Upload
others
View
7
Download
0
Embed Size (px)
Citation preview
DEVELOPMENT OF RECOMBINANT VACCINES COMPOSED OF PLPE
AND OMPH FROM PASTEURELLA MULTOCIDA A:3
A THESIS SUBMITTED TO
THE GRADUATE SCHOOL OF NATURAL AND APPLIED SCIENCES
OF
MIDDLE EAST TECHNICAL UNIVERSITY
BY
SEZER OKAY
IN PARTIAL FULFILLMENT OF THE REQUIREMENTS
FOR
THE DEGREE OF DOCTOR OF PHILOSOPHY
IN
BIOLOGY
DECEMBER 2011
Approval of the thesis:
DEVELOPMENT OF RECOMBINANT VACCINES COMPOSED OF
PLPE AND OMPH FROM PASTEURELLA MULTOCIDA A:3
submitted by SEZER OKAY in partial fulfillment of the requirements for the
degree of Doctor of Philosophy in Biology Department, Middle East
Technical University by,
Prof. Dr. Canan Özgen _______________
Dean, Graduate School of Natural and Applied Sciences
Prof. Dr. Musa Doğan _______________
Head of Department, Biology
Prof. Dr. Gülay Özcengiz _______________
Supervisor, Biology Dept., METU
Examining Committee Members:
Assoc. Prof. Dr. Mayda Gürsel _______________
Biology Dept., METU
Prof. Dr. Gülay Özcengiz _______________
Biology Dept., METU
Prof. Dr. Cumhur Çökmüş _______________
Biology Dept., Ankara University
Assist. Prof. Dr. A. Elif Erson Bensan _______________
Biology Dept., METU
Assist. Prof. Dr. Çağdaş D. Son _______________
Biology Dept., METU
Date: 30.12.2011
iii
I hereby declare that all information in this document has been obtained and
presented in accordance with academic rules and ethical conduct. I also
declare that, as required by these rules and conduct, I have fully cited and
referenced all material and results that are not original to this work.
Name, Last name: Sezer Okay
Signature :
iv
ABSTRACT
DEVELOPMENT OF RECOMBINANT VACCINES COMPOSED OF
PLPE AND OMPH FROM PASTEURELLA MULTOCIDA A:3
Okay, Sezer
Ph. D., Department of Biology
Supervisor: Prof. Dr. Gülay Özcengiz
December 2011, 121 pages
Pasteurella multocida serotype A:3 is a gram-negative bacterial pathogen which
is one of the causative agents of shipping fever in cattle. In this study, ompH and
two fragments of plpE gene (plpEN and plpEC) were cloned from the genomic
DNA of P. multocida P-1062 (ATCC 15743, serotype A:3) and plpEN-ompH and
plpEC-ompH fusions were constructed. In vitro expression of the genes was
shown in HEK-293 cells. Later, full-length plpE gene was cloned and the
recombinant proteins were expressed in E. coli and purified. Three DNA vaccine
formulations, namely pCMV-ompH, pCMV-plpEN-ompH and pCMV-plpEC-
ompH and five recombinant protein based vaccines, PlpEN-OmpH, PlpEC-
OmpH, OmpH, PlpEC and PlpE were generated. Recombinant proteins were
v
formulated with at least one of the adjuvants: alum, CpG, alum-CpG, oil based
and oil based-CpG. BALB/c mice were immunized with these vaccine
formulations and their sera were used for the evaluation of antibody and serum
IFN-γ titers. Protective capacities of the vaccines were also evaluated via
challenge of mice with 10 LD50 of P. multocida A:3. DNA vaccines induced
immune responses, but did not provide protection. All protein vaccine
formulations increased antibody levels and CpG containing formulations
enhanced serum IFN-γ titers. 100 µg of PlpEC-OmpH protein adsorbed on alum
adjuvant conferred 40% protection while no protection was obtained with PlpEN-
OmpH. Next, the effects of CpG, or its alum and oil based combinations as
adjuvants were investigated on PlpEC-OmpH mediated protection. The vaccine
formulation composed of PlpEC-OmpH and oil based-CpG adjuvant conferred
100% protection. Finally, the mice were vaccinated with recombinant OmpH,
PlpEC and PlpE formulated with oil based-CpG adjuvant. OmpH, PlpEC and
PlpE formulations provided 50%, 60% and 100% protection, respectively. These
findings implicated that recombinant PlpE and PlpEC-OmpH fusion proteins
when formulated with oil based-CpG adjuvant are potent acellular vaccine
formulation candidates against shipping fever.
Keywords: Pasteurella multocida, OmpH, PlpE, recombinant vaccine
vi
ÖZ
PASTEURELLA MULTOCIDA A:3’E AİT PLPE VE OMPH’DEN OLUŞAN
REKOMBİNANT AŞILARIN GELİŞTİRİLMESİ
Okay, Sezer
Doktora, Biyoloji Bölümü
Tez Yöneticisi: Prof. Dr. Gülay Özcengiz
Aralık 2011, 121 sayfa
Pasteurella multocida serotip A:3, sığırlardaki nakil humması hastalığı
etmenlerinden biri olan gram-negatif bakteriyel bir patojendir. Bu çalışmada,
ompH ve plpE geninin iki parçası (plpEN ve plpEC), P. multocida P-1062 (ATCC
15743, serotip A:3)’ün genomik DNA’sından kopyalanıp plpEN-ompH ve plpEC-
ompH füzyonları oluşturuldu. Genlerin in vitro ekspresyonu HEK-293
hücrelerinde gösterildi. Daha sonra, plpE geninin bütünü kopyalandı ve
rekombinant proteinler E. coli’de ekspres edilip saflaştırıldı. pCMV-ompH,
pCMV-plpEN-ompH ve pCMV-plpEC-ompH olmak üzere 3 DNA aşısı, PlpEN-
OmpH, PlpEC-OmpH, OmpH, PlpEC ve PlpE olmak üzere de 5 protein bazlı aşı
üretildi. Rekombinant proteinler, alum, CpG, alum-CpG, yağ bazlı ve yağ bazlı-
vii
CpG adjuvanlarından en az biriyle formüle edildi. BALB/c fareleri bu aşı
formülasyonlarıyla bağışıklandı ve serumları, antikor ve IFN-γ düzeylerinin
belirlenmesinde kullanıldı. Aşıların koruyuculukları, farelerin 10 LD50 P.
multocida A:3’e karşı hayatta kalma deneyi ile değerlendirildi. DNA aşıları,
bağışıklık yanıtlarını tetiklemesine rağmen koruyuculuk sağlamadı. Protein aşı
formülasyonları antikor düzeyinde artış sağladı ve serum IFN-γ titrelerindeki artış
CpG içeren formülasyonlarla elde edildi. Alum adjuvanına adsorbe edilmiş 100
µg PlpEC-OmpH proteini %40 koruma sağlarken, PlpEN-OmpH proteiniyle hiç
koruma elde edilemedi. Daha sonra, CpG ya da onun alum ve yağ bazlı
kombinasyonlarının PlpEC-OmpH üzerine adjuvant etkisi araştırıldı. PlpEC-
OmpH ve yağ bazlı-CpG adjuvanıyla hazırlanan aşı formülasyonu %100 koruma
sağladı. Son olarak, fareler yağ bazlı-CpG adjuvanıyla formüle edilmiş
rekombinant OmpH, PlpEC ve PlpE ile aşılandı. OmpH, PlpEC ve PlpE
formülasyonları sırasıyla %50, %60 ve %100 koruma sağladı. Bu bulgular, yağ
bazlı-CpG adjuvanıyla formüle edildiğinde rekombinant PlpE ve PlpEC-OmpH
füzyon proteininin nakil humması hastalığına karşı hücresiz aşı formülasyonu
adayı olduğunu gösterdi.
Anahtar kelimeler: Pasteurella multocida, OmpH, PlpE, rekombinant aşı
viii
To My Family
ix
ACKNOWLEDGEMENTS
I would like to express my deepest gratitude and sincerest appreciation to my
supervisor Prof. Dr. Gülay Özcengiz for her guidance, continuous advice,
invaluable help and understanding throughout this study as well as my graduate
education. I am grateful to Dr. Erkan Özcengiz for his invaluable help, continuous
encouragement and constructive criticism in vaccine development.
I would like to thank to Assist. Prof. Dr. Elif Erson Bensan and Prof. Dr. Cumhur
Çökmüş for their help and criticism throughout the study. I would also like to
thank to Dr. Fernando Rodriguez, Dr. Eva Perez and Dr. Jordi Marques
Argilaguet for their help and hospitality during my stay in CReSA, Barcelona.
I am grateful to my labmates Volkan Yıldırım, Burcu Tefon, Orhan Özcan, Eser
Ünsaldı, Çiğdem Yılmaz, Elif Tekin, Alper Mutlu, İbrahim Sertdemir, Aycan
Apak, Mustafa Çiçek, Mustafa Demir, İsmail Cem Yılmaz and Ayça Çırçır as
well as my ex-labmate İsmail Öğülür for their friendship and cooperation.
My special thanks also go to Aslıhan Kurt for her understanding, endless help,
encouragement and great friendship that made easier for me to overcome
diffuculties in all hard times.
Last but not least, I would like to express my heartful gratitude to my mother
Hatice, my father Memet, my brothers, Sertaç, Samet, Serkan and his wife Aysun
and my lovely nephew Duhan Efe for their endless love, support, patience and
understanding.
x
TABLE OF CONTENTS
ABSTRACT ........................................................................................................... iv
ÖZ .......................................................................................................................... vi
ACKNOWLEDGEMENTS ................................................................................... ix
TABLE OF CONTENTS ........................................................................................ x
LIST OF TABLES ............................................................................................... xiv
LIST OF FIGURES .............................................................................................. xv
LIST OF ABBREVIATIONS ............................................................................. xvii
CHAPTERS
1. INTRODUCTION .............................................................................................. 1
1.1. Bovine Respiratory Disease ............................................................................. 1
1.1.1. Etiology ..................................................................................................... 1
1.1.1.1. Mannheimia haemolytica ................................................................... 2
1.1.1.2. Pasteurella multocida ........................................................................ 3
1.1.1.3. Histophilus somni ............................................................................... 4
1.1.1.4. Mycoplasma bovis .............................................................................. 4
1.1.1.5. Arcanobacterium pyogenes ................................................................ 5
1.1.1.6. Bibersteinia trehalosi ......................................................................... 5
1.1.1.7. BRD Associated Viruses .................................................................... 5
1.1.2. Diagnosis ................................................................................................... 7
1.1.3. Control ...................................................................................................... 7
1.2. Genus Pasteurella and P. multocida ................................................................ 9
1.2.1. Classification of P. multocida ................................................................. 12
1.2.2. Genome Sequence of P. multocida ......................................................... 13
1.2.3. Virulence Factors .................................................................................... 14
1.2.3.1. Capsule ............................................................................................. 14
1.2.3.2. Lipopolysaccharide (LPS) ................................................................ 15
xi
1.2.3.3. Toxin (PMT) .................................................................................... 16
1.2.3.4. Outer Membrane Proteins (OMPs) .................................................. 17
1.3. Evasion of Pathogens from Host Immune System ......................................... 19
1.4. Vaccine Development .................................................................................... 21
1.4.1. Live (Attenuated) Vaccines..................................................................... 23
1.4.2. Killed Whole Cell Vaccines .................................................................... 23
1.4.3. Subunit Vaccines ..................................................................................... 25
1.4.3.1. Protein Based Subunit Vaccines ...................................................... 25
1.4.3.2. Polysaccharide Based Subunit Vaccines .......................................... 26
1.4.3.3. Toxoid Vaccines............................................................................... 26
1.4.3.4. Reverse Vaccinology ....................................................................... 27
1.4.4. DNA Vaccines ........................................................................................ 28
1.4.5. Adjuvants ................................................................................................ 29
1.4.6. Development of Vaccine Strategies against P. multocida ...................... 32
1.5. The Present Study .......................................................................................... 34
2. MATERIALS AND METHODS ...................................................................... 35
2.1. Bacterial Strains and Plasmids ....................................................................... 35
2.2. Culture Media................................................................................................. 36
2.3. Solutions and Buffers ..................................................................................... 36
2.4. Chemicals and Enzymes ................................................................................ 36
2.5. Growth Conditions and Maintenance of Bacterial Strains ............................. 36
2.6. Primer Design ................................................................................................ 37
2.7. Polymerase Chain Reactions (PCR)............................................................... 38
2.8. Agarose Gel Electrophoresis .......................................................................... 39
2.9. Sequencing Reactions .................................................................................... 39
2.10. Ligation Reactions ....................................................................................... 40
2.11. Transformation of E. coli Cells .................................................................... 40
2.12. Plasmid Isolation .......................................................................................... 41
2.13. Restriction Enzyme Digestion ..................................................................... 42
2.14. Construction of Recombinant Plasmids ....................................................... 42
2.15. Transient Transfection of Mammalian Cells................................................ 42
xii
2.16. Purification of His-tagged Proteins .............................................................. 43
2.18. Determination of Protein Concentration ...................................................... 44
2.19. Sodium Dodecyl Sulphate Polyacrylamide Gel Electrophoresis (SDS-
PAGE) ................................................................................................................... 45
2.20. Coomassie Blue R-250 Staining of Polyacrylamide Gels............................ 45
2.21. Western Blot................................................................................................. 46
2.22. Experiments with Mice ................................................................................ 47
2.23. Enzyme-Linked Immunosorbent Assay (ELISA) ........................................ 49
2.24. Detection of Serum Interferon-gamma (IFN-γ) Levels ............................... 50
2.25. Statistical Analyses ...................................................................................... 51
2.26. Nucleotide Sequence Accession Numbers ................................................... 51
3. RESULTS AND DISCUSSION ....................................................................... 52
3.1. Cloning of ompH and plpE Genes ................................................................. 52
3.2. Sequence Analysis of ompH and plpE Genes from P. multocida P-1062 ..... 53
3.3. Construction of DNA Vaccines and Expression of ompH, plpEN and plpEC
Genes in Mammalian Cells ................................................................................... 59
3.4. Immune Responses against DNA Vaccines pCMV-ompH, pCMV-plpEN-
ompH and pCMV-plpEC-ompH ........................................................................... 61
3.5. Expression of plpEN-ompH and plpEC-ompH Gene Fusions in E. coli and
Optimization of Recombinant Protein Purification via Affinity Column
Chromatography .................................................................................................... 65
3.6. Immune Responses against Fusion Proteins PlpEN-OmpH and PlpEC-OmpH
............................................................................................................................... 69
3.7. Effect of Different Vaccine Adjuvants on Protectivity of PlpEC-OmpH ...... 71
3.8. Expression of ompH, plpEN, plpEC and plpE Genes in E. coli and
Purification of Recombinant Proteins ................................................................... 75
3.9. Immune Responses against Recombinant OmpH, PlpEC and PlpE .............. 78
4. CONCLUSIONS ............................................................................................... 82
REFERENCES ...................................................................................................... 85
xiii
APPENDICES
A. STRUCTURES OF PLASMID VECTORS AND SIZE MARKERS ........... 103
B. COMPOSITION AND PREPARATION OF CULTURE MEDIA ............... 106
C. SOLUTIONS AND BUFFERS ...................................................................... 108
D. SUPPLIERS OF CHEMICALS, ENZYMES AND KITS ............................ 115
CURRICULUM VITAE ..................................................................................... 118
xiv
LIST OF TABLES
TABLES
1.1. Percentages of total isolates of M. haemolytica, P. multocida, and H. somni
from the lungs of cattle at Oklahoma Animal Disease Diagnostic Laboratory
between 1994 and 2002 ........................................................................................... 9 1.2. Currently recognized taxa in the genus Pasteurella, host predilection and
diseases .................................................................................................................. 11 1.3. The major outer membrane proteins of P. multocida. ................................... 17
1.4. Factors considered in designing of a successful vaccine ............................... 22 2.1. Sources and characteristics of the bacterial strains used in this study. .......... 35
2.2. Plasmids used in cloning and expression. ...................................................... 36 2.3. Primers used in PCR.. .................................................................................... 37
2.4. PCR conditions for amplified genes. ............................................................. 38
2.5. Preparation of SDS-polyacrylamide gels. ...................................................... 46
2.6. Experimental design for Methodology I vaccination experiments. ............... 48 2.7. Experimental design for Methodology II vaccination experiments. .............. 49
3.1. Computer-aided analyses of ompH, plpEN and plpEC genes. ....................... 56
3.2. Protection conferred in mice immunized with PlpEN-OmpH or PlpEC-OmpH
protein adsorbed on alum against challenge with P. multocida A:3. .................... 71
3.3. Protection conferred in mice immunized with PlpEC-OmpH protein
formulated with the CpG, alum-CpG, oil based or oil based-CpG against
challenge with P. multocida A:3. .......................................................................... 75 3.4. Protection conferred in mice immunized with recombinant OmpH, PlpEC or
PlpE protein formulated with the oil based-CpG adjuvant against challenge with
P. multocida A:3. .................................................................................................. 79
xv
LIST OF FIGURES
FIGURES
1.1. The factors affecting BRD in cattle and the results of the disease................... 2 1.2. Clinical signs of BRD associated BRSV infection. ......................................... 6 1.3. Pneumonic lungs from a calf infected with P. multocida serotype A:3........... 6 1.4. Light micrograph of P. multocida. Colony shape of P. multocida grown on
blood agar. ............................................................................................................. 10 1.5. Schematic view of the biochemical processes related with P. multocida
pathogenicity ......................................................................................................... 13 1.6. Schematic representation of inner core structure of glycoform A and
glycoform B .......................................................................................................... 15 1.7. Scheme representing immune evasions by pathogens of the BRD complex . 20 1.8. The flow chart showing the interactions in systems biology for vaccine design
............................................................................................................................... 22
1.9. Schematic representation of 10 human TLRs and their interaction with
molecules of microbial origin. .............................................................................. 30 2.1. Calibration curve for quantification of protein concentrations. ..................... 44
2.2. Schematic representation of transfer set-up in western blot. ......................... 46
3.1. Amplification of plpE, ompH and ompHNS genes. ....................................... 52
3.2. Verification of putative colonies for cloning of plpE, ompH and ompHNS in
pGEMT via restriction enzyme digestion of plasmids. ......................................... 53 3.3. Nucleotide and amino acid sequences of ompH gene. ................................... 54
3.4. Phylogenetic relationships of OmpH sequences. ........................................... 55 3.5. Nucleotide and amino acid sequences of plpE gene. ..................................... 57
3.6. Phylogenetic relationships of PlpE sequences.. ............................................. 58 3.7. Scheme of the DNA vaccine plasmid pCMV.. .............................................. 59
3.8. In vitro expression of ompH, plpEN and plpEC in mammalian cells.. .......... 60 3.9. Total IgG levels in 1:100 diluted sera from the mice vaccinated with pCMV-
ompH DNA vaccine.. ............................................................................................ 61 3.10. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with pCMV-ompH
DNA vaccine.. ....................................................................................................... 62
3.11. Total IgG levels in 1:100 diluted sera from the mice vaccinated with pCMV-
plpEN-ompH or pCMV-plpEC-ompH DNA vaccines.. ....................................... 63 3.12. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with pCMV-
plpEN-ompH or pCMV-plpEC-ompH DNA vaccines.. ....................................... 64 3.13. Purification of PlpEN-OmpH and PlpEC-OmpH fusion proteins using Ni-
NTA columns. ....................................................................................................... 66
xvi
3.14. Purification of PlpEN-OmpH and PlpEC-OmpH fusion proteins using Ni-
TED columns under native conditions. ................................................................. 66 3.15. Effect of urea on solubilization of inclusion bodies in the cells expressing
PlpEN-OmpH or PlpEC-OmpH ............................................................................ 67 3.16. Purification of PlpEN-OmpH and PlpEC-OmpH fusion proteins using Ni-
TED columns under denaturing conditions........................................................... 67
3.17. Total IgG levels in 1:1600 diluted sera from the mice vaccinated with either
50 µg or 100 µg of PlpEN-OmpH or PlpEC-OmpH fusion proteins adsorbed on
alum adjuvant.. ...................................................................................................... 69 3.18. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with either 50 µg
or 100 µg of PlpEN-OmpH or PlpEC-OmpH fusion proteins adsorbed on alum
adjuvant.. ............................................................................................................... 70 3.19. Total IgG levels in 1:1600 diluted sera from the mice vaccinated with 100
µg of PlpEC-OmpH fusion protein formulated with CpG, alum-CpG, oil based or
oil based-CpG adjuvants. ...................................................................................... 73 3.20. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with 100 µg of
PlpEC-OmpH fusion protein formulated with CpG, alum-CpG, oil based or oil
based-CpG adjuvants ............................................................................................ 74
3.21. Purification of recombinant PlpEN, PlpEC and OmpH using Ni-TED
columns under denaturing conditions. .................................................................. 76
3.22. Purification of recombinant PlpE using Ni-TED columns under standard
conditions.. ............................................................................................................ 77 3.23. Purification of recombinant PlpE using Ni-NTA columns under optimized
conditions.. ............................................................................................................ 77
3.24. Total IgG levels in 1:1600 diluted sera from the mice vaccinated with 100
µg of recombinant OmpH, PlpEC and PlpE formulated with oil based-CpG
adjuvant.. ............................................................................................................... 78
3.25. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with 100 µg of
recombinant OmpH, PlpEC and PlpE formulated with oil based-CpG adjuvant.. 79
A1. pGEM®-T Easy Cloning Vector ................................................................... 103
A2. pCMV-LII DNA Vaccine Vector ................................................................. 104
A3. pET-28a(+) His-tag Expression Vector ....................................................... 104 A4. PageRuler
™ Plus Prestained Protein Ladder and Unstained Protein Molecular
Weight Marker .................................................................................................... 105
A5. Lambda DNA/PstI Marker ........................................................................... 105
xvii
LIST OF ABBREVIATIONS
OmpH Outer membrane protein H
PlpE Pasteurella lipoprotein E
PlpEN Amino terminal of PlpE
PlpEC Carboxyl terminal of PlpE
GFP Green fluorescent protein
bp(s) Base pair(s)
HEK Human embryonic kidney
BRD Bovine respiratory disease
LPS Lipopolysaccharide
LD Lethal dose
IPTG Isopropyl-β-D-thio-galactoside
ELISA Enzyme-linked immunosorbent assay
i.m. Intramuscular
i.p. Intraperitoneal
s.c. Subcutaneous
IgG Immunoglobulin G
IFN-γ Interferon gamma
ATCC American Type Culture Collection
1
CHAPTER 1
INTRODUCTION
1.1. Bovine Respiratory Disease
1.1.1. Etiology
Bovine respiratory disease (BRD) has been one of the most serious problems in
cattle industry causing high mortality (1.5-4.2%) and economic loss (almost $1
billion per year in US) in calves. BRD is related with stressful conditions in
commingling and transportation of cattle like dust, dampness, fatigue, injury,
hunger, dehydration, anxiety, irritant gases, and adverse weather conditions (heat,
cold) coupled with bacterial and viral infections (Figure 1.1). Since transportation
is the most universally accepted non-infectious risk factor for BRD, the disease is
also known as shipping fever (Bagley, 1997; Welsh et al., 2004; Cho et al., 2008;
Wildman et al., 2008; Angen et al., 2009; Taylor et al., 2010).
