681 AATTTGATATGTAGTTTCTATATTGCGTAGTTGAGCAGTTTATGA 1725
|||||||||||||||||||||||||||||||||||||||||||||
Sbjct 1271543 AATTTGATATGTAGTTTCTATATTGCGTAGTTGAGCAGTTTATGA 1271587
135
Appendix 4: Translated sequence of the catalase gene of strain S10 in
comparison with the amino acid sequence of catalase of other S. aureus
strains
> ref|NP_646038.1| Catalase [Staphylococcus aureus subsp. aureus MW2]
ref|YP_043399.1| catalase [Staphylococcus aureus subsp. aureus MSSA476]
ref|YP_493929.1| catalase [Staphylococcus aureus subsp. aureus USA300]
ref|YP_001246765.1| Catalase [Staphylococcus aureus subsp. aureus JH9]
ref|YP_001316559.1| Catalase [Staphylococcus aureus subsp. aureus JH1]
sp|Q6G9M4|CATA_STAAS Catalase
sp|Q8NWV5|CATA_STAAW Catalase
sp|Q5HG86|CATA_STAAC Catalase
sp|Q99UE2|CATA_STAAM Catalase
sp|Q7A5T2|CATA_STAAN Catalase
sp|Q2FH99|CATA_STAA3 Catalase
sp|Q2FYU7|CATA_STAA8 Catalase
sp|Q2YXT2|CATA_STAAB Catalase
dbj|BAB95086.1| Catalase [Staphylococcus aureus subsp. aureus MW2]
emb|CAG43052.1| catalase [Staphylococcus aureus subsp. aureus MSSA476]
gb|ABD20999.1| catalase [Staphylococcus aureus subsp. aureus
USA300_FPR3757]
gb|ABQ49189.1| Catalase [Staphylococcus aureus subsp. aureus JH9]
gb|ABR52272.1| Catalase [Staphylococcus aureus subsp. aureus JH1]
Length=505
Score = 1043 bits (2697), Expect = 0.0
Identities = 499/505 (98%), Positives = 499/505 (98%), Gaps = 0/505 (0%)
Frame = +2
Query 164 MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQFDREVIPERRMHAKGS 343
MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQFDREVIPERRMHAKGS
Sbjct 1 MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQFDREVIPERRMHAKGS 60
Query 344 GAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERGAADAESDIRGFALKFYTE 523
GAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERGAADAE DIRGFALKFYTE
Sbjct 61 GAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERGAADAERDIRGFALKFYTE 120
Query 524 EGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDAQNNWDFWTGLPEALHQVTIL 703
EGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDAQNNWDFWTGLPEALHQVTIL
Sbjct 121 EGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDAQNNWDFWTGLPEALHQVTIL 180
Query 704 MSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVKLHFRTQQGIENLTDEEAAEIIATGRD 883
MSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVK HFRTQQGIENLTDEEAAEIIAT RD
Sbjct 181 MSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVKFHFRTQQGIENLTDEEAAEIIATDRD 240
Query 884 SSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDNPFDLTKVWYHDEYPLIEVGEFELN 1063
SSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDNPFDLTKVWYHDEYPLIEVGEFELN
Sbjct 241 SSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDNPFDLTKVWYHDEYPLIEVGEFELN 300
Query 1064 RNPDNYFMDVEQVAFAPTNIIPGLDFSPDKMLQGRLFSYGDAQRY*LGVNHWQIPVNQPK 1243
RNPDNYFMDVEQ AFAPTNIIPGLDFSPDKMLQGRLFSYGDAQRY LGVNHWQIPVNQPK