Bacterial pathogens associated with BRD complex are Mannheimia haemolytica
(formerly Pasteurella haemolytica), Pasteurella multocida, Histophilus somni
(formerly Haemophilus somnus), Mycoplasma bovis and Arcanobacterium
pyogenes (formerly Actinomyces pyogenes) and most recently Bibersteinia
trehalosi (formerly Pasteurella trehalosi) (Welsh et al., 2004; Cho et al., 2008;
Confer, 2009).
2
Figure 1.1. The factors affecting BRD in cattle and the results of the disease. (+):
factors decreasing the incidence; (−): factors increasing the incidence; (?): factors
not fully understood according to the available data. BVD: bovine viral diarrhea
virus (Duff and Galyean, 2007).
1.1.1.1. Mannheimia haemolytica
Gram negative bacterium M. haemolytica is a pathogen of both ovine and bovine
(Michael et al., 2011). Among the bacteria associated with BRD, it is the most
important and commonly isolated pathogen from fatal cases of shipping fever
pneumonia in cattle (Confer et al., 2006). M. haemolytica is often found in the
upper respiratory tract of healthy cattle. After a viral infection and stress factors, it
migrates to the lungs and multiplies rapidly. Major virulence factors are outer
membrane proteins (adhesins), lipopolysaccharide (LPS), leukotoxin (Lkt), and
iron-binding proteins. The immunosuppressive effects of M. haemolytica occur
via secretion of the pro-inflammatory cytokines (IL-8, IL-1β and TNF-α) by
alveolar macrophages after LPS stimulation (Srikumaran et al., 2007; Confer,
3
2009). Serotype specificity mostly comes from capsular lipopolysaccharides
(CPS) but LPS related antigenic determinants were also observed (Michael et al.,
2011). Of the M. haemolytica serotypes isolated from bovine, 65% belongs to S1
(serotype 1) and approximately 35% are S2 and S6. Majority of ovine isolates
belongs to S2. Although a number of commercial vaccines for M. haemolytica S1
are in the market, their efficacy was shown to be approximately 50% in field
studies. A combination that increases antibodies both to Lkt and a cell surface
target would be the most effective vaccine against M. haemolytica (Ayalew et al.,
2008; Michael et al., 2011). Ayalew et al. (2008) obtained a chimeric protein
composed of immunogenic regions of Lkt A and an outer membrane protein PlpE
(Pasteurella lipoprotein E) from M. haemolytica. The immune responses were
elevated in the mice vaccinated with these fusion proteins and the hyperimmune
sera were able to kill the pathogen.
1.1.1.2. Pasteurella multocida
P. multocida is the etiological agent of a wide range of animal diseases like
pneumonia in cattle and sheep, atrophic rhinitis in swine, hemorrhagic septicemia
in buffalo and cattle, and fowl cholera in chicken (Chung et al., 2005; Atashpaz et
al., 2009). It has been also isolated both from healthy animals as a member of the
oropharyngeal flora of calves and does not cause a serious disease but, in stress
conditions, it is one of the bacterial pathogens associated with BRD complex
(Ishiguro et al., 2005; Boyce et al., 2010). P. multocida strains are classified in
five capsular serogroups (A, B, D, E and F) and 16 somatic LPS serotypes (1-16).
Serogroup A, predominantly serotype A:3, causes severe pneumonia in young
feedlot calves (Dabo et al., 2008b). Detailed information about P. multocida will
be given in Section 1.2.
4
1.1.1.3. Histophilus somni
H. somni is the causative agent of pneumonia, septicemia, myocarditis, arthritis,
thrombotic meningoencephalitis and reproductive failure in cattle and other
ruminants (Geertsema et al., 2011). H. somni infections result in cranioventral
fibrinous pleuropneumonia with hemorrhage and coagulation necrosis, and the
gross lesions are similar to those observed with M. haemolytica.
Lipooligosaccharide (LOS) and various outer membrane proteins (OMPs) are the
virulence factors of H. somni. LOS assists bacterium to escape the host immune
response and OMPs are responsible for resistance to complement-mediated serum
killing (Confer, 2009). Geertsema et al. (2011) showed that DR2 subunit of 270
kDa surface protein IbpA (immunoglobulin binding protein A) is a protective
antigen of H. somni.
1.1.1.4. Mycoplasma bovis
M. bovis causes pneumonia, arthritis, otitis, conjunctivitis and mastitis in cattle. It
may also be a predisposing factor leading to the invasion of other bacteria or
viruses via weakening the host immune system (Soehnlen et al., 2011a). Often the
importance of M. bovis in BRD has been underestimated but it is widespread
within the infected cattle population and cause high economic loss in feedlot
animals (Cho et al., 2008). It is an extracellular pathogen living on the surface of
respiratory epithelial cells and causes cranioventral caseonecrotic
bronchopneumonia with abscesses, bronchiectasis and sequestration. Surface
proteins and toxin take role in virulence of M. bovis. Phenotypic variation among
strains is due to variable surface proteins (VSPs) which act as adhesins.
Transmission mostly occurs through direct contact with infected animals (Confer,
2009). Since it does not have a cell wall, antimicrobials such as β-lactam
antibiotics targeting that region are not effective against M. bovis. Resistance for
spectinomycin, tilmicosin and tetracycline has been also reported (Soehnlen et al.,
2011b).
5
1.1.1.5. Arcanobacterium pyogenes
A. pyogenes is the causative agent of mastitis, abortion and a variety of pyogenic
infections in domestic ruminants and pigs (Ülbegi-Mohyla et al., 2010). It is one
of the secondary invaders of a lung which is already infected by other pathogens,
and causes chronic abscessing pneumonia characterized by liquefactive necrosis
surrounded by a thick fibrous connective tissue. A. pyogenes may survive and
become the predominant nasopharyngeal isolate after BRD treatment in cattle.
Virulence factors are collagen-binding protein (CbpA), pyolysin, and adhesins.
(Confer, 2009).
1.1.1.6. Bibersteinia trehalosi
B. trehalosi was previously named as Pasteurella haemolytica together with M.
haemolytica but Blackall et al. (2007) reclassified it in a new genus, Bibersteinia
and described the species as “catalase and oxidase-negative, weak haemolysis on
bovine blood agar, CAMP-positive, weak growth on MacConkey agar, yellowish
pigment, production of acid from cellobiose, raffinose, aesculin, amygdalin,
arbutin, gentiobiose and salicin, no acid production from glycerol and myo-
inositol”. It is known to cause severe systemic infections and pneumonia in sheep.
Recently, this pathogen has also been reported in cattle pneumonia (Confer,
2009).
1.1.1.7. BRD Associated Viruses
There are also BRD associated viral agents including bovine viral diarrhea virus
(BVDV), bovine respiratory syncytial virus (BRSV), bovine herpes virus-1
(BHV-1), parainfluenza 3 virus (PI3V), and infectious bovine rhinotracheitis virus
(IBRV) (Wildman et al., 2008; Taylor et al., 2010a). Viral infections occur via
nose to nose contact or aerosols in a short distance. Later, the ciliated epithelium
in trachea is lysed and the housekeeping functions of the mucocilliary escalator
6
are disrupted. Therefore, clearance of bacteria from the upperways fails and the
bacteria deposit in alveoli (Ellis, 2009). Figure 1.2 shows the clinical signs of
BRD on a calf infected with BRSV.
Figure 1.2. Clinical signs of BRD associated BRSV infection (http://homepage.
usask.ca/~vim458/virology/studpages2009/VirusWebsite/brsv.html).
Figure 1.3. Pneumonic lungs from a calf infected with P. multocida serotype A:3
(Dowling et al., 2002).
7
1.1.2. Diagnosis
Diagnosis of the pathogens associated with BRD is difficult antemortem
especially in the presence of a prior treatment (Taylor et al., 2010a) but gross
necropsy and histopathological lesions may help to identify the primary bacterial
agent. Although necropsy results are not very representative for initiating agent
since it takes several days to weeks from disease onset to death, certain
microorganisms may be diagnosed antemortem. For instance, chronic respiratory
disease studies on feedlot cattle showed that M. bovis infections result in lack of
weight gain and do not respond treatment. However, distinguishing features of H.
somni infections are not very clear if other systems are not affected. Clinical signs
to characterize a disease as a BRD include increased body temperature,
respiratory tract problems (cough, nasal discharge, dyspnea, or tachypnea),
depression, and decreased appetite (Taylor et al., 2010b).
BRD can be divided into three main categories (Bagley, 1997):
I. Upper respiratory tract infections: the symptoms are inflammation of the
nostrils, pharynx and trachea, coughing, nasal discharge, fever and loss of
appetite.
II. Diphtheria: clinical signs are load noises during breathing, and swelling which
may cause death of the animal by restricting air flow.
III. Lower respiratory tract infection (pneumonia): the infection of the lung may
occur due to either migration of the pathogens from the upper respiratory tract or
the failure of protection mechanisms which protect lung against infections.
Pneumonia is more severe and serious than upper respiratory tract infections.
Figure 1.3 shows pneumonic lungs of a calf infected with P. multocida.
1.1.3. Control
Young dairy calves considered at high risk for BRD are more likely vaccinated.
However, there are some limitations of vaccination against BRD. Antibody titers
8
may not always be sufficient for protection. Also, timing of the administration is
important because stressed calves may not respond to the vaccine appropriately;
there is an increased susceptibility to all BRD related pathogens. Vaccination
against viral pathogens is more common than against bacterial pathogens because
of the higher efficacy (Welsh et al., 2004; Taylor et al, 2010b). Vista® 5 SQ
(Intervet Inc. Millsboro, Delaware) is a Modified Live Vaccine (MLV) containing
BVDV (Type 1a and 2), BRSV, PI3V and IBRV. Xue et al. (2011) demonstrated
that 96% of the heifers vaccinated with Vista® 5 SQ were protected from BVDV
Type 1b although the MLV contains Type 1a and 2. Coopers Inc. (New South
Wales, Australia) produces vaccines Bovilis® MH against M. haemolytica and
Bovilis® MH+IBR against both M. haemolytica and IBRV.
Preconditioning programs are also practiced in order to prepare the animals for
shipment by spreading the stress factors in multiple episodes. These applications
include vaccination, weaning, and training of the cattle to drink from a trough and
eat from a bunk. Vaccination at preconditioning is important for calves to have
time for development of antibodies (Taylor et al, 2010b).
Aggressive antimicrobials, tilmicosin, florfenicol, ceftiofur, and enrofloxacin, are
used either single or in combination for the control and/or treatment of BRD.
Resistance and susceptibility for these antibiotics should be analyzed periodically.
The percentage of isolations and the antibiotic susceptibilities of M. haemolytica,
P. multocida, and H. somni isolated from the lungs of 6-18-month-old cattle with
pneumonia between 1994 and 2002 were shown in Table 1.1. Antimicrobial
susceptibilities were significantly decreased for M. haemolytica for erythromycin,
florfenicol, spectinomycin, and tilmicosin. Susceptibilities for erythromycin,
spectinomycin, florfenicol, tetracycline, sulfachloropyridizine, trimethoprim-
sulfamethoxazole, and tilmicosin were significantly declined for P. multocida.
Spectinomycin and sulfachloropyridizine susceptibilities for H. somni were
variable (Welsh et al., 2004).
9
Table 1.1. Percentages of total isolates of M. haemolytica, P. multocida, and H.
somni from the lungs of cattle at Oklahoma Animal Disease Diagnostic
Laboratory between 1994 and 2002 (Welsh et al., 2004).
M. haemolytica (%) P. multocida (%) H. somni (%)
1994 62.5 20.0 17.5
1995 58.0 23.9 18.1
1996 64.1 28.2 7.7
1997 50.8 32.3 16.9
1998 30.6 28.6 40.8
1999 40.5 36.5 23.0
2000 35.7 47.4 16.9
2001 44.3 37.1 18.6
2002 50.4 32.4 17.3
Total 46.3 34.7 19.0
1.2. Genus Pasteurella and P. multocida
The first scientific name for the causative agent of fowl cholera and hemorrhagic
septicemia was Micrococcus gallicidus, Burrill 1883. Later, the generic name
Pasteurella was proposed by Trevisan in 1887 to commemorate the work of Luis
Pasteur on this microorganism. Many species names were assigned for the genus
Pasteurella according to their bipolar staining or host organism. In 1939,
Rosenbusch and Merchant used multocida epithet which was first used by Kitt in
1893 for “Bacterium bipolare multocidum” and by Lehmann and Neumann in
1899 for “Bacterium multocidium” (Mutters et al., 1985). Epithet gallicida was
also used for this bacterium but Judicial Commission of the International
Committee on Systematic Bacteriology requested the use of name Pasteurella
multocida instead of P. gallicida since this species has the same type strain
(NCTC 10322) as P. multocida in the Approved Lists (Sneath, 1982).
10
Pasteurella are defined as Gram negative, non-motile and facultative anaerobic
bacteria in Bergey’s Manual of Determinative Bacteriology. Bipolar staining is
observed in the tissue preparations from infected animals. Spherical, ovoid, or
rod-shaped cells are 0.3-1.0 µm in diameter and 1.0-2.0 µm in length growing
optimum at 37oC (Figure 1.4 A). Their biochemical activities are oxidase and
catalase positive, fermenting glucose and other sugars with the production of acid
but not gas. Rich media containing ruminant blood (Figure 1.4 B) and brain heart
infusion can be used to culture Pasteurella but not MacConkey agar or Simmons
citrate medium. The members of genus Pasteurella are generally found in the
oropharyngeal flora of many vertebrates but it is also a parasitic or commensal
microorganism found on the mucous membranes of the upper respiratory and
digestive tracts of birds and mammals causing many diseases that are of
significant economic importance to livestock industries (Bergey and Holt, 2000;
Boyce et al., 2010) Table 1.2 shows the classification of genus Pasteurella and
their pathogenicity.
Figure 1.4. Light micrograph of P. multocida (A). Darkfield lighting,
magnification of 800X at 35 mm size (Abbey, M., http://www.sciencephoto.com/
media/11568/ view). Colony shape of P. multocida grown on blood agar (B)
(http://www.gefor.4t.com/bacteriologia/ pasteurellamultocida.html).
A B A
11
Table 1.2. Currently recognized taxa in the genus Pasteurella, host predilection
and diseases (Boyce et al., 2010).
Species Hosts Association/diseases (common serotypes)
P. multocida
subsp.
multocida,
gallicida, and
septica
Birds,
mammals
FC of birds (A, F, rarely D)
Bovine pneumonia (A:3)
AR of pigs (toxigenic serotypes A and D)
HS of ungulates (B:2; B:2,5; E:2; E:2,5)
Bite wound-associated infection in human
P. dagmatis Dogs Normal flora in dogs. Cause a range of
zoonotic infections in humans
P. canis Cats and dogs
Cattle and
sheep?
Normal flora in cats and dogs. Cause a
range of mostly bite wound-associated
infections in humans.
Pneumonia in cattle and sheep?
P. stomatis Cats and dogs Normal flora in cats and dogs. Cause a
range of mostly bite wound-associated
infections in humans.
[P]. aerogenes* Pigs Sepsis, diarrhea and pneumonia
[P]. bettyae* Humans Genitourinary infections
[P]. caballi* Horses, pigs Respiratory infections
[P].langaaensis* Birds Normal flora of respiratory tract
[P].
pneumotropica*
Cats, dogs,
rodents
Pneumonia and various suppurative
infections in rodents
[P]. mairii* Pigs Isolated from pig reproductive tract and
associated with abortions
[P]. skyensis* Fish Fatal infections in Atlantic salmon
[P]. testudinis* Tortoises Respiratory disease in tortoises
* While these species are currently valid within the Pasteurella genus, genomic
data suggest that they are not part of the Pasteurella sensu stricto group and that
they will be moved to new genera in the future.