Sbjct 301 RNPDNYFMDVEQAAFAPTNIIPGLDFSPDKMLQGRLFSYGDAQRYRLGVNHWQIPVNQPK 360
Query 1244 GVGIENICPFSRDGQMRVVDNNQGGGTHYYPNNHGKFDSQPEYKKPPFPTDGYGYEYNQR 1423
GVGIENICPFSRDGQMRVVDNNQGGGTHYYPNNHGKFDSQPEYKKPPFPTDGYGYEYNQR
Sbjct 361 GVGIENICPFSRDGQMRVVDNNQGGGTHYYPNNHGKFDSQPEYKKPPFPTDGYGYEYNQR 420
Query 1424 QDDDNYFEQPGKLFRLQSEGAKERIFTNTANAMEGVTDDVKRRHIRHCYKADPEYGKGVA 1603
QDDDNYFEQPGKLFRLQSE AKERIFTNTANAMEGVTDDVKRRHIRHCYKADPEYGKGVA
Sbjct 421 QDDDNYFEQPGKLFRLQSEDAKERIFTNTANAMEGVTDDVKRRHIRHCYKADPEYGKGVA 480
Query 1604 KALGIDINSIDLETENDETYENFEK 1678
KALGIDINSIDLETENDETYENFEK
Sbjct 481 KALGIDINSIDLETENDETYENFEK 505
136
Appendix 5: Translated sequence of the catalase gene of S10 in
comparison with the amino acid sequence of the catalase-like protein of
S. aureus subps. anaerobius strain MVF 213
> sp|Q9L4S2|CATB_STAAA Catalase-like protein emb|CAB76840.1| Catalase [Staphylococcus aureus] Length=455 Score = 927 bits (2396), Expect (2) = 0.0
Identities = 443/445 (99%), Positives = 443/445 (99%), Gaps = 0/445 (0%) Frame = +2 Query 164 MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQFDREVIPERRMHAKGS 343
MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQFDREVIPERRMHAKGS
Sbjct 1 MSQQDKKLTGVFGHPVSDRENSMTAGPRGPLLMQDIYFLEQMSQFDREVIPERRMHAKGS 60
Query 344 GAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERGAADAESDIRGFALKFYTE 523
GAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERGAADAESDIRGFALKFYTE
Sbjct 61 GAFGTFTVTKDITKYTNAKIFSEIGKQTEMFARFSTVAGERGAADAESDIRGFALKFYTE 120
Query 524 EGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDAQNNWDFWTGLPEALHQVTIL 703
EGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDAQNNWDFWTGLPEALHQVTIL
Sbjct 121 EGNWDLVGNNTPVFFFRDPKLFVSLNRAVKRDPRTNMRDAQNNWDFWTGLPEALHQVTIL 180
Query 704 MSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVKLHFRTQQGIENLTDEEAAEIIATGRD 883
MSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVKLHFRTQQGIENLTDEEAAEIIATGRD
Sbjct 181 MSDRGIPKDLRHMHGFGSHTYSMYNDSGERVWVKLHFRTQQGIENLTDEEAAEIIATGRD 240
Query 884 SSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDNPFDLTKVWYHDEYPLIEVGEFELN 1063
SSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDNPFDLTKVWYHDEYPLIEVGEFELN
Sbjct 241 SSQRDLFEAIEKGDYPKWTMYIQVMTEEQAKNHKDNPFDLTKVWYHDEYPLIEVGEFELN 300
Query1064 RNPDNYFMDVEQVAFAPTNIIPGLDFSPDKMLQGRLFSYGDAQRY*LGVNHWQIPVNQPK 1243
RNPDNYFMDVEQVAFA TNIIPGLDFSPDKMLQGRLFSYGDAQRY LGVNHWQIPVNQPK
Sbjct 301 RNPDNYFMDVEQVAFASTNIIPGLDFSPDKMLQGRLFSYGDAQRYRLGVNHWQIPVNQPK 360
Query1244 GVGIENICPFSRDGQMRVVDNNQGGGTHYYPNNHGKFDSQPEYKKPPFPTDGYGYEYNQR 1423
GVGIENICPFSRDGQMRVVDNNQGGGTHYYPNNHGKFDSQPEYKKPPFPTDGYGYEYNQR
Sbjct 361 GVGIENICPFSRDGQMRVVDNNQGGGTHYYPNNHGKFDSQPEYKKPPFPTDGYGYEYNQR 420
Query1424 QDDDNYFEQPGKLFRLQSEGAKERI 1498
QDDDNYFEQPGKLFRLQSEGAKERI
Sbjct 421 QDDDNYFEQPGKLFRLQSEGAKERI 445
137
Appendix 6: Partial sequence of the catalase gene of S. aureus subsp.
anaerobius strain K41 isolated from lymph node abscess of sheep at meat
inspection in Alkadaro slaughter house, Khartoum North, Sudan
TCtACTGTAGCaGGaGAACGTGgTGCTGCTGATGCGGAGAGTGACATtCGAGGATTTGCGTTAAAGTTCTACaCTGAAGAaGGAAA
CTGGGATTTAGTAGGGAATAACACACCAGTATTCTTCTTTAGAGATCCAAAGCTATTTGTTAGTTTAAATCGCGCGGTGAAACGAG
ATCCTAGAACAAATATGAGAGATGCACAAAATAACTGGGATTTCTGGACGGGGCTTCCAGAAGCATTGCACCAAGTAACGATCTTA
ATGTCAGATAGAGGGATTCCTAAAGATTTACGTCACATGCATGGGTTCGGTTCACACACATACTCTATGTATAATGATTCTGGTGA
ACGTGTTTGGGTTAAACTCCATTTTAGAACGCAACAAGGTATTGAAAACTTAACTGATGAAGAAGCTGCTGAAATTATAGCAACAG
GTCGTGATTCATCTCAACGCGATTTATTCGAAGCCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATGACT
GAGGAACAAGCTAAAAACCATAAAGATAATCCATTTGATTTAACAAAAGTATGGTATCACGATGAGTATCCTCTAATTGAAGTTGG
AGAGTTTGAATTAAATAGAAATCCAGATAATTACTTTATGGATGTTGAACAAGTTGCGTTTGCACCAACTAATATTATTCCAGGAT
TAGATTTTTCTCCAGACAAAATGCTGCAAGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATTGATTAGGAGTTAATCATTGG
CAGATTCCTGTAAACCAACCTAAAGGTGTGGGTATTGAAAATATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGACAA
TAACCAAGGTGGAGGAACACATTATTATCCAAATAACCATGGTAAATTTGATTCTCAACCTGAATATAAAAAGCCACCATTCCCAA
CTGATGGATACGGCTATGAATATAATCAACGTCAAGATGATGATAATTATTTTGAACAACCAGGTAAATTGTTTAGATTACAATCA
GAGGGCGCTAAAGAAAGAATTTTTACAAATACAGCAAATGCAATGGAAGGCGTAACGGATGATGTTAAACGACG
Appendix 7: Partial sequence of the catalase gene of S. aureus subsp.
anaerobius strain S19 isolated from outbreak of Morel’s disease in
Alsamra village, Khartoum North, Sudan
AACTGgGATTTAGTAGGGAATAACACACCAGTATTCTTCTTTAGAGATCCAAAGCTATTTGTTAGTTTAAATCGCGCGGTGAAACG
AGATCCTAGAACAAATATGAGAGATGCACAAAATAACTGGGATTTCTGGACGGGGCTTCCAGAAGCATTGCACCAAGTAACGATCT
TAATGTCAGATAGAGGGATTCCTAAAGATTTACGTCACATGCATGGGTTCGGTTCACACACATACTCTATGTATAATGATTCTGGT
GAACGTGTTTGGGTTAAACTCCATTTTAGAACGCAACAAGGTATTGAAAACTTAACTGATGAAGAAGCTGCTGAAATTATAGCAAC
AGGTCGTGATTCATCTCAACGCGATTTATTCGAAGCCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATGA
CTGAGGAACAAGCTAAAAACCATAAAGATAATCCATTTGATTTAACAAAAGTATGGTATCACGATGAGTATCCTCTAATTGAAGTT
GGAGAGTTTGAATTAAATAGAAATCCAGATAATTACTTTATGGATGTTGAACAAGTTGCGTTTGCACCAACTAATATTATTCCAGG
ATTAGATTTTTCTCCAGACAAAATGCTGCAAGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATTGATTAGGAGTTAATCATT
GGCAGATTCCTGTAAACCAACCTAAAGGTGTGGGTATTGAAAATATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGAC
AATAACCAAGGTGGAGGAACACATTATTATCCAAATAACCATGGTAAATTTGATTCTCAACCTGAATATAAAAAGCCACCATTCCC
AACTGATGGATACGGCTATGAATATAATCAACGTCAAGATGATGATAATTATTTTGAACAACCAGGTAAATTGTTTAGATTACAAT
CAGAGGGCGCTAAAGAAAGAATTTTTACAAATACAGCAAATGCAATGGAAGGCGTAACGGATGATGTTAAACGACG
Appendix 8: Partial sequence of the catalase gene of S. aureus subsp.