12
1.2.1. Classification of P. multocida
Currently two methods are being used for classification of P. multocida. First one
is passive hemagglutination test developed by Carter (1952). In this test
erythrocytes are sensitized with capsular antigens that recognize five serogroups
(A, B, D, E and F) according to capsular polysaccharides. Genetic and structural
studies showed that the bacteria belonging to each serotype express distinct
polysaccharides on their capsules (Boyce et al., 2010). Serogroup A causes fowl
cholera in avian species and enzootic bronchopneumonia or pneumonic
pasteurellosis in bovine. In pigs, atrophic rhinitis and pneumonia are associated
primarily with toxigenic strains of serogroup D and serogroup A, respectively.
Serogroups B and E are associated with hemorrhagic septicemia in ungulates.
Serogroup F strains are predominantly isolated from diseased poultry, in
particular, turkeys and more recently from a fatal case of fibrinous peritonitis in
calves (Catry et al., 2005; Al-Hasani et al., 2007; Lee et al., 2007; Dabo et al.,
2008b). Human infections with P. multocida largely arise from the bite of an
infected carnivore, but other types of infections are occasionally reported (Wu et
al., 2007).
Agglutination (serum/plate agglutination or indirect/passive hemagglutination)
tests have some disadvantages for classification of P. multocida like:
I) Inability of encapsulated cells to agglutinate without treatment.
II) The lack of antigens for hemagglutination on cells which are not encapsulated.
III) Cross reactions among strains (Heddleston et al., 1972).
Therefore, the second test for serotyping, gel diffusion precipitin method was
developed by Heddleston et al. (1972) in which a precipitate is formed upon
antigen-antibody reaction according to lipopolysaccharide (LPS) antigen
recognizing 16 somatic serotypes (1–16). Recent studies have revealed that LPS
layers in each Heddleston serotypes are structurally different from each other
(Boyce et al., 2010).
13
Both of these tests are used for the standard classification of P. multocida. First
capsule, then the LPS type is stated, e.g. A:3 shows capsular type A and LPS type
3. However, since these methods are laborious and require specific antisera which
are difficult to obtain, genetic typing techniques have been developed for more
accurate classification of P. multocida (Boyce et al., 2010).
Figure 1.5. Schematic view of the biochemical processes related with P.
multocida pathogenicity (May et al., 2001).
1.2.2. Genome Sequence of P. multocida
Genome sequence of an avian isolate of P. multocida strain Pm70 serotype A:3
was published by May et al. in 2001. The genome consists of 2,257,487 base pairs
in length and predicted to contain 2,014 coding sequences (CDSs), 200 (10%)
being unique to P. multocida, six rRNA operons and 57 tRNAs representing all 20
14
amino acids. Complete sets of enzymes are encoded for the pathways of Entner–
Doudoroff, oxidative pentose phosphate, trichloroacetic acid (TCA) cycle,
glycolysis and gluconeogenesis. 104 putative virulence-associated genes (ca. 7%
of coding density) were identified. Two genes (pfhB1 and pfhB2) were related
with filamentous hemagglutinin. 53 CDSs (more than 2.5% of the genome) were
associated with proteins taking role in iron uptake or acquisition (May et al.,
2001). A schematic view of the biochemical processes taking role in P. multocida
pathogenicity was shown in Figure 1.5.
1.2.3. Virulence Factors
The major virulence factors of P. multocida are capsule, lipopolysaccharide
(LPS), toxin (PMT), outer membrane proteins (OMPs), adhesins and type IV
fimbriae (pili) (Harper et al., 2006).
1.2.3.1. Capsule
Capsule is a highly hydrated polysaccharide protecting the bacterium against
phagocytosis and desiccation, and takes role in the bactericidal activity of serum
complement. P. multocida strains are classified in five (A, B, D, E and F)
serogroups with respect to their capsular antigens (Chung et al., 2001). Generally,
bacterial strains having a capsule are more virulent than their variants lacking the
capsule (Harper et al., 2006). Acapsular cexA::tet strain of P. multocida was
removed from blood, liver and spleen after i.p. challenge of mice yet wild-type
bacteria multiplied rapidly (Boyce and Adler, 2000). Similarly, Chung et al.
(2001) demonstrated that acapsular hexA::tet (M) strain of P. multocida A:1
(PBA930) was attenuated in both mice and chickens. This acapsular strain was
sensitive to bactericidal action of the chicken serum. Mice vaccinated i.m. with
PBA930 were cross-protected against A:1 and A:3 strains but s.c. or i.p.
vaccinations did not confer any protection (Chung et al., 2005). Acapsular strains
may be derived from the capsular strains via repeated passage of the bacteria in
15
the laboratory (Watt et al., 2003). Mutation in fis gene also resulted in loss of
capsule formation and the expression of other virulence factors FHA and PlpE
were down-regulated (Steen et al., 2010).
1.2.3.2. Lipopolysaccharide (LPS)
In Gram negative bacteria, LPS is an integral component of the outer membrane
and in some species, incorporation of lipid A is essential for cell survival. In P.
multocida, there are two LPS types, glycoform A and B, which have the same
outer core but differ in inner core structure (Figure 1.6).
Figure 1.6. Schematic representation of inner core structure of glycoform A (A)
and glycoform B (B). Glc: glucose, Hep: heptose, P: phosphate, Kdo: 3-deoxy-D-
mannooctulosonate, PEtn: phosphoethanolamine (Harper et al., 2011).
LPS is an important virulence factor that interacts directly with the innate immune
system and induces cellular immune response via toll-like receptor TLR4 (Harper
et al., 2011). If the host response fails to clear the bacteria and the infection
proceeds, accumulation of high amounts of systemic LPS can cause endotoxic
shock, and overproduced inflammatory mediators end up with tissue damage,
organ failure, septic shock, and death (Harper et al., 2004). LPS is the major
antigen related with the serotypic classification of P. multocida. According to the
16
antibody responses to LPS, P. multocida strains are classified in 16 serotypes
(Adler et al., 1999). Harper et al. (2003) showed that dcaA mutant of P. multocida
was attenuated in mice and chicken due to impaired LPS structure. It is also
responsible for the cross protection between serovars 3 and 4 and serovars 2 and 5
(Harper et al., 2011).
1.2.3.3. Toxin (PMT)
Pasteurella multocida toxin (PMT) is encoded by toxA gene in some strains of
serogroup A and D causing progressive atrophic rhinitis (PAR) in pigs (Seo et al.,
2009) characterized by nasal haemorrhage, bone atrophy and shortening or
distortion of snout (Takada-Iwao et al., 2007). PMT is a mitogen for fibroblasts
and osteoblasts stimulating G protein families Gq and G12/13, and activator of
phospholipase Cβ (Busch et al., 2001; Pullinger and Lax, 2007; Preuß et al.,
2009). PMT elevates diacylglycerol and inositol 1,4,5-triphosphate levels, protein
kinase C activation and Ca2+
mobilization in the treated cells (Miyazawa et al.,
2006). Monomeric 146-kDa protein PMT is composed of 1285 amino acids. N
terminus (amino acids 1 to 506) located at the surface and contains cell-binding
domain whereas C terminus (amino acids 681 to 1285) contains active site with a
mixed α/β domain (Pullinger et al., 2001). There are protection studies with
mutant forms of PMT against PAR (Petersen et al., 1991; Seo et al., 2009),
however, PMT constitutes only ca. 0.6% of the total bacterial proteins, so toxoid
vaccines are not economically efficient (Hsuan et al., 2009). Therefore, new
vaccine formulations have been studied such as Bordetella bronchiseptica and P.
multocida bacterin-toxoid (Sakano et al., 1997) or P. multocida bacterin-toxoid
(Hsuan et al., 2009).
17
1.2.3.4. Outer Membrane Proteins (OMPs)
The outer membrane proteins (OMPs) of the Gram-negative bacteria are
important for the interaction with the extracellular environment. OMPs take role
in membrane stability and the transport of various molecules. Non-specific
diffusion of solutes and transport of specific ligands are carried out by porins
(Boyce et al., 2006). The major OMPs of P. multocida are shown in Table 1.3.
Table 1.3. The major outer membrane proteins of P. multocida.
Designation Definition Reference
OmpH Outer membrane protein H Luo et al., 1997
OmpA Outer membrane protein A Dabo et al., 2003
Omp16 16 kDa outer membrane protein Goswami et al., 2004
PlpE Pasteurella lipoprotein E Wu et al., 2007
PlpB Pasteurella lipoprotein B Chomnawang et al., 2009
Oma87 87 kDa outer membrane antigen Ruffalo and Adler, 1996
PCP Peptidoglycan associated
lipoprotein cross-reacting protein Tabatabai, 2008
GlpQ Periplasmic glycerophosphodiester
phosphodiesterase Tabatabai, 2008
LctP Lactate permease P Tabatabai, 2008
RfaF Heptosyl transferase F Tabatabai, 2008
HemR Heme–hemopexin receptor protein Tabatabai, 2008
There are protection studies on OMPs of P. multocida. OmpH from P. multocida
B:2 conferred 100% protection in i.p. vaccinated mice but the protection was 80%
in s.c. vaccinated animals against challenge with lethal dose of the pathogen (Tan
18
et al., 2010). Lee et al. (2007) reported that recombinant OmpH from a swine
isolate of P. multocida protected 70% of vaccinated mice. Antisera raised in
rabbits against recombinant Oma87 protein protected mice against lethal dose of
P. multocida A:1 (Ruffalo and Adler, 1996) however, fusion of F1 fragment of
Oma87 and GST did not confer any protection in chicken (Mitchison et al., 2000).
Recombinant OmpA induced Th2-type immune response but did not protect the
mice (Dabo et al., 2008a). Wu et al. (2007) demonstrated that recombinant PlpE
from P. multocida A:1 cross-protected mice and chickens against challenge with
A:1, A:3 and A:4 serotypes, however, protection capacity of PlpB was not that
high (Wu et al., 2007; Chomnawang et al., 2009).
Iron uptake from the environment is also important for the pathogenesis of
bacteria because iron is one of the factors regulating the expression of the
virulence genes (Puchalski et al., 2010). Therefore, iron regulated outer
membrane proteins (IROMPs) of P. multocida are also mentioned among
virulence factors (Garrido et al., 2008; Puchalski et al., 2010). As discussed
earlier, more than 2.5% of P. multocida genome codes for proteins related with
uptake or acquisition (May et al., 2001). They have cross-protection capability.
Garrido et al. (2008) reported that a fur (ferric uptake regulator) mutant of P.
multocida (serogroup A, ovine isolate) expressing high levels of IROMP
conferred cross-protection in mice.
Attachment to host cells or extracellular matrix is important in bacterial
infections. Hence, the proteins that mediate this adherence, namely adhesins, are
potentially immunogenic (Hatfaludi et al., 2010). 39 kDa adhesin, Cp39, in crude
capsular extract of P. multocida was shown to be cross-protective among
serogroup A strains (Sthitmatee et al., 2008). Type IV fimbriae (pili) are long,
filamentous structures in many Gram-negative bacteria and they also take role in
attachment (Hatfaludi et al., 2010). Mohd Yasin et al. (2011) vaccinated goats
with inactivated recombinant E. coli expressing fimbrial protein of P. multocida
B:2 and showed the increase in antibody levels and decrease in the colonization of
19
pathogen after intratracheal challenge. Fuller et al. (2000) identified pfhaB1 and
pfhaB2 among the virulence genes of P. multocida. These genes were predicted to
encode filamentous hemagglutinin-like proteins taking role in colonization and
adherence. Inactivation of pfhaB2 in an avian isolate of P. multocida (A:3) caused
attenuation of the strain in turkeys after intranasal challenge (Tatum et al., 2005).
1.3. Evasion of Pathogens from Host Immune System
The two arms of immune responses are innate and adaptive immunity.
Physiological barriers such as skin and mucosal surfaces, tears, normal intestinal
flora are the parts of innate immune system found in all multicellular organisms.
Macrophages, dendritic cells (DCs), natural killer (NK) cells and neutrophils are
the key cellular components. Complement system and the early cytokines are the
other key parts of innate immune response. On the other hand, adaptive immune
system is constituted by B and T lymphocytes. T cells produce cytokines specific
to epitopes of antigens which are presented by B cells, macrophages and DCs.
Hence, innate and adaptive immune responses work together.
T cells are divided into T helper (Th, express CD4, respond MHC class II) and T
cytotoxic (Tc, express CD8, respond MHC class I) cells. In response to the
antigens, Th cells secrete cytokines and B cells are differentiated into memory B
cells and plasma cells secreting the antibodies, and Tc cells are differentiated into
memory Tc cells and effector Tc cells. Secreted antibodies form humoral
immunity; on the other hand, cell-mediated immunity is formed by Tc cells
against intracellular parasites or by NK cells via antibody-dependent cellular
cytotoxicity for extracellular parasites (Srikumaran et al., 2007; Elgert, 2009).
Despite these protection systems, microbial infections still occur because
pathogens develop ways to evade host immunity. A schematic view of immune
evasion pathways of BRD associated pathogens was shown in Figure 1.7. The
first line of invasion is epithelium and mucosal membranes. BHV-1 infects the
epithelial cells of upper respiratory tract resulting in necrosis of epithelium and
20
adjacent lymphoid tissue. This damage favors bacterial pathogens such as M.
haemolytica to migrate and colonize in lower respiratory tract.
Figure 1.7. Scheme representing immune evasions by pathogens of the BRD
complex (Srikumaran et al., 2007).
21
M. haemolytica produces leukotoxin (Lkt) which are cytolytic to leukocytes and
evades from phagocytosis, a second barrier. PI3V and H. somni are capable of
inhibiting the production of superoxide by alveolar macrophages without
damaging the cells thus evade from intracellular killing. BHV-1 causes apoptosis
in epithelial cells of upper respiratory tract but undergoes a latent infection in
sensory neurons by the production of latency-related (LR) RNA. M. haemolytica,
M. bovis, BVDV, BRSV and BHV-1 suppress the proliferation of lymphocytes.
BVDV also induces apoptosis of T and B cells or may induce immune tolerance
via inhibition of IFN-γ induction. For evasion from humoral response, M.
haemolytica Lkt down-regulates the expression of MHC class II molecules and H.
somni blocks binding of immunoglobulins. On the other hand, BHV-1 escapes
from Tc cells via down-regulating expression of MHC class I molecules through
inhibition of host cell protein synthesis with vhs (virion host shot-off) protein.
Many pathogens evade immune responses by rapidly changing the structure of
their antigenic surface proteins. For instance, H. somni undergoes an antigenic
phase variation in its lipooligosaccharide (LOS) components (Srikumaran et al.,
2007).
1.4. Vaccine Development
The term “vaccine” was derived by Edward Jenner from his less dangerous
vaccine strain Variolae vaccinae (cowpox virus) adapted from vaccinus (vacca,
cow). Still some of the veterinary vaccines are produced using the same
technology introduced by E. Jenner on live vaccines in 1796 and L. Pasteur on
killed whole cell vaccines. On the other hand, recent developments in systems
biology brought new approaches to vaccine design (Adams et al., 2011). Figure
1.8 shows a flow chart on interactions in systems biology for vaccine
development. The basic factors that should be considered in design of a successful
vaccine are efficacy, safety and the characteristics of the pathogen as summarized
in Table 1.4 (Mak and Saunders, 2008). Vaccine types can be categorized as live
(attenuated), killed (whole cell), subunit and DNA vaccines.
22
Figure 1.8. The flow chart showing the interactions in systems biology for
vaccine design (Adams et al., 2011).
Table 1.4. Factors considered in designing of a successful vaccine (Mak and
Saunders, 2008).
Characteristic Description
Efficacy Induction of appropriate immune responses to eliminate the
pathogen
The coverage (percentage of vaccinated individuals
protected from the disease) should be 80-95%
Safety No risk to cause a disease.
Detrimental side effects should be very few
Pathogen Causing an acute rather than chronic infection
Induction of immunity after exposure
Antigenic variation should be little
No attack to the cells of the immune system
Not having an environmental or animal reservoir
23
1.4.1. Live (Attenuated) Vaccines
As its name implies, a live vaccine is developed using an infectious agent that is
still alive but has been somehow weakened (attenuated) not to cause a disease.
The most effective viral vaccines are live vaccines attenuated via either heating,
continuous passage in tissue culture/animal host, or genetic modifications. A
natural pathogen in another host can also be used, e.g. E. Jenner used cowpox
virus against smallpox disease in human (Ada, 2003; Lund et al., 2005; Arnon,
2011).
The vaccine agent has the same broad spectrum of antigens as the pathogen and
since it is able to replicate in the host, exists for longer periods than killed vaccine
agent, hence, provides more effective and long lasting immunity generating both
humoral and cell-mediated responses. On the other hand, rarely the vaccine agent
may revert back and gain pathogenicity or in immune deficient patients even the
attenuated form may cause serious infections. Usually, fewer than two per million
cases occur annually among vaccinated people (Arnon, 2011).
A successful example of live vaccines is the Bacille Calmette-Guérin (BCG)
against tuberculosis. The vaccine was developed via over 200 subculturing of the
pathogen by Albert Calmette and Camille Guérin between 1905 and 1921 at
Pasteur Institutes in France and started to be used internationally after 1927
(Bonah, 2005; Arnon, 2011).
1.4.2. Killed Whole Cell Vaccines
A killed vaccine contains an organism (a whole bacterium, parasite or virus) that
is antigenically intact, but lost the ability of replication or induction of any clinical
disease due to the inactivation through heat, gamma irradiation or chemicals such
as formaldehyde (formalin), alcohol or alkylating agents (Mak and Saunders,
2008; Day and Schultz, 2011).
24
Killed vaccines are safer but less effective than live vaccines. If the pathogen is
killed properly, it is unable to revert back but the killing process may damage
some of the antigens. As the vaccine agent cannot replicate, it is cleared from the
body quickly, thus it does not induce the immune responses as well as live
organism (Arnon, 2011) and larger amounts of the vaccine should be administered
in the primary dose that raises the cost. A weaker response to a given dose is
obtained, so frequent boosters are needed (Mak and Saunders, 2008). Most of the
killed vaccines require an adjuvant for an adequate immune response. Generally
adjuvanted vaccines are considered more likely to have an adverse effect (Day
and Schultz, 2011).
Killed vaccines provide better protection than an isolated compartment of the
organism. They activate a high inflammatory response inducing an effective
antigen presentation by DCs. However, sometimes this may cause side effects like
fever, local pain and allergic reactions (Arnon, 2011). Since the vaccine agent is
dead it cannot effectively penetrate the host cells. Therefore, they generally induce
high levels of neutralizing antibodies but not MHC class I- restricted cytotoxic T-
cell (Tc) response. As a result, killed vaccines are not very effective against
intracellular pathogens (Ada, 2003; Mak and Saunders, 2008).
In spite of the mentioned drawbacks, killed viral vaccines against influenza,
Hepatitis type A, Salk polio and Japanese Encephalitis are wide in use.
Preparation of killed whole cell vaccine is easier and less time consuming as well
as its safety. These advantages are sometimes very crucial when a vaccine is
needed in case of a pandemic disease like H5N1 avian influenza in 2005 and
H1N1 influenza in 2009. Bacterial killed vaccines in use for human health are
against pertussis (Bordetella pertussis) and cholera (Vibrio cholera). Studies still
proceed to develop an acellular vaccine against pertussis and a toxoid-bacterin
vaccine against cholera (Arnon, 2011).
25
1.4.3. Subunit Vaccines
Subunit vaccines contain specific immunogenic structural proteins or metabolites
obtained from the pathogen instead of the entire intact organism. Therefore, they
are very safe lacking the risk of reversion or any possible side effects resulting
from irrelevant compartments of the pathogen (Mak and Saunders, 2008; Day and
Schultz, 2011).
1.4.3.1. Protein Based Subunit Vaccines
Some of the proteins for subunit vaccine production are prepared using
conventional purification processes which are very laborious, less effective and
increase the cost. Recombinant DNA technology greatly facilitated the vaccine
development for pathogens that are very difficult or impossible to grow in vitro
and/or whose components are very problematic to purify in sufficient amounts.
The gene encoding the antigen is cloned on a vector and introduced to a yeast or
bacterial host such as E. coli. Recombinant microorganisms are cultured in high
volumes in the laboratory and the expression of desired protein is induced using
different techniques such as IPTG induction. Protein of interest can easily be
isolated from the other proteins of the recombinant organism. However, the host
organism may alter the three dimensional conformation of the protein that may
decrease or lose its stability and protectivity (Mak and Saunders, 2008). Their
advantages are being well characterized and targeting the immune response to
specific immunodominant antigens. Nevertheless, they do not activate a broad
response as the whole organism does. Like the killed vaccines, it is difficult to get
cell-mediated immunity with subunit vaccines. For a better immune response,
they require an adjuvant which initiates inflammation and provides prolonged
release of the antigen (Arnon, 2011).
26
1.4.3.2. Polysaccharide Based Subunit Vaccines
Capsular polysaccharides of the pathogenic encapsulated bacteria such as
Salmonella typhi, Streptococcus pneumoniae, Neisseria meningitidis or
Haemophilus influenzae are used for vaccine development. The induction of
immunity may occur through two mechanisms: I) polysaccharides serve as
haptens and bind to self proteins, then the conjugate is taken up by DCs for
activation, II) presentation of non-peptide antigens to T-cells by MHC-like
molecule CD1 (Arnon, 2011). Total IgG antibodies against H. influenzae type b
(Hib) capsular polysaccharides started to increase after 11 months of age and the
significant increase in IgG2 levels were observed after 22 months of age in
children (Claesson et al., 1988). Therefore, immune induction by polysaccharides
is not effective in children younger than 2 years of age. In these cases, vaccine
efficacy can be increased by joining the capsule polysaccharide to a carrier protein
such as diphtheria or tetanus toxoid supplying a T-cell epitope. These types of
vaccines are called “conjugate vaccines” (Mak and Saunders, 2008). For an
effective vaccine against Hib infection in children, the protective capsular
polysaccharide PRP is conjugated to either OMP of Hib or tetanus toxoid.
Although conjugate vaccines provide long lasting IgG response, pure
polysaccharide vaccines such as Pneumovax-23 containing 23 different
polysaccharides from S. pneumoniae are still in use for adults (Arnon, 2011).
1.4.3.3. Toxoid Vaccines
Several bacteria such as Corynebacterium diphtheriae and Clostridium tetanii are
non-invasive but the toxins they secrete cause pathogenicity. Toxoid vaccines
(toxoids) are developed against these types of diseases via inactivating the
bacterial toxins by chemicals such as formaldehyde; hence, they lose their toxicity
but keep immunogenicity (Mak and Saunders, 2008; Arnon, 2011). For instance,
the diphtheria vaccine is produced via growing C. diphtheriae in liquid medium,
passing the culture from a filter, incubating the filtrate with formaldehyde, and
27
then adsorption of the toxoid onto aluminum salt (Koslap-Petraco and Hackley,
2011). Antibodies raised upon toxoid immunization neutralize the toxins via
binding to them, and then the toxins are cleared from the system. Tetanus and
diphtheria toxoids are routinely used against C. tetanii and C. diphtheriae
infections, respectively. Pertussis vaccine also includes B. pertussis toxin but
special efforts were required in order to eliminate completely its neurotoxicity.
The pediatric vaccine DPT (diphtheria-pertussis-tetanus) is a combination of these
three toxoids and used worldwide in almost every country (Arnon, 2011).
1.4.3.4. Reverse Vaccinology
In conventional subunit vaccine development, the pathogen is grown in laboratory
conditions and separated into individual components. Ability of the each
component is tested for induction of the immune responses. This process is time-
consuming and only proteins which can be purified in adequate amounts for
vaccination tests are identified. Mostly these proteins are not useful for vaccine
development because the proteins expressed during infection are not expressed
while in vitro culturing. Therefore, it may take several years or decades to identify
a protective antigen produced during infection in vivo. Once the suitable antigen
is identified, recombinant DNA technology as mentioned previously can be used
to obtain the protein in large amounts (Rappuoli, 2001).
A new era started after late 1990s by the publication of genome sequence of a
pathogen H. influenzae for the first time and by October 2011, 1,670 bacterial
genome projects have been finished and 5,478 are ongoing
(http://www.genomesonline.org/cgi-bin/GOLD/bin/gold.cgi). By the help of
bioinformatics, these genomes are mined for disease related genes; candidate
antigens are defined and tested for protectivity. Genomes belonging to multiple
strains of a pathogen are mined to obtain a universal vaccine or synthetic peptides
are designed mimicking the T-cell and B-cell epitopes. Since this technology
proceeds on the opposite way of conventional vaccine development, it is called
28
“reverse vaccinology”. An example of the first applications of reverse
vaccinology is the vaccine development studies against N. meningitidis which
causes sepsis and meningitis in young adults and children. After genome project
of N. meningitidis started, more than 600 genes coding surface-exposed proteins
were identified and half of them were expressed and tested for immunogenicity.
91 antigens were identified and 29 of them were found to be protective (Mora et
al., 2006). Computer based technologies are very important in reverse
vaccinology. There are many software programs for vaccine target prediction like
PSORTb (http://www.psort.org/psortb/; Yu et al., 2010), LipoP (http://www.
cbs.dtu.dk/services/LipoP/; Rahman et al., 2008), SVMHC (http://www.
sbc.su.se/~pierre/svmhc/new.cgi; Dönnes and Elofsson, 2002), EPIMHC (Reche
et al., 2005), SMM-align (Nielsen et al., 2007), Ensembl (http://www.ensembl.
org/index.html). Al-Hasani et al. (2007) identified 6 novel immunogenic proteins
of P. multocida serotype A:1 utilizing PSORTb, LipoP and Protemome Analyst
software programs. Recently, He et al. (2010) developed a web-based vaccine
design system, Vaxign (http://www.violinet.org/vaxign/) that predicts vaccine
targets against different pathogens using reverse vaccinology tools.
1.4.4. DNA Vaccines
DNA vaccines are the recombinant bacterial plasmid DNA molecules carrying the
genes encoding for foreign (immunogenic) proteins under a eukaryotic promoter
for the expression in mammalian cells (Garmory et al., 2003). In 1990, Wolff et
al. showed that the i.m. injection of DNA expression vector carrying the
luciferase gene resulted in luciferase production in vivo in the muscle cells of the
mouse at least 2 months without a special delivery system. Later, Tang et al.
(1992) delivered DNA-coated gold microparticles directly into the skin of mice
using a biolistic system (gene gun) for eliciting an immune response in mice
against a foreign protein. Delivered DNA molecules are taken up by DCs and
expressed foreign protein is processed during passage to the draining lymph
nodes. Related peptides are attached to the MHC molecule and expressed on the
29
cells surface. Immunocompetent T-cells in the lymph node recognize the MHC
complex and activated. Thus, a type 1 T-cell response is induced in subhuman
primates including both humoral and cell-mediated immunity with increased
CD4+ and CD8
+ effector T-cells (Ada, 2003). In the case of i.m. injection of DNA
vaccines, the functional DNA moves to the spleen through blood and antigen-
presenting cells (APCs) induce the immune responses (Arnon, 2011).
DNA vaccines are relatively easy in production and cost less with a good safety
and preclinical efficacy. Human clinical trials for DNA vaccines against the
diseases such as HIV and SARS are ongoing but there are several approved DNA
vaccines for use in animals (Larsen et al., 2009) such as the one protecting horses
against West Nile virus infection. Intradermal injection of a single dose of DNA
vaccine containing the plasmid construct carrying the gene for rabies glycoprotein
G induced serum neutralizing antibodies and protected the Beagle dogs against
challenge with the virulent virus one year after the vaccination (Day and Schultz,
2011). There are DNA vaccine studies against BRD associated pathogens as well.
van Drunen Littel-van den Hurk et al. (2010) delivered the plasmid construct
carrying the gene encoding glycoprotein E2 of BVDV intramuscularly to newborn
calves via an electroporation-based system. Induced humoral and cell-mediated
immune responses and close to complete protection from clinical signs of the
disease were observed in vaccinated calves. In order to increase the efficacy,
prime-boost regimens can be applied. Priming with an E2 DNA vaccine and
boosting with CpG adjuvanted E2 protein increased both humoral and cell-
mediated immune responses and protected the calves from the challenge of
BVDV-1 (Liang et al., 2006) and BVDV-2 (Liang et al., 2008).
1.4.5. Adjuvants
The term “adjuvant” is derived from the Latin word “adjuvare” that means “to
help” what exactly the adjuvants do. Most of the vaccines are composed of
nonliving material that cannot stimulate a significant immune response.
30
Therefore, these types of vaccines are formulated with an adjuvant for an
increased efficacy. Adjuvants are responsible for a local inflammation as well as
tissue destruction, distress and pain which are the key components in induction of
humoral and cell-mediated immune responses. Nonliving adjuvants may also act
as both delivery systems like liposomes, or as modulators like monophosphoryl
lipid A (MPL). Different types of adjuvants have different effects on innate
immunity which in turn shapes the adaptive immune response. Therefore, the type
of adjuvant has to be selected accordingly. Extracellular pathogens are mostly
eliminated by humoral response and Th2 skewing whereas infections caused by
intracellular pathogens require cell-mediated immunity and Th1 domination
(Lycke, 2007).
Figure 1.9. Schematic representation of 10 human TLRs and their interaction
with molecules of microbial origin. TLRs 1 and 2, and 6 and 2 form heterodimers.
PG: peptidoglycan, LP: lipopeptides, Imiquimod: a synthetic antiviral compound,
TIR: Toll/Interleukin-1/Resistance domain (Beutler, 2006).
31
Specific molecules of microbial origin such as LPS, DNA, RNA, bacterial
lipopeptides and lipoteichoic acid carry out adjuvant effect interacting with
mammalian Toll-like receptors (TLRs) (Figure 1.9). In Drosophila, Toll protein is
responsible for the development of ventral structures. The molecules taking role in
Toll and TLR signaling pathways are the members of the same family (Beutler,
2006).
Many different compounds such as aluminum hydroxide, aluminum phosphate,
oil-in-water emulsions, nucleotides (CpG), polyphosphazenes, liposomes, and
cytokines have been used for adjuvant purposes (Singh, 2007).
The story of immunological adjuvants started over 85 years ago. In 1924, Lewis
showed that i.p. injection of live tuberculosis (TB) pathogen a few days prior to
the vaccination with antigens dramatically increased the immune responses
against those antigens (Ott and van Nest, 2007). Later, in 1925 G. Ramon reported
that it was possible to increase the levels of tetanus or diphtheria antitoxin by
adding bread crumbs, starch oil, agar, tapioca, saponin, or lecithin to the vaccines
(Edelman, 2000). Two important progresses were carried out by Freund in 1930s
by the formulation of “incomplete Freund’s adjuvant” (IFA) which is a water-in-
oil emulsion containing 10% mannide monooleate (Arlacel A) and 90% mineral
oil, and “complete Freund’s adjuvant” (CFA) containing water-in-oil emulsion
mixed with killed TB. By the mid-1940s, the potency of water-in-oil systems was
increased and low-reactogenic alum systems were developed (Ott and van Nest,
2007). Alum compounds such as aluminum hydroxide [Al(OH)3] and aluminum
phosphate (AlPO4) are all known as “alum” but their physical characteristics and
adjuvant properties are different. Currently, the most prevalent method for
preparation of aluminum adjuvanted vaccines is adsorption of antigens onto
preformed Al(OH)3 or AlPO4 gels under controlled conditions (Gupta and Rost,
2000). There are some limitations in use of aluminum adjuvants: I) impropriety
for boosting immunizations with tetanus and diphtheria antigens, II) formation of
granulomas at the injection site, III) occasional erythema, IV) increase in IgE
32
levels and V) lack of biodegradability. On the other hand, oil adjuvants also have
some disadvantages like I) intense inflammation, II) formation of granulomas, III)
not retaining at the injection site, IV) carcinogenesis risk by poorly metabolized
mineral oils, and V) toxicity of CFA (Ott and van Nest, 2007). Activation of
immune cells by synthetic oligodeoxynucleotides (ODNs) was first reported by
Yamamoto et al. in the beginning of 1990s. Later, Krieg et al. (1995) showed that
unmethylated CpG dinucleotides induce innate immune system via interaction
with TLR9 in endocytic vesicles of the immune cells; then swelling and
acidification of vesicles result in production of reactive oxygen species (Klinman
et al., 2004).
1.4.6. Development of Vaccine Strategies against P. multocida
Animal experiments and field studies have shown that utilization of M.
haemolytica-P. multocida bacterin-toxoids in feedlot animals decreases BRD
occurrence and/or overall mortality rates (Wildman et al., 2008) and live
(attenuated) vaccines provide cross-protection against varying P. multocida
serotypes. Nevertheless, since the attenuation mechanism is not clear, outbreaks
come out in flocks vaccinated with live (attenuated) vaccines. Moreover,
serotype-specific immunity is the drawback of killed vaccines (Lee et al., 2007).
In recent years, chimeric genes created by genetic fusion have been studied for
use in recombinant vaccine development because of their versatility (Ayalew et
al., 2008). DNA vaccine technology is another alternative mean to improve
vaccine efficacy. Register et al. (2007) conducted a DNA vaccine study using
either a 5'-truncated or full length, genetically detoxified toxA gene from P.
multocida serogroup D in two different vectors. The construct carrying a signal
sequence with the full length toxin increased both antibody and interferon-γ levels
in pigs. Seo et al. (2009) reported that a truncated form of PMT was protective in
mice and reduced the clinical signs of AR in pigs.
33
Outer membrane proteins (OMPs) are potential targets for novel antimicrobial
drugs as well as vaccines against Gram-negative bacteria (Gatto et al., 2002;
Carpenter et al., 2007). Basagoudanavar et al. (2006) showed that mice
immunized with OMPs of P. multocida 6:B had high antibody titers and
Montanide adjuvanted OMPs protected 94% of the animals against bacterial
challenge. In P. multocida, OmpH is one of the major antigenic, surface-exposed
and conserved OMP porin that is detected in 100% of bovine isolates investigated
and has potential as a vaccine candidate (Dabo et al., 2008b). Protection capacities
of recombinant OmpH from P. multocida serotype D and B:2 in mice (Lee et al.,
2007 and Tan et al., 2010, respectively) and A:1 in chicken (Luo et al., 1997)
were reported. Antigenicity and protection capability of OmpA from P. multocida
were also studied. A strong Th2-type immune response was observed with
recombinant OmpA from P. multocida serotype A:3 but no protection could be
obtained in mice (Dabo et al., 2008a). Likewise, OmpA-equivalent Omp28 from
P. multocida A:3 did not confer any protection in mice (Gatto et al., 2002).
Pasteurella lipoprotein E (PlpE) is another immunogenic OMP of P. multocida.
Recombinant PlpE from P. multocida A:1 was cross-protected the vaccinated
mice against challenge with P. multocida serotypes A:1, A:3 and A:4, and the
vaccinated chicken against A:1 and A:4 (Wu et al., 2007). However, protectivity
of recombinant PlpB from P. multocida A:1 was very low (20-30%) in mice
(Chomnawang et al., 2009). Sthitmatee et al. (2008) reported that recombinant
adhesive protein rCp39 from P. multocida A:3 was cross protective in chicken
against challenge with A:3 and A:1 serotypes. Non-lipidated or lipidated forms of
two recombinant lipoproteins GlpQ and PCP from P. multocida A:1 induced
antibody titers but did not confer any protection in mice (Lo et al., 2004).
P. multocida serotypes used in vaccine development have been predominantly
avian or swine isolates. There is no vaccine study to date utilizing recombinant
OmpH and/or PlpE from a bovine isolate of P. multocida A:3. Hence, there is a
need of studies on bovine isolates of P. multocida for vaccine development
against shipping fever.
34
1.5. The Present Study
The goal of this study is to develop novel vaccine formulations against shipping
fever using PlpE and OmpH from a bovine isolate of P. multocida (A:3). The
chimeras of two plpE fragments and ompH were used as DNA vaccines. The
recombinant proteins and their fusions expressed in E. coli were purified and used
for immunization of mice. Effects of different adjuvants on protection were also
studied. Humoral and cell-mediated immune responses in mice induced by DNA
and protein based vaccines and their protective efficacies were evaluated.
35
CHAPTER 2
MATERIALS AND METHODS
2.1. Bacterial Strains and Plasmids
The sources and characteristics of bacterial strains are listed in Table 2.1.
Plasmids used in cloning experiments are given in Table 2.2. The structures of
plasmid vectors and the size markers are presented in Appendix A.
Table 2.1. Sources and characteristics of the bacterial strains used in this study.
Strain Characteristics Source and Reference
P. multocida
P-1062 Serotype A:3, bovine strain
American Type
Culture Collection
(ATCC 15743)
E. coli DH5α
F’ dlacZΔ(lacZY A-
argF)U169 supE44λ- thi-1
gyrA recA1 relA1 endA1
hsdR17
American Type
Culture Collection
E. coli
BL21(DE3)
F– ompT gal dcm lon hsdSB(rB
-
mB-) λ(DE3 [lacI lacUV5-T7
gene 1 ind1 sam7 nin5])
Novagen, Merck
(Germany)
36
Table 2.2. Plasmids used in cloning and expression.
Plasmid Size Markers Source and Reference
pCMV-LII 3.8 kb amp (Ampr)
Dr. F. Rodriguez
(Rodriguez et al., 2001)
pET-28a(+) 5.3 kb kan (Kanr)
Novagen, Merck
(Germany)
pGEM®-T
Easy 3.0 kb amp (Amp
r), lacZ
Promega Inc. (Madison,
WI)
2.2. Culture Media
The composition and preparation of culture media are given in Appendix B.
2.3. Solutions and Buffers
The composition of solutions and buffers are given in Appendix C.
2.4. Chemicals and Enzymes
The chemicals and enzymes used and their suppliers are listed in Appendix D.
2.5. Growth Conditions and Maintenance of Bacterial Strains
P. multocida were grown in Brain Heart Infusion (BHI) Broth (Appendix B) and
Blood agar (BA, Appendix B) plates whereas E. coli BL21 and E. coli DH5α
strains were grown in Luria Broth (LB, Appendix B) medium and stored on Luria
agar (LA, Appendix B) plates. The cultures were stored at 4oC and subcultured
monthly. Cultures grown in LB until mid-log phase were covered with 50%
glycerol for long term storage at –80oC.
37
LB and LA media were supplemented with the appropriate antibiotics, whenever
necessary. The concentrations of antibiotics included in media were as follows:
Ampicillin, 100 μg/mL; kanamycin, 30 μg/mL.
2.6. Primer Design
Primers for amplification of ompH and plpE genes of P. multocida P-1062 were
designed according to the complete genome sequence of P. multocida subsp.
multocida strain Pm70 (NCBI accession number NC_002663) (Table 2.3).
Table 2.3. Primers used in PCR. Restriction enzyme cut sites are underlined.