anaerobius strain G2 isolated from lymph node abscess of sheep at meat
inspection in Ghanawa slaughter house, Omdurman, Sudan
CACACCAGTATTCTTCTTTAGAGATCCAAAGCTATTTGTTAGTTTAAATCGCGCGGTGAAACGAGATCCTAGAACAAATATGAGAG
ATGCACAAAATAACTGGGATTTCTGGACGGGGCTTCCAGAAGCATTGCACCAAGTAACGATCTTAATGTCAGATAGAGGGATTCCT
AAAGATTTACGTCACATGCATGGGTTCGGTTCACACACATACTCTATGTATAATGATTCTGGTGAACGTGTTTGGGTTAAACTCCA
TTTTAGAACGCAACAAGGTATTGAAAACTTAACTGATGAAGAAGCTGCTGAAATTATAGCAACAGGTCGTGATTCATCTCAACGCG
ATTTATTCGAAGCCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATGACTGAGGAACAAGCTAAAAACCAT
AAAGATAATCCATTTGATTTAACAAAAGTATGGTATCACGATGAGTATCCTCTAATTGAAGTTGGAGAGTTTGAATTAAATAGAAA
TCCAGATAATTACTTTATGGATGTTGAACAAGTTGCGTTTGCACCAACTAATATTATTCCAGGATTAGATTTTTCTCCAGACAAAA
TGCTGCAAGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATTGATTAGGAGTTAATCATTGGCAGATTCCTGTAAACCAACCT
AAAGGTGTGGGTATTGAAAATATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGACAATAACCAAGGTGGAGGAACACA
TTATTATCCAAATAACCATGGTAAATTTGATTCTCAACCTGAATATAAAAAGCCACCATTCCCAACTGATGGATACGGCTATGAAT
ATAATCAACGTCAAGATGATGATAATTATTTTGAACAACCAGGTAAATTGTTTAGATTACAATCAGAGGGCGCTAAAGAAAGAATT
TTTACAAATACAGCAAATGCAATGGAAGGCGTAACGGATGATGTTAAACGACG
138
Appendix 9: Partial sequence of the catalase gene of S. aureus subsp.
anaerobius strain ATCC35844, DSM no. 20714
CTGGGAtTTAGTAGGGAATAACACACCAGTATTCTTCTTTAGAGATCCAAAGCTATTTGTTAGTTTAAATCGCGCGGTGAAACGAG
ATCCTAGAACAAATATGAGAGATGCACAAAATAACTGGGATTTCTGGACGGGGCTTCCAGAAGCATTGCACCAAGTAACGATCTTA
ATGTCAGATAGAGGGATTCCTAAAGATTTACGTCACATGCATGGGTTCGGTTCACACACATACTCTATGTATAATGATTCTGGTGA
ACGTGTTTGGGTTAAACTCCATTTTAGAACGCAACAAGGTATTGAAAACTTAACTGATGAAGAAGCTGCTGAAATTATAGCAACAG
GTCGTGATTCATCTCAACGCGATTTATTCGAAGCCATTGAAAAAGGTGATTATCCAAAATGGACAATGTATATTCAAGTAATGACT
GAGGAACAAGCTAAAAACCATAAAGATAATCCATTTGATTTAACAAAAGTATGGTATCACGATGAGTATCCTCTAATTGAAGTTGG
AGAGTTTGAATTAAATAGAAATCCAGATAATTACTTTATGGATGTTGAACAAGTTGCGTTTGCATCAACTAATATTATTCCAGGAT
TAGATTTTTCTCCAGACAAAATGCTGCAAGGGCGTTTATTCTCATATGGCGATGCGCAAAGATATCGATTAGGAGTTAATCATTGG
CAGATTCCTGTAAACCAACCTAAAGGTGTGGGTATTGAAAATATTTGTCCTTTTAGTAGAGATGGTCAAATGCGCGTAGTTGACAA
TAACCAAGGTGGAGGAACACATTATTATCCAAATAACCATGGTAAATTTGATTCTCAACCTGAATATAAAAAGCCACCATTCCCAA
CTGATGGATACGGCTATGAATATAATCAACGTCAAGATGATGATAATTATTTTGAACAACCAGGTAAATTGTTTAGATTACAATCA
GAGGGCGCTAAAGAAAGAATTTTACAAATACAGCAAATGCAATGGAAGGCGTAACGGATGATGTTAAACGAC
Poster presented at Tropentag 2007
139
Tropentag, October 9-11, 2007, Witzenhausen, Germany
“Utilisation of diversity in land use systems:
Sustainable and organic approaches to meet human needs”
Outbreak of Morels Disease (Sheep Abscess disease) in the Sudan
Nasreen Omer Musa1, Sulieman El Sanousi1, Abdulkhalig Babiker1, Kamal Eldin Hassan Ali Eltom2
1University of Khartoum, Institute for Promotion of Animal Export Studies, Microbiology and
Molecular Biology, Sudan
2Georg-August-Universit¨at Göttingen, Institute of Tropical Animal Health, Germany
Abstract
We report here for an outbreak of abscess disease in a flock of sheep in Al Samra village,
Khartoum North, Sudan. The flock consisted of 100 animals of different ages ranging from 4 - 12 months. The animals were free grazing during the daytime and they were kept in a pen at
the evenings, where they receive some type of feed supplemented with concentrates. Thirty
animals were showing one or two abscess of superficial (prescapular or parotid) lymph nodes.