Gene name Primer
name Nucleotide sequence
Size of the
PCR products
ompH ompHF 5' agatctatggcaacagtttacaa 3' 984 bp (with
ompHR)
ompH ompHR 5' agatctttagaagtgtacgcgta 3' 984 bp (with
ompHF)
ompH ompHRN 5' agatctgaagtgtacgcgtaaac 3' 981 bp (with
ompHF)
plpE plpEF 5' ggatccatgtgtagcggtggtgg 3' 948 bp (with
plpER)
plpE plpER 5' agatctttgtgcttggtgactt 3' 948 bp (with
plpEF)
plpEN plpENR 5' cggagatcttccataacttccataat 3' 489 bp (with
plpEF)
plpEC plpECF 5' ggatccatgccttcagcagattacaa 3' 474 bp (with
plpER)
38
Table 2.4. PCR conditions for amplified genes.
2.7. Polymerase Chain Reactions (PCR)
Final concentrations in PCR mixture were as 1X PCR buffer (Fermentas), 0.2 mM
dNTP mix (Fermentas), 0.4 mM of each primer, 2.5 mM MgCl2 (Fermentas), 2
Product Primers used PCR conditions (35 cycle)
ompH (without signal
sequence)
ompHF and
ompHR
Initial denaturat.: 3 min at 94oC
Denaturation: 1 min at 94oC
Annealing: 1 min at 50oC
Extension: 1 min at 72oC
Final extention: 10 min at 72oC
ompH (without signal
sequence and stop codon)
ompHF and
ompHRN
Initial denaturat.: 3 min at 94oC
Denaturation: 1 min at 94oC
Annealing: 1 min at 50oC
Extension: 1 min at 72oC
Final extention: 10 min at 72oC
plpE (without signal
sequence and stop codon)
plpEF and
plpER
Initial denaturat.: 3 min at 94oC
Denaturation: 1 min at 94oC
Annealing: 1 min at 50oC
Extension: 1 min at 72oC
Final extention: 10 min at 72oC
plpEN (N terminal
fragment of plpE without
signal sequence and stop
codon)
plpEF and
plpENR
Initial denaturat.: 3 min at 94oC
Denaturation: 30 sec at 94oC
Annealing: 30 sec at 55oC
Extension: 30 sec at 72oC
Final extention: 10 min at 72oC
plpEC (C terminal
fragment of plpE without
signal sequence and stop
codon)
plpECF and
plpER
Initial denaturat.: 3 min at 94oC
Denaturation: 30 sec at 94oC
Annealing: 30 sec at 55oC
Extension: 30 sec at 72oC
Final extention: 10 min at 72oC
39
Units of Taq polymerase (Fermentas), and 10 ng of template DNA. The volume
was completed to 50 μL with dH2O. The sequences of primers and the size of
products are given in Table 2.3. Table 2.4 shows primers and PCR conditions
used for the amplification of the genes of interest.
After PCR, amplicons were run on 1% agarose gel. Desired bands from PCR
products were cut from the gel and extracted using Qiagen Gel Extraction Kit.
2.8. Agarose Gel Electrophoresis
Electrophoresis was carried out on a horizontal submarine electrophoresis
apparatus. 1% agarose gel was prepared in TAE buffer (Appendix C) and run at
90 Volts for 45-60 min. The gel was stained with ethidium bromide solution (0.5
μg/mL of TAE buffer). The DNA bands were visualized on a shortwave UV
transilluminator (UVP, Canada) and photographed using Vilber Lourmat Gel
Imaging System (Vilber Lourmat, France). PstI digested Lambda DNA marker
(Fermentas, Appendix A) was used to determine the molecular weights of DNA
bands.
2.9. Sequencing Reactions
DNA sequencing was carried out either by RefGen Biotechnology Inc. (Ankara,
Turkey) or MCLAB DNA Sequencing Department (San Francisco, CA) using the
chain termination method with BigDye Cycle Sequencing Kit V3.1 (Applied
Biosystems) in ABI 3130xl Genetic Analyzer (Applied Biosystems).
Deduced nucleotide and amino acid sequence data were analyzed using National
Center for Biotechnology Information (NCBI) database using the BLAST search
at the web site (http://www.ncbi.nlm.nih.gov/BLAST). Phylogenetic analyses
were conducted using MegAlign (DNASTAR, Madison, WI) and MEGA4
(Tamura et al., 2007) computer programs.
40
2.10. Ligation Reactions
Ligation of PCR products to pGEM-T Easy vector (Promega) was performed as
supplier’s recommendation. Briefly, 5 μL of 2X ligase buffer, 50 ng of pGEM-T
Easy, 100 ng of PCR product and 3 Weiss units of T4 DNA ligase was mixed and
the volume was completed to 10 μL with H2O. Ligation was carried out as
overnight incubation at 4oC. When the vectors pCMV-LII or pET28a(+) were
used, vector and insert DNA were mixed in 1:3 molar ratio, 5 Weiss units of T4
DNA Ligase (Fermentas) and 1 μL of 10X ligase buffer were added and the
mixture was incubated 16 h at 4oC.
2.11. Transformation of E. coli Cells
E. coli competent cells were prepared according to the protocol described by
Hanahan D. (1985). A single E. coli colony from a fresh LA plate was inoculated
in 3 mL of LB and incubated overnight with shaking at 37°C to obtain a stationary
phase culture. Three ml of this seed culture was inoculated into a fresh flask
containing 200 mL LB medium. The culture was incubated at 37 °C at 200 rpm in
an orbital shaker until the OD600 reaches 0.4-0.6. Then the culture was incubated
on ice for 15 min. After centrifuging at 3500 rpm for 5 min at 4 °C, supernatants
were decanted and the pellet was resuspended in 20 mL of ice-cold Buffer 1
(Appendix C). The cells were spun down at 3,500 rpm for 5 min at 4°C. Finally,
supernatants were decanted and the pellet was resuspended gently in 8 mL of ice-
cold Buffer 2 (Appendix C). 100 μL of aliquots were incubated on ice for 15-30
min and the cells were frozen in liquid nitrogen. The competent cells were stored
at – 80°C.
For transformation, 100 µl aliquot of competent E. coli cells were thawed on ice
for 10 min. 10 μL of ligation products or 0.5 ng of appropriate plasmid DNA was
added to the cells and mixed gently. The mixture was incubated on ice for 30 min.
After a heat shock at 42oC for 60 sec, it was incubated on ice for 5 min. 900 μL of
41
LB was added to the mixture and incubated at 37oC for 80 min by gentle agitation
(100 rpm). The cells were centrifuged at 3000 rpm for 10 min and resuspended in
100 μL of LB. Transformed cells were plated on selective medium containing
appropriate antibiotic (100 μg/mL ampicillin or 30 μg/mL kanamycin). For blue –
white colony selection, they were plated on LB agar media containing 80 mg/mL
X-gal, 0.5 mM IPTG and 100 μg/mL ampicillin.
2.12. Plasmid Isolation
QIAprep Spin Miniprep Kit (Qiagen) or GeneJET Plasmid Miniprep Kit
(Fermentas), were used for the isolation of E. coli plasmid DNA as described by
the manufacturers.
E. coli plasmids were also isolated by the miniprep method described by
previously (Kieser et al, 2000). Each strain was grown as a patch on LB agar
containing 100 µg/mL ampicillin or 30 µg/mL kanamycin. Ca. 1 cm2 of bacterial
cell mass was scraped with a sterile toothpick and put into Eppendorf tube
containing 100 µL cold STE buffer (Appendix C). The cells were resuspended by
vortexing and the tubes were incubated on ice for 20 min. 3/5 volume of lysis
buffer (Appendix C) was added to each tube and vortexed immediately. The cells
were lysed by incubation at room temperature for 10 min and then at 70°C for 10
min to denature DNA. Afterwards, tubes were cooled rapidly in cold water. An
equal amount of phenol/chloroform/isoamylalcohol (Amresco, OH) was added
and vortexed hard until a homogeneous and milky white mixture was obtained.
Finally, the samples were centrifuged for 5 min at 13,000 rpm to separate phases.
20 µL of supernatant was loaded directly on an agarose gel for electrophoresis.
Endotoxin free plasmids for DNA vaccine preparation were isolated using
Endofree Plasmid Mega Kit (Qiagen) as described by the manufacturer.
42
2.13. Restriction Enzyme Digestion
Restriction enzyme was added in a suitable buffer to the DNA to introduce 1 Unit
per μg of DNA. The mixture was incubated at a temperature appropriate for that
restriction enzyme for 3-5 h. The sample was stored at -20oC when needed.
2.14. Construction of Recombinant Plasmids
plpE and ompH genes were amplified via PCR using chromosomal DNA of P.
multocida P-1062. plpE gene was amplified with PlpEF and PlpER primers (Table
2.3); it was also cloned as two fragments, N-terminal (plpEN) without a signal
sequence and C-terminal (plpEC). Primers for N-terminal fragment were PlpEF
and PlpNR, and for C-terminal fragment were PlpCF and PlpER (Table 2.3).
Primers for ompH amplification were OmpHF and OmpHR (Table 2.3). PCR
products were ligated to pGEMT Easy vector and introduced into E. coli DH5α.
plpEN-ompH and plpEC-ompH fusions were obtained in pGEMT Easy.
Recombinant plasmids were verified with restriction enzyme digestion and
nucleotide sequence analysis. The genes of interest were cloned in pCMV to be
used as a DNA vaccine (pCMV-ompH, pCMV-plpEN-ompH and pCMV-plpEC-
ompH) and in pET28a to express His-tagged proteins (pET28-plpEN-ompH,
pET28-plpEC-ompH, pET28-plpEN, pET28-plpEC, pET28-plpE and pET28-
ompH). In order to visualize the expression of the genes in a eukaryotic system,
gfp gene was also cloned at the 3’ of the genes in pCMV (pCMV-ompH-gfp,
pCMV-plpEN-gfp, pCMV-plpEC-gfp). A total of 17 (6 in pGEM-T, 5 in pCMV
and 6 in pET28a) constructs were obtained.
2.15. Transient Transfection of Mammalian Cells
Human embryonic kidney (HEK) 293 cells were kindly provided by Dr. A. Elif
Erson Bensan (METU, Ankara, Turkey) and maintained in complete Dulbecco's
modified Eagle's medium (DMEM) supplemented with 2 mM glutamine, 15%
43
heat inactivated fetal bovine serum (FBS), 2 mM non-essential amino acids, 100
U/ml penicillin and 0.1 mg/ml streptomycin (all from Biochrom AG, Germany).
HEK 293 cells were transfected with pCMV-ompH-gfp, pCMV-plpEN-gfp and
pCMV-plpEC-gfp plasmids using FuGENE 6 Transfection Reagent (Roche
Applied Science, Germany) according to manufacturer’s recommendations.
pCMV-gfp and pCMV were used as positive and negative controls, respectively.
2x105 cells were grown in each well of a six-well plate for 24 h at 37°C in
a 5% CO2 atmosphere in complete DMEM. The cells were washed and 2 ml of
DMEM was added to wells. 1 µg or 2 µg of each plasmid was mixed with 3 µl of
FuGENE 6 in DMEM and the mixture was added onto the cells. After incubation
for 5 h, the medium was changed with DMEM supplemented with FBS and
antibiotics. The cells were incubated for 48 h and visualized under Zeiss LSM 510
fluorescence confocal microscope (Carl Zeiss AG, Germany).
2.16. Purification of His-tagged Proteins
Recombinant E. coli BL21 cells carrying pET28-plpE, pET28-plpEN, pET28-
plpEC, pET28-ompH, pET28-plpEN-ompH or pET28-plpEC-ompH were grown
in Luria Broth (LB, Merck) supplemented with kanamycin (30 µg/ml final
concentration). Expression was induced at OD600 of 0.6 by adding isopropyl-β-D-
galactopyranoside (IPTG, Sigma) to 1 mM final concentration and incubated at
37°C for 5 h in a shaker incubator at 200 rpm. Cells were harvested by
centrifugation at 6,000 g at 4°C for 15 min and resuspended in LEW buffer
(Appendix C). Following the sonication using a CP70T Ultrasonic Processor
(Cole-Parmer, Vernon Hills, IL) for 6×10 sec at 60% amplitude, cellular debris
was removed by centrifugation at 15,000 g for 15 min. For solubilization of PlpE,
30 mM of 2-mercaptoethanol (BME) was added to the supernatant. The
supernatants containing the recombinant proteins were purified using Protino Ni-
TED 2000 packed columns (Macherey-Nagel, Germany) or Ni-NTA Spin Kit
(Qiagen) according to suppliers’ recommendations. Eluted proteins were dialyzed
44
using a cellulose dialysis tube (Sigma) in 1 L of DB buffer (Appendix C) at 4oC
stirring o/n and sterilized by 0.2 µm membrane filter. The purity of proteins was
determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-
PAGE). The proteins were adsorbed onto indicated adjuvant for the preparation of
vaccines.
2.18. Determination of Protein Concentration
Protein concentrations were measured by the Bradford quantification method
(1976). The assay is based on the observation at 595 nm when the absorbance is
maximal for an acidic solution of Coomassie Brilliant Blue G-250 while binding
to a protein.
y = 0,0563x + 0,0105
R2 = 0,9918
0
0,1
0,2
0,3
0,4
0 1 2 3 4 5 6
Amount of protein (mg/ml)
Ab
so
rba
nc
e a
t 5
95
nm
Figure 2.1. Calibration curve for quantification of protein concentrations.
Assay reagent was made by dissolving 100 mg of Coomassie Blue G-250 in 50
mL of 95% ethanol. The solution was then mixed with 100 mL of 85%
phosphoric acid and made up to 1 L with distilled water. The reagent was filtered
45
through Whatman No. 1 filter paper. Bovine serum albumin (BSA) was used as
the standard for preparation of protein calibration curve. Volumes of 2, 4, 6, 8 and
10 μL of BSA (1 mg/mL) were added to Eppendorf tubes and volumes were
completed to 100 μL with dH2O. 100 μL of distilled water was added into a tube
as reagent blank. 900 μL of assay reagent was added to each tube and vortexed.
Optical densities (O.D.) of solutions at 595 nm were measured on a Shimadzu
UV-1208 spectrophotometer. A calibration curve was plotted using O.D. values of
standards (Figure 2.1) and the amounts of proteins were calculated using equation
obtained from the curve.
2.19. Sodium Dodecyl Sulphate Polyacrylamide Gel Electrophoresis (SDS-
PAGE)
SDS-polyacrylamide gels were prepared according to Laemmli (1970) (Table
2.5). Ca. 10 µg of protein was mixed with sample loading buffer (Appendix C)
and the gel was run at 16 mA in 1X running buffer (Appendix C) using a Mini-
Protean electrophoresis apparatus (Bio-Rad) until the loading dye reached to the
end of the gel.
2.20. Coomassie Blue R-250 Staining of Polyacrylamide Gels
After electrophoresis, the gel was incubated in fixation solution (Appendix C) for
45 min and then soaked in 100 mL of freshly prepared Coomassie Blue R-250
stain (Appendix C) for 15 min at room temperature. The gel was then destained
by keeping it in destaining solution (Appendix C) for at least 1 h.
46
Table 2.5. Preparation of SDS-polyacrylamide gels.
Stacking Gel
0.125 M Tris, pH 6.8
Separating Gel
0.375 M Tris, pH 8.8
Monomer concentration 4.5% 12%
Acrylamide/bis 0.65 mL 4 mL
dH2O 3.05 mL 3.35 µL
1.5 M Tris-HCl, pH 8.8 - 2.5 mL
0.5 M Tris-HCl, pH 6.8 1.25 mL -
10% (w/v) SDS 50 µL 100 µL
10% Ammonium persulphate 25 µL 50 µL
TEMED 5 µL 5 µL
TOTAL MONOMER 5 mL 10 mL
2.21. Western Blot
3MM Whatman® papers and the 0.2 µm nitrocellulose membrane (Bio-Rad,
Hercules, CA) were soaked in 1X transfer buffer (Appendix C) and laid out as
shown in Figure 2.2.
Figure 2.2. Schematic representation of transfer set-up in western blot.
47
The transfer was performed at 1.5 µA per cm2 of the membrane for 1 h 15 min
using a semi-dry blotter (Cleaver Scientific Ltd, Warwickshire, UK) according to
a modified method of Towbin et al. (1979). Later, the membrane was incubated in
10% skim milk in 1X TBS (Appendix C) at 4oC o/n or at 37
oC for 2 h and then
washed with 1X TTBS (0.5% Twin in 1X TBS) for 10 min. Primary antibody was
applied at 1/400 dilution in 5% skim milk incubating the membrane 1 h at RT.
The membrane was washed with 1X TTBS for 10 min and secondary antibody
(antimouse IgG, Sigma) was applied at dilution of 6 µl/100 ml of 5% skim milk
for 1 h at RT. Then the membrane was washed with 1X TBS for 10 min and the
AP conjugate substrate (Bio-Rad, Hercules, CA) was applied until the bands were
visualized.
2.22. Experiments with Mice
Female BALB/c mice weighing between 15 and 18 g were obtained from Faculty
of Medicine of Ankara University, Experimental Animals Unit (Ankara, Turkey).
The experimental design for the Methodology I vaccination experiments were
shown in Table 2.6. The mice were bled from the tail vein 14 days after each
immunization and the sera were kept at -20°C.
Immunization of mice for the experiments of adjuvant effect was administered via
Methodology II (Table 2.7). CpG adjuvant was kindly provided by Dr. İhsan
Gürsel (Bilkent University, Ankara, Turkey) and aluminum hydroxide (alum)-
CpG mix, oil based (Montanide ISA 206 VG, Seppic, France) and oil based-CpG
adjuvants were kindly provided by Dr. Erkan Özcengiz (VBR Inc., Ankara,
Turkey). 100 µg of PlpEC-OmpH was adsorbed onto different adjuvants were
administered to each mouse. Control mice received PBS. The second injection
was performed three weeks after the first injection and the pathogen challenge
was applied 10 days after the second injection. The vaccines were injected
through intraperitoneal (i.p.) route. The mice were bled from the tail vein before
the second immunization and the challenge; the sera were kept at -20°C. The same
48
methodology was performed for vaccination of PlpE, PlpEC and OmpH
formulated with oil based and oil based-CpG adjuvant. Control mice were
received adjuvant only.
Table 2.6. Experimental design for Methodology I vaccination experiments.
Type of
experiment Vaccine Amount Route
Number
of dose*
Number
of mice
DNA
vaccines
pCMV-ompH 50 µg i.m. 3 6
100 µg i.m. 3 6
pCMV-plpEN-ompH 100 µg i.m. 3 6
pCMV-plpEC-ompH 100 µg i.m. 3 6
pCMV (control) 100 µg i.m. 3 6
Fusion
protein
vaccines
PlpEN-OmpH 50 µg s.c. 2 5
PlpEC-OmpH 50 µg s.c. 2 5
PlpEN-OmpH 100 µg s.c. 2 5
PlpEC-OmpH 100 µg s.c. 2 5
PBS (control) 500 µl s.c. 2 5
* Each dose was administered in 15 days intervals.
After vaccination regimen, the mice were challenged with intraperitoneal injection
of 10 LD50 (55 CFU) of P. multocida A:3 in 500 µl of saline solution. P.
multocida was grown o/n on blood agar plates. The colonies was scratched from
the plate and resuspended in sterile saline solution to an OD630 of 0.6. A serial
dilution was performed and 108 dilution was used as the 10 LD50 of the pathogen.
Survivors were recorded 7 days after challenge. Animal experiments were
performed under the approval of Ethical Committee on Animal Experiments of
Middle East Technical University, Ankara (Etik-2009/11, 09.07.2009).
49
Table 2.7. Experimental design for Methodology II vaccination experiments.
Type of
experiment Protein* Adjuvant Route
Number
of dose**
Number
of mice
Adjuvant
effect
PlpEC-OmpH CpG i.p. 2 5
PlpEC-OmpH Alum-CpG i.p. 2 5
PlpEC-OmpH Oil based i.p. 2 5
PlpEC-OmpH Oil based-CpG i.p. 2 5
Control PBS i.p. 2 5
Single
protein
vaccines
PlpE Oil based-CpG i.p. 2 5
PlpEC Oil based-CpG i.p. 2 5
OmpH Oil based-CpG i.p. 2 5
Control Oil based-CpG i.p. 2 5
* 100 µg of each protein was used.
** The vaccines were administered at day 0 and 21.
2.23. Enzyme-Linked Immunosorbent Assay (ELISA)
Purified recombinant proteins were used as ligands to coat ELISA plates at
concentrations of 1 µg/well prepared in carbonate buffer (Appendix C). The plates
were covered with parafilm and incubated at 4oC overnight. Afterwards, the plates
were washed three times with washing solution (WS, Appendix C). 50 µl of
blocking solution (BS, Appendix C) was added to the wells and the plates were
incubated at 37oC for 1 h. The sera collected from the mice immunized with DNA
and protein based vaccines were diluted as 1:50, 1:100, 1:200, 1:400, 1:800,
1:1600 and 1:3200 in BS to use as primary antibodies and incubated at 37oC for 1
h. The plates were washed four times with WS. Alkaline phosphatase conjugated
rabbit anti-mouse IgG (Sigma) was used as secondary antibody at a dilution of
1:1000 in BS and incubated at 37oC for 1 h. The plates were washed four times
with WS. 100 µl of AP Conjugate Substrate Kit (Bio-Rad) was used as
50
colorimetric substrate reagent prepared adding 400 µl of development buffer and
100 µl of solution A and B in 10 ml of dH2O. The plates were incubated 30 min at
RT at a dark place and the reaction was stopped with 50 µl of 1 M NaOH. Optical
densities were measured at 405 nm on a RT-2100C Microtiter plate Reader
(Rayto, Shenzhen, China). Absorbance values for 1:100 and 1:1600 dilutions were
used for the comparison of antibody responses in mice vaccinated with DNA and
protein vaccines, respectively.
2.24. Detection of Serum Interferon-gamma (IFN-γ) Levels
Mouse IFN-γ Minikit (Pierce, Thermo Scientific) was used for the detection of
serum IFN-γ levels of vaccinated mice. The protocol was applied according to
manufacturer’s recommendations. Briefly, 96-well plates were coated with 100 µl
of diluted Coating Antibody by overnight incubation at room temperature (RT).
Next, 300 µl of Blocking Buffer (Appendix C) was added to each well and
incubated for 1 h at RT. After aspirating Blocking Buffer, the plate was allowed to
dry for 1 h at RT. The plate was sealed and kept at 4oC. Serum samples were
added at 1:4 dilutions in Assay Buffer (Appendix C) and incubated at RT
overnight. The plate was washed three times with Wash Buffer (Appendix C) and
100 µl of diluted Detection Antibody was added to each well. After incubation of
1 h at RT, the plate was washed and 100 µl of Streptavidin-HRP (Pierce, Thermo
Scientific) was added at a dilution of 1:10000. The plate was incubated at RT for
30 min and washed three times with Wash Buffer. 100 µl of TMB substrate
(Thermo Scientific) was added to each well and incubated at RT for 30 min. The
reaction was stopped by adding 100 µl of 0.18 M sulfuric acid (H2SO4) and the
absorbance was read at 450 nm on a RT-2100C Microtiter plate Reader (Rayto,
Shenzhen, China).
51
2.25. Statistical Analyses
An analysis of variance (ANOVA) and the Tukey’s test were used for mean
comparison of antibody response between groups. Survival data were compared
using the chi-square test (two-sided). Statistical analyses for immune responses
and survival were performed using GraphPad Prism version 5.00 for Windows
(GraphPad Software, USA). The significance level (p) for all analyses was set at
0.05. Standard deviations were calculated using Microsoft Office Excel 2010
program.
2.26. Nucleotide Sequence Accession Numbers
GenBank accession numbers of plpE and ompH genes from P. multocida P-1062
are GU247966and GQ914772, respectively.
52
CHAPTER 3
RESULTS AND DISCUSSION
3.1. Cloning of ompH and plpE Genes
Genomic DNA of Pasteurella multocida P-1062 (A:3, ATCC 15743) was used for
PCR amplification of ompH and plpE genes (Figure 3.1). plpE gene was cloned
without a signal sequence and a stop codon to obtain a genetic fusion with ompH.
Figure 3.1. Amplification of plpE (lane 1), ompH (lane 2) and ompHNS (lane 3)
genes. Lane 4: Negative control, M: Lambda DNA/PstI marker.
1.0 kb
0.8 kb
53
Lee et al. (2007) reported that cloning of entire ompH gene from P. multocida was
failed probably because of the lethality of protein product; hence, signal sequence
of the gene was deleted for the expression of ompH in E. coli. Therefore, signal
sequences were eliminated while designing of primers for amplification of ompH
and plpE genes in this study. One copy of ompH was also cloned without a stop
codon (ompHNS) to obtain a gfp fusion which was later used in transfection of
mammalian cells.
PCR products were cut and extracted from the agarose gel and ligation to pGEMT
Easy vector was performed. Ligation products were introduced into E. coli DH5α
competent cells. Putative colonies were screened by manual plasmid isolation and
verified by restriction enzyme digestion (Figure 3.2).
M 1 2 3 4 5 6 M
Figure 3.2. Verification of putative colonies for cloning of plpE (lanes 1 and 2),
ompH (lanes 3 and 4) and ompHNS (lanes 5 and 6) in pGEMT via restriction
enzyme digestion of plasmids. M: Lambda DNA/PstI marker.
3.2. Sequence Analysis of ompH and plpE Genes from P. multocida P-1062
Positive clones for pGEMT-ompH and pGEMT-plpE were used for sequencing of
the genes; the sequences were compared with previously sequenced genes in
BLAST (http://blast.ncbi.nlm.nih.gov/Blast.cgi) database and analyzed using
1.0 kb
0.8 kb
pGEMT
Gene of
interest
54
DNASTAR (DNASTAR Inc., Madison, WI) and Mega4 (Tamura et al., 2007)
programs.
A
GCAACAGTTTACAATCAAGACGGTACAAAAGTTGATGTAAACGGTTCTGTAC
GTTTAATCCTTAAAAAAGAAAAAAATAAGCACGGTGATTTAGTGGATAACGG
TTCACGCGTTTCATTCAAAGCGTCTCATGATTTAGGCGAAGGCTTAAGCGCA
TTAGCTTATACAGAACTTCGTTTCAGTAAAAATGTAACAAAGCAAAAAAAGA
CCAAAGCAGGAAAAGACAAGAATTATGTTGTTGAACGACTTGGTAACAATGT
CCACGTAAAACGTCTTTATGCCGGTTTCGCGTATGAAGGTTTAGGAACATTA
ACTTTCGGTAACCAATTAACTATCGGTGATAATGTTGGTGTGTCTGATTACA
CTTACTTCTTAGGTGGTATCAACAACCTTCTTTCTAGCGGTGAAAAAGCAAT
TAACTTTAAATCTGCAGAATTCAACGGTTTCACATTTGGTGGTGCGTATGTC
TTCTCAGCGGATGCTGACAAACAAGCATCACGTGATGGTCGCGGTTTCGTTG
TAGCGGGTTTATACAACAGAAAAATGGGCGATGTTGGTTTCGCACTTGAAGC
AGGTTATAGCCAAAAACAAAAATATGTAACAGCAGCTAAACAAGAAAAAGCC
TTTATGGTCGGTACTGAATTATCATATGCTGGTTTAGCACTTGGTGTTGACT
ATGCACATACAGTGACTAACAAAGAAAAAGTAGAAGGTAAAAAACGCGCACT
TGAAGTAGGTTTAAACTATGACATTAATGACAAAGCAAAAGTTTACACTGAC
TTGATTTGGGCAAAAGAAAGTTCAAAAGGTGTTACTACAAGAGATTCTAGCA
TCTTATTAGGTGCGGGCTACAAGCTTCACAAAAAAGTTGAAACCTTTGTTGA
AGGTGGCTGGAGCAGAAAGAAAGCTGCTGTTGGCGTAACAACAAAAGATAAC
AAAGTTGGTGTTGGTTTACGCGTACACTTCTAA
B
ATVYNQDGTKVDVNGSVRLILKKEKNKHGDLVDNGSRVSFKASHDLGEGLSA
LAYTELRFSKNVTKQKKTKAGKDKNYVVERLGNNVHVKRLYAGFAYEGLGTL
TFGNQLTIGDNVGVSDYTYFLGGINNLLSSGEKAINFKSAEFNGFTFGGAYV
FSADADKQASRDGRGFVVAGLYNRKMGDVGFALEAGYSQKQKYVTAAKQEKA
FMVGTELSYAGLALGVDYAHTVTNKEKVEGKKRALEVGLNYDINDKAKVYTD
LIWAKESSKGVTTRDSSILLGAGYKLHKKVETFVEGGWSRKKAAVGVTTKDN
KVGVGLRVHF-
Figure 3.3. Nucleotide (A) and amino acid (B) sequences of ompH gene.
Sequence similarity of the proteins among different strains is important in vaccine
development for cross protection. For instance, the cross-reactive proteins of
55
Clostridium tetani shared 65–78% sequence similarity with their closest
homologues in C. perfringens (Alam et al., 2008). Accordingly, the sequence of
ompH (GenBank accession number: GQ914772, Figure 3.3) was analyzed in the
present study. Computer-aided analysis (EditSeq, DNASTAR) of 969 base pairs
(bp) ompH gene without the signal sequence was shown in Table 3.1. Luo et al.
(1997) reported that ompH from P. multocida X-73 (serotype A:1) is 1,059 bp
long coding for 353 amino acids, including a 20 amino acid signal peptide. The
mature protein has a calculated molecular mass of 36.6 kDa.
Figure 3.4. Phylogenetic relationships of OmpH sequences. The phylogenetic tree
was constructed by using MEGA4 with Neighbor-Joining method (Saitou and
Nei, 1987). The numbers show the percentage that the related taxon grouped
together in 1000 repeats. GenBank accession numbers are given in parentheses.
56
Table 3.1. Computer-aided analyses of ompH, plpEN and plpEC genes.
Gene
name
Number of
nucleotides (bp)
G+C
content (%)
Number of
amino acids
Molecular
mass (kDa)
ompH 969 38.29 322 35.0
plpEN 474 35.86 158 17.5
plpEC 459 34.20 153 17.4
Mature OmpH from P. multocida P-1062 was 10 amino acids shorter than that of
X-73, and it had 81.7–90.7% sequence similarity to OmpH sequences belonging
to other P. multocida serotypes of avian, bovine or swine origin and 23.9 – 29.8%
identity to outer membrane protein sequences of Actinobacillus
actinomycetemcomitans, Haemophilus somnus, Plesiomonas shigelloides,
Mannheimia succiniciproducens, Actinobacillus succinogenes, Aggregatibacter
aphrophilus. In order to show the identity of P-1062 OmpH to other P. multocida
OmpH sequences, a phylogenetic tree was constructed in MEGA4 program
(Figure 3.4).
plpE gene was cloned via PCR as full-length and an N-terminal (plpEN, bases
from 1 to 483) and a C-terminal (plpEC, bases from 487 to 945) fragment (Figure
3.5A). Nucleotide sequences of plpEN and plpEC were identical to plpE sequence
(GenBank accession number GU247966). Computer-aided analyses (Edit-Seq,
DNASTAR) of plpEN and plpEC were shown in Table 3.1. The alignment of
deduced amino acid sequence of the PlpE from P. multocida P-1062 (Figure 3.5B)
with other bacterial outer membrane proteins (MegAlign, DNASTAR) showed
that the sequence had 89–100% identity to PlpE sequences from other P.
multocida strains and 24–29% identity to PlpE sequences of Mannheimia
haemolytica.
57
Figure 3.5. Nucleotide (A) and amino acid (B) sequences of plpE gene. N
terminal fragment was underlined and C terminal fragment was shaded.
A
TGTAGCGGCGGTGGCGGTAGCGCTGGAAATCGTGCTGACCGTGTAGA
GGAAAAAGCACAACCGGTTCAATCAAATAGTGAGCCTTCTTCCGCTC
CAATCAAAAATCCTACTAATACCGCTACGAATGATTCTCTTCATGAC
AAACTTTCAATGTCTTCTCATGACACATCCAAAGAAAATAGTCAACA
ATCCTCCTTTAAAGCCCCTCTAGAACAAGAAAAAAACCAACCTGCAC
AAGAAAATCTCACTTGGACAGGTTATCATGTTTCAGAAGTGGGAAAT
GCGAGTAATAATGTAGATAAAGATAACGTTACGGTATTCACTTTCGT
AAAATATAATTCTCAATACAATGATGATCCAGTTTTTGATAAAACAA
AAACACAAAGTAAAACAATATCATTAGTTGACGGAAAAAATGAGAAT
AAAGAGGATTATTATAACTTTACGTTAAAAGACGCTTTATTTTATTA
TGGAAGTTATGGA(CAA)CCCCTTTTCCAAGGCCAAGGAATTTTAACCAAAAAAAAAAAAGGTTAAGGAAAAAAAA
AAAAAATTTTAATTAATTTTTTAATTGGCCAAAATTTTAAAAAACCCCAAGGAATTGGCCAAAATTAAAAAATTAAAATTGGAAGGAAAACCCC
TTCCAAAATTGGCCAACCTTAAAACCTTGGCCAAAACCTTTTAATTTTAATTCCAAAAGGAAAAGGAATTGGGGTTTTTTTTAATTAATTAATT
TTCCCCGGTTAATTTTAAAAGGTTGGAATTGGTTAAAAAATTCCGGAAGGTTTTGGGGTTTTCCAAGGAAAATTAATTAATTTTCCCCTTCCAA
GGTTAATTGGGGCCAAAATTGGTTGGAACCTTCCTTTTAACCTTTTTTCCCCGGAAAAAATTGGGGCCAAAAGGAATTTTTTAATTGGGGTTGG
AAAAAATTCCTTAACCAAGGAATTAATTAAAATTAAGGAAGGGGAACCGGTTGGAATTGGAATTTTTTGGTTTTTTCCAAGGCCTTCCTTCCAA
GGGGAAGGAAAAGGGGAACCAAAAAAAACCTTTTAAAACCTTAATTAAAACCAACCCCAACCAACCAAAAGGGGAACCAAAATTCCCCCCCCAA
TTAAAAAACCTTAATTCCCCCCCCTTAACCAAGGGGAACCCCCCGGAACCAAAACCAATTGGGGCCAAAATTGGGGAAGGCCTTGGAAAATTTT
TTTTAATTCCAAAACCGGCCAAGGAAAAAAAAAAAACCTTGGAATTAAAAAAAAAAAATTAACCGGTTTTGGTTTTGGGGTTGGTTAAGGGGAA
AAAAAAGGCCTTGGAAAAAAAAAATTAATTTTAATTGGGGGGTTTTAATTTTAATTTTTTGGCCTTGGAAAAAAAAAAAAGGTTCCAACCCCAA
AAGGCCAACCAAAA
B
CSGGGGSAGNRADRVEEKAQPVQSNSEPSSAPIKNPTNTATNDSLHDK
LSMSSHDTSKENSQQSSFKAPLEQEKNQPAQENLTWTGYHVSEVGNAS
NNVDKDNVTVFTFVKYNSQYNDDPVFDKTKTQSKTISLVDGKNENKED
YYNFTLKDALFYYGSYG(Q)PPSSAADDYYKKKKVVEEKKNNYYIIYYAAIIKKPPDDAAIINNNNEENNLLNNAA
LLTTAATTYYYYQQEEDDGGFFIIYYSSVVLLSSDDVVNNRRVVGGSSEEYYIIPPQQYYGGNNVVTTLLTTFFRRNNGGKKIIYYGGEEIIYYRR
YYNNRRGGRRDDDDLLFFQQLLSSGGEEGGQQNNLLTTIITTPPHHKKDDNNPPHHKKLLSSPPTTGGPPDDNNMMAAMMEELLNNFFIINNAAEE
KKTTDDKKKKYYVVVVGGVVGGKKAAEEKKYYYYGGLLLLFFAAEEKKSSHHQQAAQQ
58
In order to show the identity of P-1062 PlpE to other P. multocida PlpE
sequences, a phylogenetic tree was constructed in MEGA4 program (Figure 3.6).
As discussed by Wu et al. (2007) and Singh et al. (2010), with more than 90%
sequence similarity among P. multocida strains, PlpE is a cross protective antigen.
Figure 3.6. Phylogenetic relationships of PlpE sequences. The phylogenetic tree
was constructed by using MEGA4 with Neighbor-Joining method (Saitou and
Nei, 1987). The numbers show the percentage that the related taxon grouped
together in 1000 repeats. GenBank accession numbers are given in parentheses.
59
3.3. Construction of DNA Vaccines and Expression of ompH, plpEN and
plpEC Genes in Mammalian Cells
In DNA vaccine studies, transfection efficiency of the plasmid constructs and the
gene expression in a eukaryotic system are checked out prior to vaccination
(Doroud et al., 2010; Zhu et al., 2011). A cDNA encoding green fluorescent
protein (GFP) from the jellyfish Aequorea victoditis elegans can be used as a
reporter gene to visualize the expression of genes and the localization of proteins
in eukaryotic cells (Chalfie et al., 1994; Watanabe et al., 1999). In this study, first,
ompHNS, ompH, plpEN and plpEC were cloned in eukaryotic expression vector
pCMV under the human cytomegalovirus (CMV) promoter (Figure 3.7).
Figure 3.7. Scheme of the DNA vaccine plasmid pCMV. ompH, plpEN, plpEC,
gfp and their fusions were cloned in BglII site between SVSD/SA and LII tail. CMV
IE: human cytomegalovirus immediate-early promoter; SVSD/SA and SVpolyA:
SV40 splice donor-acceptor and transcription terminator-polyadenylation signal,
respectively; LII tail: targeting signal of lysosomal integral membrane protein-II
(modified from Rodriguez et al., 2001).
Then, fusions of ompHNS, plpEN and plpEC with gfp at 3' in pCMV were
obtained using E. coli DH5α. To observe the expression of these bacterial genes in
a mammalian host, human embryonic kidney (HEK) 293 cells were transiently
transfected with pCMV-ompHNS-gfp, pCMV-plpEN-gfp, pCMV-plpEC-gfp.
pCMV-gfp and pCMV alone were also used as positive and negative controls,
60
respectively. After 48 h incubation, gfp expression in transfected cells was
monitored under fluorescence confocal microscope (Zeiss LSM 510) (Figure 3.8).
GFP expression was successfully observed in HEK 293 cells transfected with
pCMV-ompHNS-gfp, pCMV-plpEN-gfp, pCMV-plpEC-gfp and pCMV-gfp
while there was no GFP expression in negative control. Later, in addition to
ompH, plpEN-ompH and plpEC-ompH fusions were also obtained in pCMV.
Finally, endotoxin free pCMV-ompH, pCMV-plpEN-ompH and pCMV-plpEC-
ompH were purified from E. coli cells to use as DNA vaccines.
Figure 3.8. In vitro expression of ompH, plpEN and plpEC in mammalian cells.
HEK 293 cells were transiently transfected with pCMV-ompH-gfp (A), pCMV-
plpEN-gfp (B), pCMV-plpEC-gfp (C), and pCMV-gfp (D) and pCMV (E) as a
positive and negative control, respectively. Green color shows the expression of
the gene of interest together with gfp gene at 3'. The cells were visualized under
20x objective of Zeiss LSM 510 fluorescence confocal microscope.