Abscesses were round with diameter of 4 - 10 cm, soft in consistency when palpated. All abscesses were incised following aseptical proceures (shaving, rubbing with tincture of iodine
and 70% alcohol) and the contents were expelled from which samples were taken in sterile
containers. The contents of almost all abscesses were odourless, viscid, yellowish white to creamy in colour and were enclosed in a thick connective tissue capsule. Bacteriological
examination of the contents of abscesses of 28 (93.33 %) animals revealed pure cultures of
Gram-positive cocci arranged in pairs, tetrads and clusters. Biochemical tests for these bacteria were typical to those of Staphylococcus aureus subspecies anaerobius, the
aetiological agent of sheep abscess disease, which was firstly described by Morel in 1911 in
France. Abscesses of the remaining two animals yielded growth of Corynebacterium spp., the
causative agent of caseous lymphadenitis of sheep. Results of this report confirm findings of previous investigations on abscess syndromes of sheep in the Sudan, in which Staph. aureus
subsp. anaerobius was found to be the first organism to be incriminated in superficial lymph
node abscess in sheep, especially of small ages and in sheep in steaming up operations.
Keywords: Corynebacterium spp., Morels Disease, sheep abscess, Staphylococcus aureus
Contact Address: Nasreen Omer Musa, University of Khartoum, Institute for Promotion of Animal Export Studies, Microbiology and Molecular Biology, Shabmat, 13314 Khartoum
North, Sudan, e-mail: [email protected]
140
Paper submitted to Veterinary Microbiology on 19.11.2008
Genes and Genome
The catalase gene differentiates between some strains of Staphylococcus aureus
subspecies anaerobius
Nasreen O. Musa1†
, Kamal Eltom*1†
, Frank Gessler1, Helge Böhnel
1, Abdulkhalig
Babiker2, Suleiman M. El Sanousi
2
1Institute of Tropical Animal Health, Georg-August University of Göttingen,
Kellnerweg 6, D-37077 Göttingen, Germany
2Faculty of Veterinary Medicine, University of Khartoum, 13314 Shambat, Khartoum
North, Sudan
Present address of K. Eltom and Nasreen O. Musa: Institute for Promotion of Animal
Export Studies, University of Khartoum, 13314 Shambat, Khartoum North, Sudan
Present address of F. Gessler and H. Böhnel: Institute of Applied Biotechnology in the
Tropics at Georg-August University of Göttingen, Marie-Curie-Str. 7, 37079
Göttingen, Germany.
*Corresponding author
Present corresponding author address: Kamal Eltom, Institute for Promotion of
Animal Export Studies, University of Khartoum, 13314 Shambat, Khartoum North,
Sudan. Tel. +249 185 318120, Telefax + 249 185 326827, E-mail: keltom@daad-
alumni.de
† Nasreen O. Musa and Kamal Eltom contributed equally to this paper
This work was conducted at the Institute of Tropical Animal Health, Georg-August
University of Göttingen.
141
ABSTRACT
Staphylococcus aureus subspecies anaerobius strain S10 was isolated from outbreak
of sheep abscess disease. Sequence of the catalase gene of this strain showed 99%
identity to the catalase gene (katB) sequence of the reference strain (S. aureus subsp.
anaerobius strain MVF213) with mismatching of three base pairs. An important
substitution located 1036 nucleotides upstream the initiation codon from “C” in katB
to “T” in the catalase gene of strain S10 originated a stop codon. The deduced protein
(345 amino acids) is 105 amino acids shorter than that of katB. Partial sequence (600
– 990 bp) of the catalase gene of other eight local isolates in addition to another
reference strain (DSM no. 20714) revealed the same mutations in all local (African)
strains, whereas sequence of the reference (European) strain was typical to that of
katB. Sequence of the catalase gene of S. aureus subsp. anaerobius stain S10 was
deposited in the GenBank under accession no. EU281993.
Keywords: catalase gene, sheep abscess disease, Staphylococcus aureus subspecies
anaerobius.
142
INTRODUCTION
Anaerobic Staphylococcus aureus bacteria are the causal agent of sheep abscess or
Morel’s disease (Bajmócy et al., 1984, Hamad et al., 1992). Although these bacteria
are considered apathogenic to man, a report on a case of septicaemia due to one strain
of these bacteria in man has recently been published (Peake et al., 2006). These
bacteria were separated from other S. aureus bacteria in a subspecies (S. aureus
subspecies anaerobius) because of their negative or weak growth in normal air, lack
of the catalase enzyme activity in addition to some other biochemical properties (de la
Fuente et al., 1985). Although some strains of S. aureus subsp. aureus were reported
to lack this catalase enzyme activity (Tu et al., 1976, Friedberg et al., 2003, Yelmaz et
al., 2005), they still grow well under aerobic conditions (Grüner et al., 2007).
Comparative studies between the catalase genes of S. aureus subsp. aureus and S.
aureus subsp. anaerobius (katA and katB, respectively) showed that katA had
undergone mutations led to deletion of one base pair in addition to 8 silent and 6 mis-
sense mutations (Sanz et al., 2000). The deletion resulted in shift of the reading frame
and premature termination of translation with subsequent generation of katB, which
codes for a protein 55 amino acid residues shorter than katA. Lack of the catalase
activity of S. aureus subsp. anaerobius is attributed to some of these mutations (Sanz
et al., 2000). Loss of the catalase enzyme activity in some strains of S. aureus subsp.
aureus was also attributed to mutations of the catalase gene (katA). While in a
methicillin resistant S. aureus subsp. aureus strain deletion of five successive base
pairs leading to shift in the reading frame and premature termination of translation
(Grüner et al., 2007), substitution of a key amino acid in the protein (histidine 58 by
143
atyrosine) led to inactivity of this gene in methicillin sensitive S. aureus subsp. aureus
strain (Piau et al., 2008).
We report here for some strains of S. aureus subsp. anaerobius that harbour a catalase
gene that underwent mutations other than those previously reported for the European
strains.
MATERIALS AND METHODS
Bacterial strains
S. aureus subsp. anaerobius strain S10 (SaanS10) was isolated from superficial lymph
node abscess of one lamb in a flock of sheep during outbreak of Morel’s disease in
Alsamra village, East Nile Province of the Sudan, as has previously been reported
(Musa et al., 2007). Other isolates and strains used in this study were as follows: two
isolates from animals in the same disease outbreak, 6 isolates from superficial lymph
node abscesses of sheep at meat inspection in abattoirs located in two different areas
of Khartoum State, and S. aureus subsp. anaerobius DSM no. 20714 as reference
strain. Identification of the isolates was based on failure of aerobic growth within 48
h, lack of catalase activity, positive coagulase activity, in addition to the fermentation
ability of some sugars. All tests were done according to standards methods (Barrow
and Feltham, 1993).
DNA extraction
Genomic DNA was extracted using Axy Prep Bacterial Genomic DNA Miniprep Kit
of Axygen (Bioron, Ludwigshafen, Germany) with some modifications of the
manufacturer’s protocol. In brief, 3-5 colonies from 48 h blood agar culture were
144
suspended in 150 µl of the recommended buffer. Lysis of the cells was achieved by
treatment with 10 µl of 1% lysostaphin (Sigma, Taufkirchen, Germany) for 1 h at 37
°C followed by addition of 2 µl of 10% Proteinase K (Bioron) at 56 °C for 2 h. The
follow-up steps were carried out according to the manufacturer’s protocol.
PCR
To confirm the biochemical identification of the isolates, a conserved region of the
thermonuclease gene (nuc gene) of S. aureus was amplified by PCR using primers
and conditions previously described (Brakstad et al., 1992).
Sequencing of the catalase gene
In order to amplify and sequence the whole catalase gene of SaanS10 and to partially
sequence the catalase gene of the other isolates, primers and conditions previously
described for the amplification of katA and katB (Sanz et al., 2000) in addition to
other primers designed for this purpose were used (Table 1). Sequencing was done by
Seqlab (Göttingen, Germany). For confirmation of the sequence results, both strands
were sequenced, or overlapping parts of the gene were sequenced. Sequences were
edited using a software program (BioEdit, Version 7.0.5.3). Alignment and
comparisons were done using the Basic Local Alignment Search Tool (BLAST) of
NCBI. The resulting sequence was deposited in the GenBank under accession no.
EU281993.
RESULTS AND DISCUSSION
Identification of the isolates by biochemical tests could be confirmed by PCR
amplification of the nuclease and catalase genes to the species level only (i.e. S.