61
3.4. Immune Responses against DNA Vaccines pCMV-ompH, pCMV-plpEN-
ompH and pCMV-plpEC-ompH
Six BALB/c mice per group were i.m. immunized three times in two weeks
intervals with 50 µg or 100 µg of pCMV-ompH DNA vaccine. Serum IgG levels
were measured via ELISA technique (Figure 3.9). As compared to control group
mice vaccinated with pCMV, there was not a significant increase in antibody
levels in mice vaccinated with 50 µg of pCMV-ompH whereas significant
increment (p<0.05) was obtained with 100 µg of pCMV-ompH after third
vaccination.
Figure 3.9. Total IgG levels in 1:100 diluted sera from the mice vaccinated with
pCMV-ompH DNA vaccine. Statistically significant (p<0.05) increase as
compared to control was shown with an asterisk.
62
Figure 3.10. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with
pCMV-ompH DNA vaccine. Statistically significant (p<0.05) increase as
compared to control was shown with an asterisk.
Serum interferon gamma (IFN-γ) levels were also measured to reveal any cell-
mediated immune response conferred by pCMV-ompH DNA vaccines (Figure
3.10). In contrast to antibody response, there was not a significant increase in
serum IFN-γ levels in mice vaccinated with 100 µg of pCMV-ompH whereas the
increment by 50 µg of pCMV-ompH was significant (p<0.05) after second and
third vaccinations.
Vaccinated mice were challenged with 10 LD50 (55 CFU) of live P. multocida.
However, neither 50 µg nor 100 µg of pCMV-ompH DNA vaccine conferred
protection.
Later, six mice per group were vaccinated with 100 µg of pCMV-plpEN-ompH or
pCMV-plpEC-ompH fusion DNA vaccines. Significant increase (p<0.05) in
antibody levels was obtained in mice vaccinated with pCMV-plpEC-ompH after
first vaccination and remained after second and third injections. On the other
63
hand, in spite of higher mean values than that of control group, a significant
increase (p<0.05) in antibody level was obtained after third vaccination with
pCMV-plpEN-ompH (Figure 3.11).
Serum IFN-γ levels in mice vaccinated with pCMV-plpEN-ompH or pCMV-
plpEC-ompH DNA vaccines were measured (Figure 3.12). Serum IFN-γ titers
were significantly high (p<0.05) in mice immunized with pCMV-plpEN-ompH
vaccine after first and second immunizations. However, a significant increase in
serum IFN-γ levels could not be obtained by pCMV-plpEC-ompH construct. As a
result, pCMV-plpEN-ompH DNA vaccine induced both humoral and cell-
mediated immune responses against P. multocida A:3 in mice.
Figure 3.11. Total IgG levels in 1:100 diluted sera from the mice vaccinated with
pCMV-plpEN-ompH or pCMV-plpEC-ompH DNA vaccines. Statistically
significant (p<0.05) increase as compared to control was shown with an asterisk.
64
Figure 3.12. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with
pCMV-plpEN-ompH or pCMV-plpEC-ompH DNA vaccines. Statistically
significant (p<0.05) increase as compared to control was shown with an asterisk.
The mice immunized with pCMV-plpEN-ompH or pCMV-plpEC-ompH were
challenged with 10 LD50 of live P. multocida but no protection was obtained
despite of induced antibody and/or IFN-γ levels. Therefore, they are not
individually suitable for use as a vaccine but can be used for prime-boost studies,
i.e. priming with a DNA vaccine and boosting with a protein formulation. Liang et
al. (2008) immunized calves priming with a plasmid encoding E2 protein of
BVDV-2 and boosting with E2 protein formulations. Both humoral and cell-
mediated immune responses were induced in vaccinated animals and protection
was recorded upon viral challenge.
There is only one DNA vaccine study on P. multocida conducted by Register et
al. (2007). They constructed four DNA vaccines composed of 5'-truncated or full-
length, genetically detoxified toxA gene (encoding PMT) from a swine isolate of
P. multocida in two different vectors which have or lack a signal sequence for
secretion. The construct encoding full-length gene with a signal sequence induced
65
both humoral and cell-mediated immune responses in mice and pigs. However,
protection studies in mice with lethal dose of bacteria were not performed.
3.5. Expression of plpEN-ompH and plpEC-ompH Gene Fusions in E. coli and
Optimization of Recombinant Protein Purification via Affinity Column
Chromatography
For gene expression in E. coli and protein purification by His-tag affinity column
chromatography, fusion gene constructs, i.e. plpEN-ompH and plpEC-ompH,
were obtained in pET28a(+) vector using E. coli DH5α. Later, recombinant
plasmids were introduced to E. coli BL21 (DE3) cells providing phage T7 RNA
polymerase (Kothari et al., 2006) and recombination was verified by restriction
enzyme digestion. For the production of His-tagged fusion proteins, recombinant
E. coli BL21 (DE3) cells were grown in Luria Broth containing IPTG to a final
concentration of 1 mM for the induction of gene expression under the control of
phage T7 promoter (Kothari et al., 2006). IPTG-induced cultures were centrifuged
and the pellets were resuspended in Binding Buffer (Ayalew et al., 2008)
containing 6 M urea. The cells were sonicated and the lysates were centrifuged,
supernatants containing the over-expressed proteins. Ni-NTA (Qiagen) columns
were used for the purification of fusion proteins on the bases of nickel affinity of
histidine-tagged proteins. Purity of eluates was monitored on SDS-polyacrylamide
gels (Figure 3.13). Over-expression and partial purification of 55-60 kDa His-
tagged fusion proteins in denaturing conditions using Ni-NTA columns were
successfully obtained.
66
M 1 2 3 4 5 6 7 8
Figure 3.13. Purification of PlpEN-OmpH and PlpEC-OmpH fusion proteins
using Ni-NTA columns. M: Prestained protein ladder, Lanes 1, 4: Uninduced
culture lysates, Lanes 2, 5: IPTG-induced culture lysates, Lanes 3, 6: Eluates,
Lanes 7, 8: Flow-through samples for PlpEN-OmpH and PlpEC-OmpH,
respectively.
M 1 2 3 4 5 6
Figure 3.14. Purification of PlpEN-OmpH and PlpEC-OmpH fusion proteins
using Ni-TED columns under native conditions. M: Prestained protein ladder,
Lanes 1, 3: Uninduced culture lysates, Lanes 2, 4: IPTG-induced culture lysates,
Lanes 3, 6: Eluates for PlpEN-OmpH and PlpEC-OmpH, respectively.
55 kDa
72 kDa
36 kDa
72 kDa
55 kDa
36 kDa
28 kDa
67
M 1 2 3 4 5 6 7 8
Figure 3.15. Effect of urea on solubilization of inclusion bodies in the cells
expressing PlpEN-OmpH or PlpEC-OmpH. M: Unstained protein ladder, Lanes1,
5: Uninduced culture lysates and Lanes 2, 6: IPTG-induced culture lysates for
PlpEN-OmpH. Lanes 3, 7: Uninduced culture lysates and Lanes 4, 8: IPTG-
induced culture lysates for PlpEC-OmpH. Cells were treated with (lanes 1-4) or
without (lanes 5-8) urea.
M 1 2 3 4 5 6
Figure 3.16. Purification of PlpEN-OmpH and PlpEC-OmpH fusion proteins
using Ni-TED columns under denaturing conditions. M: Prestained protein ladder.
Lanes 1, 4: Uninduced culture lysates, Lanes 2, 5: IPTG-induced culture lysates,
Lanes 3, 6: Eluates for PlpEN-OmpH and PlpEC-OmpH, respectively.
66 kDa
45 kDa
35 kDa
72 kDa
55 kDa
68
Ni-TED (Macherey-Nagel) columns were used to obtain larger amounts of
proteins to be used in vaccine preparations. First, native conditions were applied
for the purification of proteins. Uninduced and IPTG-induced cells were
resuspended in Lysis-Elution-Wash (LEW) Buffer of the commercial kit lacking
urea and sonicated. Lysates were centrifuged and the supernatants from induced
culture were used as crude extracts for His-tagged fusion proteins. After nickel
affinity column chromatography using Ni-TED columns, eluates were screened on
SDS-polyacrylamide gel (Figure 3.14). Lack of a difference between uninduced
and induced samples and very low level or no protein in eluates probably resulted
from unsuccessful solubilization of inclusion bodies in the absence of urea.
Later, effect of urea on solubilization of inclusion bodies was investigated for
protein purification using Ni-TED columns. Uninduced and IPTG-induced
cultures were centrifuged and the pellets were resuspended in either Binding
Buffer (Ayalew et al., 2008) containing 6 M urea or LEW Buffer lacking urea.
The cells were sonicated and centrifuged. Solubilized proteins were run on SDS-
polyacrylamide gel (Figure 3.15). Over-production of fusion proteins was
observed in IPTG-induced cells treated with Binding Buffer but LEW Buffer
lacking urea was ineffective on solubilization of inclusion bodies.
Finally, His-tagged fusion proteins were decided to be purified under denaturing
conditions using Ni-TED columns for use in vaccine formulations. Protein
profiles of the samples were visualized via SDS-PAGE (Figure 3.16).
Solubilization of inclusion bodies and purification of His-tagged proteins were
successfully accomplished. Molecular masses of PlpEN-OmpH and PlpEC-OmpH
fusions were ca. 55 and 53 kDa, respectively.
69
3.6. Immune Responses against Fusion Proteins PlpEN-OmpH and PlpEC-
OmpH
Five BALB/c mice per group were immunized twice with either 50 µg or 100 µg
of fusion proteins adsorbed to aluminum hydroxide (alum) at day 0 and 14. Before
second immunization and challenge, mice were bled from tail veins and serum
samples were obtained.
Figure 3.17. Total IgG levels in 1:1600 diluted sera from the mice vaccinated
with either 50 µg (A) or 100 µg (B) of PlpEN-OmpH or PlpEC-OmpH fusion
proteins adsorbed on alum adjuvant. Statistically significant (p<0.05) increase as
compared to control was shown with an asterisk.
70
Antibody levels in mice immunized with PlpEN-OmpH or PlpEC-OmpH fusion
proteins were measured via ELISA. Both of the fusion proteins induced humoral
immune response (Figure 3.17). Serum IFN-γ levels in vaccinated mice were also
investigated (Figure 3.18). Neither 50 µg PlpEN-OmpH nor 50 µg or 100 µg of
PlpEC-OmpH increased cell-mediated immune responses in vaccinated mice.
Statistically significant (p<0.05) increase in serum IFN-γ level was only observed
in mice vaccinated with 100 µg of PlpEN-OmpH.
Figure 3.18. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with either
50 µg (A) or 100 µg (B) of PlpEN-OmpH or PlpEC-OmpH fusion proteins
adsorbed on alum adjuvant. Statistically significant (p<0.05) increase as compared
to control was shown with an asterisk.
71
Mice immunized with either 50 µg or 100 µg of fusion proteins were challenged
with 10 LD50 of live P. multocida A:3. Two out of five mice (40%) vaccinated
with 100 µg of PlpEC-OmpH survived after challenge which was not statistically
significant (p=0.11). Other vaccine formulations did not confer any protection
(Table 3.2).
Table 3.2. Protection conferred in mice immunized with PlpEN-OmpH or PlpEC-
OmpH protein adsorbed on alum against challenge with P. multocida A:3.
Vaccine formulation
(protein/adjuvant) Dose (µg)
No. of mice
survived/challenged
Protection
%
PlpEN-OmpH/alum 50 0/5 0
PlpEC-OmpH/alum 50 0/5 0
PlpEN-OmpH/alum 100 0/5 0
PlpEC-OmpH/alum 100 2/5 40
Control - 0/5 0
3.7. Effect of Different Vaccine Adjuvants on Protectivity of PlpEC-OmpH
Selection of appropriate antigen doses and use of potent adjuvants that can boost
antigen immunogenicity is a crucial step in vaccine development and is essentially
empiric. Hence, the useful approach for determination of safe and efficient
vaccine candidates is trial-and-error methodologies (Rojo-Montejo et al., 2011).
In vaccine formulations, adjuvants are used to form a depot effect and induce the
cytokine production by targeting immune cells. Antibody subclasses and hence,
Th1-Th2 balance can change depending on the type of the adjuvant. In mice, IgG1
is related with Th2-type immunity whereas IgG2a, IgG2b, and IgG3 are
associated with Th1-type response. Different mechanisms take role in the
72
clearance of encapsulated bacteria by each IgG subclasses. For instance, binding
to Fc receptors is mediated by IgG2a and IgG2b and they can fix complement
together with IgG3 better than IgG1 can; protection may be provided by IgG1 or
IgG3 through cooperatively binding to bacteria. Thus, an immune response
against encapsulated bacteria may be beneficial with a broad subclass distribution
(Lefeber et al., 2003).
CpG oligodeoxynucleotides (ODNs) has been utilized as vaccine adjuvants in a
number of studies on animals including mice and cattle (Klinman et al., 2004).
Bacterial DNA contains unmethylated CpG dinucleotides at an expected
frequency but they are underrepresented and selectively methylated in vertebrates
resulting in recognition of bacterial DNA as a pathogen-associated material.
Through binding to TLR9, CpG ODNs induce Th1-type responses with secretion
of IL-12 and IFN-γ in mice (Liang et al., 2006) whereas aluminum hydroxide
induces Th2-type cellular immunity (Makidon et al., 2008). Chen et al. (2011)
reported that hepatitis B vaccine formulation with CpG adjuvant induced Th1-
type immune response increasing IFN-γ and IL-2 levels while the alum
adjuvanted formulation triggered Th2-type response. Oil based adjuvants
(emulsions) have been used in vaccine formulations since 1945 (Aucouturier et
al., 2006). Emulsion type adjuvants are more efficient than alum. They target
muscle cells and induce an early and strong immuno-competent environment at
the injection site in addition to providing a prolonged duration for the action of the
antigen (Huang et al., 2010).
In this study, different adjuvants were used in formulations of PlpEC-OmpH to
increase its 40% protective efficacy. For this purpose, previously used aluminum
hydroxide (alum) was replaced with four different adjuvants: I) CpG, II) alum-
CpG, III) oil based and IV) oil based-CpG. The vaccination protocol was changed
from two s.c. injections in two weeks intervals to two i.p. injections at day 0 and
21 and bacterial challenge at day 31. Peripheral blood samples were collected
73
from tail veins of the mice before the second immunization and challenge and the
sera were used in ELISA for the measurement of immune responses.
Figure 3.19. Total IgG levels in 1:1600 diluted sera from the mice vaccinated
with 100 µg of PlpEC-OmpH fusion protein formulated with CpG, alum-CpG, oil
based or oil based-CpG adjuvants. Statistically significant (p<0.05) increase as
compared to control was shown with an asterisk.
A statistically significant (p<0.05) increment in antibody response was obtained in
mice vaccinated with alum-CpG, oil based and oil based-CpG formulations both
after first and second immunizations. There was not a significant difference
among these adjuvants in terms of induction of antibody levels. CpG formulation
increased antibody titers only after second injection still being lower as compared
to those by the other three adjuvants (Figure 3.19). Formulations containing CpG
significantly (p<0.05) increased serum IFN-γ levels after first and second
vaccination (Figure 3.20). A statistically significant increment in IFN-γ levels in
mice vaccinated with oil based formulation with respect to control group was not
recorded.
74
Figure 3.20. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with 100
µg of PlpEC-OmpH fusion protein formulated with CpG, alum-CpG, oil based or
oil based-CpG adjuvants. Statistically significant (p<0.05) increase as compared
to control was shown with an asterisk.
Although alum induces Th2-type immunity, increased serum IFN-γ levels in mice
vaccinated with alum-CpG formulation showed a Th1-type polarization.
Likewise, Gentil et al. (2010) reported that the vaccine formulation with alum
adjuvant induced IgG1 levels responsible for Th2-type response whereas the one
with alum-CpG adjuvant had increased titers of IgG2a and IgG2b associated with
Th1-type immunity. Lefeber et al. (2003) demonstrated that the highest levels of
IgG subclasses associated with Th1-type response were obtained with the vaccine
formulation with CpG and dimethyl dioctadecyl ammonium bromide
combination.
75
Table 3.3. Protection conferred in mice immunized with PlpEC-OmpH protein
formulated with CpG, alum-CpG, oil based or oil based-CpG against challenge
with P. multocida A:3.
Vaccine formulation
(protein/adjuvant)
No. of mice
survived/challenged
Protection
%
PlpEC-OmpH/CpG 0/5 0
PlpEC-OmpH/alum-CpG 0/5 0
PlpEC-OmpH/oil based 3/5 60*
PlpEC-OmpH/oil based-CpG 5/5 100*
Control 0/5 0
*Statistically significant (p<0.05) as compared to control.
Protective capacities of the vaccine formulations composed of PlpEC-OmpH
fusion protein formulated with CpG, alum-CpG, oil based or oil based-CpG
adjuvants were also exhibited via challenge of the immunized mice with 10 LD50
of live P. multocida. Control group mice and those vaccinated with CpG or alum-
CpG formulations were died at the second day after challenge (Table 3.3).
Formulation with oil based adjuvant conferred 60% (3 out of 5 mice) protection
while 100% (5 out of 5) of the mice vaccinated with PlpEC-OmpH formulated
with oil based-CpG adjuvant were protected from the bacterial challenge. Thus,
the formulation composed of PlpEC-OmpH fusion protein and oil based-CpG
adjuvant can be used as a potential vaccine candidate against P. multocida A:3.
3.8. Expression of ompH, plpEN, plpEC and plpE Genes in E. coli and
Purification of Recombinant Proteins
For the gene expression and protein purification, ompH, plpEN, plpEC and plpE
were cloned in pET28a vector and introduced into E. coli BL21(DE3) cells.
Purification of the recombinant PlpEN, PlpEC and OmpH proteins from E. coli
76
cultures was performed via affinity column chromatography as described in
section 3.5. PlpEC and OmpH proteins were successfully purified but
recombinant PlpEN could not be recovered from E. coli (Figure 3.21).
M 1 2 3 4 5 6 7 8 9
Figure 3.21. Purification of recombinant PlpEN, PlpEC and OmpH using Ni-TED
columns under denaturing conditions. M: Prestained protein ladder. Lanes 1, 4, 7:
Uninduced control, Lanes 2, 5, 8: IPTG-induced culture lysates and Lanes 3, 6, 9:
Eluates for PlpEN, PlpEC and OmpH, respectively.
Standard protocol was applied for the purification of PlpE but no protein was
bound on the column (Figure 3.22). Therefore, the effects of increased NaCl
concentration as well as addition of β-mercaptoethanol (B-ME) or Triton X-100 to
the LEW Buffer with 8 M urea were investigated. Ni-NTA and Ni-TED columns
were used in each case (data not shown). Finally, the purification protocol was
optimized as addition of 30 mM B-ME to the LEW buffer containing 8 M urea
and 1 M NaCl with the utilization of Ni-NTA columns (Figure 3.23).
28 kDa
36 kDa
55 kDa
17 kDa
77
M 1 2 3 4 5
Figure 3.22. Purification of recombinant PlpE using Ni-TED columns under
standard conditions. M: Protein ladder, Lane 1: Uninduced control, Lane 2: IPTG
induced culture lysate, Lane 3: Eluate, Lane 4: Flow-through, Lane 5: Wash
fractions.