145
aureus) but not to the subspecies level. Further genetic characterization could be made
by sequencing the catalase gene. Sequence of the putative catalase gene of S. aureus
subsp. anaerobius strain S10 (SaanS10) showed 99% identity to katB gene of S.
aureus subsp. anaerobius MVF213 (GenBank accession no. AJ000471), katA gene of
S. aureus subsp. aureus strains NCTC 8325 and Newman (GenBank accession
nos.CP000253 and AP009351.1, respectively) and some other strains. The whole
amplified part of the putative catalase gene of SaanS10 (katS10) was 1725 nucleotides
in length. Comparison of this sequence with katB sequence revealed mismatches of
only three bases. But, in comparison with katA 15 bases substitutions occurred within
the coding region of katA, six of which were mis-sense mutations while the others
were silent mutations. An important substitution occurred at position no. 1099 (1036
bases upstream the initiation codon) of katS10 gene. In katS10 the base is “T”, while
in katA and katB it is “C”. This substitution resulted in the code "TGA" instead of
"CGA". This code for termination of translation rendered the predicted protein to be
only 345 amino acids in length. In S. aureus subsp. aureus (NCTC 8325 and Newman
strains) the protein of katA is 505 a.a. long. In S. aureus subsp. anaerobius strain
MVF213, which is catalase negative, the catalase-like protein of katB is 445 a.a. long.
Loss of the catalase activity of S. aureus subsp. anaerobius is attributed to deletion of
one base 1338 nucleotides upstream the initiation codon, which resulted in shift in the
reading frame and premature termination of translation 30 bases later (Sanz et al.,
2000). In katS10 this deletion is absent, a feature of similarity to katA. The third
mismatching of katS10 and katB is that the substitution which occurred at base 949
upstream the initiation codon leading to serine in katB instead of proline in katA (Sanz
et al., 2000) did happen in katS10. Interestingly, all mutations, except the above
mentioned ones, occurred in katA gene leading to the generation of katB did also
146
occur in katS10. This suggests that katA underwent mutations in at least two steps
leading to the generation of katB and katS10.
To see if these mutations of katS10 are unique features of SaanS10 or common to
other S. aureus subsp. anaerobius local strains, partial sequence (600- 990 bp) of the
catalase genes of other eight isolates in addition to a reference strain (S. aureus subsp.
anaerobius DSM no 20714) was performed. The segment of the gene chosen for this
partial sequence targeted a region that contained most of the mutations seen in katS10
including position 1099 of the gene. The sequence of the catalase gene of all local
isolates was identical to that of katS10, while that of the reference strain was identical
to katB sequence.
S. aureus subsp. anaerobius strain MVF213 was originally isolated from lamb
affected with abscess disease in Spain. The mutations found in this strain leading to
the generation of katB were also found in three other strains isolated from lambs
affected with the same disease in Spain at different years (Sanz et al., 2000). The
Spanish strains thus seem to have originated from one clone (European clone), and the
local strains harbouring katS10 seem to originate from another genetically distinct
clone (African clone). This assumption can be augmented by the results of Elhaj and
El Sanousi (2005) who found that local isolates of S. aureus subsp. anaerobius were
identical, but distinct from the reference strain, in the DNA restriction pattern in
PFGE.
In conclusion, results of this study show clear differentiation between local and
reference strains of S. aureus subsp. anaerobius on the base of the catalase gene
sequence. However, the potential use of the catalase gene as gene marker for typing
strains of S. aureus subsp. anaerobius requires further investigations including more
147
international strains of both S. aureus subsp. anaerobius and catalase negative S.
aureus subsp. aureus.
To the best of our knowledge, this is the second report on the catalase-like protein
gene of S. aureus subsp. anaerobius and the fourth on a non-functional catalase gene
of S. aureus in general.
AKNOWLEDGMENTS
Dr. Muna O. Elhaj, Central Veterinary Research Laboratories centre- Soba, Sudan,
provided the reference strain. This work was partially funded by University of
Khartoum, Sudan and the Institute of Applied Biotechnology in the Tropics (IBT) at
the University of Göttingen, Germany.
REFERENCES
Bajmócy, E., Fazekas, B., Tanyi, J. 1984. An outbreak of Morel’s disease (a
contagious sheep disease accompanied by abscess formation) in Hungary. Acta Vet.
Hung. 32, 9–13.
Barrow, G.L., Feltham, R.K.A. (Eds.) 1993. Cowan and Steel's manual for the
identification of medical bacteria, 3rd edn. Cambridge: Cambridge University Press.
Brakstad, O.G., Aasbakk, K., Maeland, J.A. 1992. Detection of Staphylococcus
aureus by polymerase chain reaction amplification of the nuc gene. J. Clin. Microbiol.
30, 1654–1660.
De la Fuente, R., Suarez, G., Schleifer, K.H. 1985. Staphylococcus aureus subsp.
anaerobius nov., the causal agent of abscess disease of sheep. Int. J. Sys. Bact. 35,
99–102.
148
Elhaj, M.O., El Sanousi, S.M. 2005. Pulsed-field gel electrophoresis for comparison
of Staphylococcus aureus subsp. anaerobius subsp. anaerobius local Sudanese
isolates. J. Anim. Vet. Adv. 4, 706–707.
Friedberg, B., Hauer, E., Belkhirat, M., Watine, J., Le Coustumier, A. 2003. Catalase
negative Staphylococcus aureus: a rare cause of catheter-related bacteremia. Clin.
Microbiol. Infect. 9, 1253–1255.
Grüner, B.M., Han, S.-R., Meyer, H.-G., Wulf, U., Bhakdi, S., Siegel, E.K. 2007.
Characterization of a catalase-negative methicillin-resistant Staphylococcus aureus
strain. J. Clin. Microbiol. 45, 2684–2685.
Hamad, A.R.A.R., Shigiddi, M.T., El Sanousi, S.M. 1992. Abscess disease of sheep in
the Sudan. Sud. J. Vet. Sc. Anim. Husb. 31, 60–61.
Musa, N.O., Babiker, A., El Sanousi, S. M., Eltom, K. 2007. Outbreak of Morel’s
disease in the Sudan. Abstract. p. 30. Tropentag, Witzenhausen, Germany.
Peake, S.L., Peter, J.V., Chan, L., Wise, R.P., Butcher, A.R. Grove, D.I. 2006. First
report of septicemia caused by an obligately anaerobic Staphylococcus aureus
infection in a human. J. Clin. Microbiol. 44, 2311–2313.
Piau, C., Jehan, J., Leclercq, R., Daurel, C. 2008. Catalase-negative Staphylococcus
aureus strain with point mutations in the katA gene J. Clin. Microbiol. 46, 2060–2061.
Sanz, R., Marin, I., Ruiz-Santa-Quiteria, J.A., Orden, J.A., Cid, D., Diez, R.M.,
Silhadi, K.S., Amils, R., de la Fuente, R. 2000. Catalase deficiency in Staphylococcus
aureus subsp. anaerobius is associated with natural loss of function mutations within
the structural gene. Microbiology 146, 465–475.
149
Tu, K.K., Palutke, W.A. 1976. Isolation and characterization of a catalase-negative
strain of Staphylococcus aureus. J. Clin. Microbiol. 3, 77–78.
Yilmaz, M., Aygun, G., Utku, T. Dilkmen, Y., Ozturk, R. 2005. First report of
catalase-negative methicillin-resistant Staphylococcus aureus sepsis. J. Hosp. Infect.
60, 188–189.
150
Table 1: Oligonucleotides used in this study
Primer Sequence Gene Source
Nuc F 5´ GCGATTGATGGTGATACGGTT 3´ Thermo-
nuclease
Brakstad et al.
(1992)
Nuc R 5´ AGCCAAGCCTTGACGAACTAAAGC 3´ Thermo-
nuclease
Brakstad et al.
(1992)
3 F 5´ GCTTTTTAAGTGTACTATTC 3´ Catalase This study a
164 F 5´ TATAAATTGTGGAGGGATGAC 3´ Catalase Sanz et al. (2000)
8 F 5´ CTCCATTTTAGAACGCAACAA 3´ Catalase Sanz et al. (2000)
1396 F 5´ GATGGATACGGCTATGAATA 3´ Catalase This study a
872 R 5´ GCTATAATTTCAGCAGCTTC 3´ Catalase This study a
1583 R 5´ TGGGTCAGCTTTGTAACA 3´ Catalase Sanz et al. (2000)
1726 R 5´ TCATAAACTGCTCAACTACGC 3´ Catalase Sanz et al. (2000)
a The primers were designed based on the sequences of the catalase genes of
Staphylococcus aureus strain MVF213 (GenBank accession no. AJ000471) and S.
aureus strain ATCC12600 (GenBank accession no. AJ000472)