M 1 2 3 4 5
Figure 3.23. Purification of recombinant PlpE using Ni-NTA columns under
optimized conditions. M: Protein ladder, Lane 1: IPTG induced culture lysate,
Lane 2: Flow through, Lane 3: Wash I, Lane 4: Wash II, Lane 5: Eluate fractions.
25 kDa
35 kDa
25 kDa
35 kDa
PlpE
78
3.9. Immune Responses against Recombinant OmpH, PlpEC and PlpE
Recombinant OmpH, PlpEC and PlpE were formulated with oil based-CpG
adjuvant that provided the full protection with PlpEC-OmpH. Five BALB/c mice
per group were i.p. immunized with 0.5 ml of vaccine formulations containing
100 µg of recombinant protein at day 0 and 21. Antibody levels in vaccinated
mice were measured (Figure 3.24). A statistically significant (p<0.05) increase in
antibody titers were obtained in mice immunized with PlpEC and PlpE after first
and second injections and with OmpH after second vaccination.
Figure 3.24. Total IgG levels in 1:1600 diluted sera from the mice vaccinated
with 100 µg of recombinant OmpH, PlpEC and PlpE formulated with oil based-
CpG adjuvant. Statistically significant (p<0.05) increase as compared to control
was shown with an asterisk.
Serum IFN-γ levels in mice vaccinated with recombinant OmpH, PlpEC and PlpE
formulated with oil based-CpG were significantly (p<0.05) induced after first and
second injection (Figure 3.25).
79
Figure 3.25. IFN-γ levels in 1:4 diluted sera from the mice vaccinated with 100
µg of recombinant OmpH, PlpEC and PlpE formulated with oil based-CpG
adjuvant. Statistically significant (p<0.05) increase as compared to control was
shown with an asterisk.
Table 3.4. Protection conferred in mice immunized with recombinant OmpH,
PlpEC or PlpE protein formulated with oil based-CpG adjuvant against challenge
with P. multocida A:3.
Vaccine formulation
(protein/adjuvant)
No. of mice
survived/challenged Protection (%)
OmpH/oil based-CpG 3/6 50
PlpEC/oil based-CpG 3/5 60*
PlpE/oil based-CpG 5/5 100*
Control (oil based-CpG) 0/5 0
*Statistically significant (p<0.05) as compared to control.
80
For the detection of protective efficacies of recombinant OmpH, PlpEC and PlpE
proteins, immunized mice were challenged with 10 LD50 of live P. multocida A:3.
Control mice were died at day 2 after challenge. OmpH formulation conferred
50% protection while 60% (3 out of 5 mice) protection was provided by PlpEC
formulation. On the other hand, a full (100%) protection was obtained with the
vaccine formulation composed of 100 µg of recombinant PlpE adsorbed on oil
based-CpG adjuvant (Table 3.4).
Outer membrane protein H (OmpH) and Pasteurella lipoprotein E (PlpE) are of
interest in recombinant vaccine studies against different serotypes of P. multocida.
Wu et al. (2007) reported that recombinant PlpE from P. multocida serotype A:1
causing fowl cholera conferred 63-100% protection in mice and chicken against
heterologous challenge with the serotypes A:1, A:3 and A:4. Luo et al. (1997)
vaccinated chickens with native and recombinant OmpH from P. multocida
serotype A:1 and reported 100% and 18% protection, respectively. However,
Sthitmatee et al. (2008) showed that both native and recombinant OmpH from
serotype A:1 and its identical protein, Cp39 from serotype A:3 conferred 60-100%
protection in chickens against challenge with serotypes A:1 and A:3. Tan et al.
(2010) immunized mice i.p. or s.c. with recombinant OmpH from P. multocida
serotype B:2 causing hemorrhagic septicemia and obtained 80% and 100%
protection, respectively. Moreover, recombinant OmpH from a swine isolate of P.
multocida causing atrophic rhinitis provided 70% protection in mice (Lee et al.,
2007). Dabo et al. (2008) vaccinated mice with recombinant OmpA from a bovine
isolate of P. multocida serotype A:3 but no protection was obtained. However,
there is no study on protectivity of recombinant PlpE or OmpH proteins isolated
from P. multocida A:3 targeting shipping fever. In the present study,
immunogenicity and protective capacities of OmpH and PlpE from P. multocida
P-1062 (serotype A:3, a bovine isolate) were investigated. PlpEN-OmpH and
PlpEC-OmpH fusions or recombinant OmpH, PlpEC and PlpE proteins were
capable of inducing antibody titers in vaccinated mice irrespective of adjuvant
used in the formulation. Induction of serum IFN-γ levels in vaccinated mice was
81
achieved by alum adjuvanted PlpEN-OmpH and CpG containing formulations.
However, statistically significant (p<0.05) protection was conferred by PlpEC-
OmpH formulated with oil based and oil based-CpG and PlpE and PlpEC
formulated with oil based-CpG. Dabo et al. (2008a) reported that recombinant
OmpA from a bovine isolate of P. multocida A:3 elicited a strong Th2-type
immunity but did not provide a protection showing the insufficiency of a sole
Th2-type immune response in protection and the need for some specific Th1
response. Therefore, a balance between Th1- and Th2-type immunity and
selection of appropriate antigen would be effective in protection against P.
multocida. Both humoral and cell-mediated immune responses are involved in P.
multocida infection (Korde et al, 2005; Praveena et al., 2010); the former takes
role in the suppression of the infection in early stage whereas the latter is probably
necessary for the complete elimination of the pathogen in the later stage of the
infection (Verma and Jaiswal, 1997). In this study, the vaccines composed of
PlpEC-OmpH and PlpE formulated with oil based-CpG increased serum total IgG
and IFN-γ levels and conferred 100% protection in mice.
82
CHAPTER 4
CONCLUSIONS
There was not a significant increase in antibody titers in mice vaccinated with
50 µg of pCMV-ompH whereas significant increment (p<0.05) was obtained with
100 µg of pCMV-ompH after third vaccination.
Serum IFN-γ levels in mice vaccinated with 100 µg of pCMV-ompH did not
induced while the increment by 50 µg of pCMV-ompH was significant (p<0.05)
after second and third vaccinations.
Neither 50 µg nor 100 µg of pCMV-ompH DNA vaccine confer protection
against 10 LD50 (55 CFU) of live P. multocida.
pCMV-plpEC-ompH significantly (p<0.05) increased antibody levels after first,
second and third injections. On the other hand, a significant increase (p<0.05) in
antibody level was obtained after third vaccination with pCMV-plpEN-ompH.
pCMV-plpEN-ompH significantly (p<0.05) induced IFN-γ titers after first and
second immunizations. However, a significant increase in serum IFN-γ levels
could not be obtained by pCMV-plpEC-ompH construct. As a conclusion, pCMV-
plpEN-ompH DNA vaccine induced both humoral and cell-mediated immune
responses against P. multocida A:3 in mice.
83
No protection could be obtained with pCMV-plpEN-ompH or pCMV-plpEC-
ompH DNA vaccines against 10 LD50 of live P. multocida.
Antibody levels in mice immunized with PlpEN-OmpH or PlpEC-OmpH fusion
proteins were siginicantly (p<0.05) induced.
Neither 50 µg PlpEN-OmpH nor 50 µg or 100 µg of PlpEC-OmpH increased
cell-mediated immune responses in vaccinated mice. Statistically significant
(p<0.05) increase in serum IFN-γ level was only observed in mice vaccinated with
100 µg of PlpEN-OmpH.
Two out of five mice (40%) vaccinated with 100 µg of PlpEC-OmpH were
survived after challenge which was not statistically significant (p=0.11).
A statistically significant (p<0.05) increment in antibody response was obtained
in mice vaccinated with PlpEC-OmpH formulated with alum-CpG, oil based and
oil based-CpG after first and second immunizations. CpG formulation increased
antibody titers only after second injection still being lower as compared to those
by the other three adjuvants.
Formulations containing PlpEC-OmpH and CpG significantly (p<0.05)
increased serum IFN-γ levels after first and second vaccination immunization. A
statistically significant increment in IFN-γ levels in mice vaccinated with PlpEC-
OmpH and oil based adjuvant formulation was not recorded.
Formulation with PlpEC-OmpH and oil based adjuvant conferred 60% (3 out of
5 mice) protection while 100% (5 out of 5) of the mice vaccinated with PlpEC-
OmpH and oil based-CpG adjuvant were protected from the bacterial challenge.
84
A statistically significant (p<0.05) increase in antibody titers were obtained in
mice immunized with PlpEC and PlpE after first and second injections and with
OmpH after second vaccination.
Serum IFN-γ titers were significantly (p<0.05) induced by vaccination with
OmpH, PlpEC and PlpE formulated with oil based-CpG adjuvant.
OmpH and oil based-CpG formulation conferred 50% protection while 60%
protection was provided by PlpEC formulation. On the other hand, a full (100%)
protection was obtained with the vaccine formulation composed of 100 µg of
recombinant PlpE formulated with oil based-CpG adjuvant.
PlpEC-OmpH fusion and recombinant PlpE formulated with oil based-CpG
adjuvant provided full protection in mice. These two formulations are potential
candidates for acellular vaccine development against shipping fever.
85
REFERENCES
Ada, G. (2003). Overview of vaccines. In: Vaccine protocols (2nd
ed.). Edited by
Robinson, A., Hudson, M.J., Cranage, M.P. Humana Press, New Jersey, USA.
pp. 1-14.
Adams, L.G., Khare, S., Lawhon, S.D., Rossetti, C.A., Lewin, H.A., Lipton,
M.S., Turse, J.E., Wylie, D.C., Bai, Y., Drake, K.L. (2011). Enhancing the role
of veterinary vaccines reducing zoonotic diseases of humans: Linking systems
biology with vaccine development. Vaccine doi:10.1016/j.vaccine.2011.05.080.
Adler, B., Bulach, D., Chung, J., Doughty, S., Hunt, M., Rajakumar, K.,
Serrano, M., van Zanden, A., Zhang, Y., Ruffolo, C. (1999). Candidate vaccine
antigens and genes in Pasteurella multocida. J Biotechnol 73(2-3): 83-90.
Alam, S.I., Bansod, S., Singh, L. (2008). Immunization against Clostridium
perfringens cells elicits protection against Clostridium tetani in mouse model:
identification of cross-reactive proteins using proteomic methodologies. BMC
Microbiol 8: 194.
Al-Hasani, K., Boyce, J., McCarl, V.P., Bottomley, S., Wilkie, I., Adler, B.
(2007). Identification of novel immunogens in Pasteurella multocida. Microb Cell
Fact 6: 3.
Angen, O., Thomsen, J., Larsen, L.E., Larsen, J., Kokotovic, B., Heegaard,
P.M., Enemark, J.M. (2009). Respiratory disease in calves: microbiological
86
investigations on trans-tracheally aspirated bronchoalveolar fluid and acute phase
protein response. Vet Microbiol 137(1-2): 165-171.
Arnon, R. (2011). Overview of vaccine strategies. In: Vaccine design: innovative
approaches and novel strategies. Edited by Rappuoli, R. and Bagnoli, F. Caister
Academic Press, Norfolk, UK. pp. 1-17.
Atashpaz, S., Shayegh, J., Hejazi, M.S. (2009). Rapid virulence typing of
Pasteurella multocida by multiplex PCR. Res Vet Sci 87(3): 355-357.
Aucouturier, J., Ascarateil, S., Dupuis, L. (2006). The use of oil adjuvants in
therapeutic vaccines. Vaccine 24 Suppl 2: S2-44-45.
Ayalew, S., Confer, A.W., Payton, M.E., Garrels, K.D., Shrestha, B., Ingram,
K.R., Montelongo, M.A., Taylor, JD. (2008). Mannheimia haemolytica chimeric
protein vaccine composed of the major surface-exposed epitope of outer
membrane lipoprotein PlpE and the neutralizing epitope of leukotoxin. Vaccine
26: 4955-4961.
Bagley, C.V. (1997). Bovine respiratory disease. Animal health fact sheet.
Website: http://extension.usu.edu/files/publications/factsheet/ah_beef_04.pdf
Basagoudanavar, S.H., Singh, D.K., Varshney, B.C. (2006). Immunization with
outer membrane proteins of Pasteurella multocida (6:B) provides protection in
mice. J Vet Med A Physiol Pathol Clin Med 53(10): 524-530.
Bergey, D.H. and Holt, J.G. (2000). Bergey’s manual of determinative
bacteriology (9th
ed.). Lippincott Williams & Wilkins, Philadelphia, USA.
87
Beutler, B. (2006). Microbial pathogenesis and the discovery of Toll-like receptor
function. In: Vaccine adjuvants: immunological and clinical principles. Edited by
Hacket C.J. and Harn Jr. D.A. Humana Press, New Jersey, USA. pp. 1-24.
Blackall, P.J., Bojesen, A.M., Christensen, H., Bisgaard, M. (2007).
Reclassification of [Pasteurella] trehalosi as Bibersteinia trehalosi gen. nov.,
comb. nov. Int J Syst Evol Microbiol 57(Pt 4): 666-674.
Bonah, C. (2005). The ‘experimental stable’ of the BCG vaccine: safety, efficacy,
proof, and standards, 1921–1933. Stud Hist Phil Biol & Biomed Sci 36: 696–721.
Boyce, J.D. and Adler, B. (2000). The capsule is a virulence determinant in the
pathogenesis of Pasteurella multocida M1404 (B:2). Infect Immun 68(6): 3463-
3468.
Boyce, J.D., Cullen, P.A., Nguyen, V., Wilkie, I., Adler, B. (2006). Analysis of
the Pasteurella multocida outer membrane sub-proteome and its response to the in
vivo environment of the natural host. Proteomics 6(3): 870-880.
Boyce, J.D., Harper, M., Wilkie, I.W., Adler, B. (2010). Pasteurella. In:
Pathogenesis of bacterial infections in animals (4th
ed.). Edited by Gyles, C.L.,
Prescott, J.F., Songer, G., Thoen, C.O. Wiley-Blackwell, Iowa, USA. pp. 325-
340.
Bradford, M.M. (1976). A rapid and sensitive method for the quantitation of
microgram quantities of protein utilizing the principle of protein-dye binding.
Anal Biochem 72: 248–254.
Busch, C., Orth, J., Djouder, N., Aktories, K. (2001). Biological activity of a C-
terminal fragment of Pasteurella multocida toxin. Infect Immun 69(6): 3628-3634.
88
Carpenter, T., Khalid, S., Sansom, M.S. (2007). A multidomain outer
membrane protein from Pasteurella multocida: modelling and simulation studies
of PmOmpA. Biochim Biophys Acta 1768: 2831-2840.
Carter, G.R. (1952). The type specific capsular antigen of Pasteurella multocida.
Can J Med Sci 30(1): 48-53.
Catry, B., Chiers, K., Schwarz, S., Kehrenberg, C., Decostere, A., de Kruif,
A. (2005). Fatal peritonitis caused by Pasteurella multocida capsular type F in
calves. J Clin Microbiol 43(3): 1480-1483.
Chalfie, M., Tu, Y., Euskirchen, G., Ward, W.W., Prasher, D.C. (1994).
Green fluorescent protein as a marker for gene expression. Science 263: 802-805.
Chen, Z., Cao, J., Liao, X., Ke, J., Zhu, S., Zhao, P., Qi, Z. (2011). Plasmids
enriched with CpG motifs activate human peripheral blood mononuclear cells in
vitro and enhance Th-1 immune responses to hepatitis B surface antigen in mice.
Viral Immunol 24: 199-209.
Cho, Y.S., Lee, H.S., Lim, S.K., Joo, Y.S., Kim, J.M., Kim, J.H. (2008). Safety
and efficacy testing of a novel multivalent bovine bacterial respiratory vaccine
composed of five bacterins and two immunogens. J Vet Med Sci 70: 959-964.
Chomnawang, M.T., Nabnuengsap, J., Kittiworakarn, J., Pathanasophon, P.
(2009). Expression and immunoprotective property of a 39-kDa PlpB protein of
Pasteurella multocida. J Vet Med Sci 71(11): 1479-1485.
Chung, J.Y., Wilkie, I., Boyce, J.D., Adler, B. (2005). Vaccination against fowl
cholera with acapsular Pasteurella multocida A:1. Vaccine 23(21): 2751-2755.
89
Chung, J.Y., Wilkie, I., Boyce, J.D., Townsend, K.M., Frost, A.J., Ghoddusi,
M., Adler, B. (2001). Role of capsule in the pathogenesis of fowl cholera caused
by Pasteurella multocida serogroup A. Infect Immun 69(4): 2487-2492.
Claesson, B.A., Lagergård, T., Trollfors, B. (1988). Development of serum
antibodies of the immunoglobulin G class and subclasses against the capsular
polysaccharide of Haemophilus influenzae type b in children and adults with
invasive infections. J Clin Microbiol 26(12): 2549-2553.
Confer, A.W. (2009). Update on bacterial pathogenesis in BRD. Anim Health Res
Rev 10(2): 145–148.
Confer, A.W., Ayalew, S., Panciera, R.J., Montelongo, M., Wray, J.H. (2006).
Recombinant Mannheimia haemolytica serotype 1 outer membrane protein PlpE
enhances commercial M. haemolytica vaccine-induced resistance against serotype
6 challenge. Vaccine 24(13): 2248-2255.
Dabo, S.M., Confer, A., Montelongo, M., York, P., Wyckoff III, J.H. (2008a).
Vaccination with Pasteurella multocida recombinant OmpA induces strong but
non-protective and deleterious Th2-type immune response in mice. Vaccine 26:
4345-4351.
Dabo, S.M., Taylor, J.D., Confer, A.W. (2008b). Pasteurella multocida and
bovine respiratory disease. Anim Health Res Rev 8: 129-150.
Day, M.J. and Schultz, R.D. (2011). Veterinary immunology: principles and
practice. Manson Publishing, London, UK. pp. 192-196.
Dönnes, P. and Elofsson, A. (2002). Prediction of MHC class I binding peptides,
using SVMHC. BMC Bioinformatics 3:25.
90
Doroud, D., Vatanara, A., Zahedifard, F., Gholami, E., Vahabpour, R.,
Najafabadi, A.R., Rafati, S. (2010). Cationic solid lipid nanoparticles loaded by
cysteine proteinase genes as a novel anti-leishmaniasis DNA vaccine delivery
system: characterization and in vitro evaluations. J Pharm Pharmaceut Sci 13:
320-335.
Dowling, A., Hodgson, J.C., Schock, A., Donachie, W., Eckersall, P.D.,
Mckendrick, I.J. (2002). Experimental induction of pneumonic pasteurellosis in
calves by intratracheal infection with Pasteurella multocida biotype A:3. Res Vet
Sci 73(1): 37-44.
Duff, G.C. and Galyean, M.L. (2007). Recent advances in management of
highly stressed, newly received feedlot cattle. J Anim Sci 85: 823-840.
Edelman, R. (2000). An overview of adjuvant use. In: Vaccine adjuvants:
preparation methods and research protocols. Edited by O’Hagan D.T. Humana
Press, New Jersey, USA. pp. 1-28.
Elgert, K.D. (2009). Immunology: understanding the immune system. Wiley-
Blackwell, New Jersey, USA.
Ellis, J.A. (2009). Update on viral pathogenesis in BRD. Anim Health Res Rev
10(2): 149–153.
Fuller, T.E., Kennedy, M.J., Lowery, D.E. (2000). Identification of Pasteurella
multocida virulence genes in a septicemic mouse model using signature-tagged
mutagenesis. Microb Pathog 29(1): 25-38.
Garmory, H.S., Brown, K.A., Titball, R.W. (2003). DNA vaccines: improving
expression of antigens. Genet Vaccines Ther 1(1): 2.
91
Garrido, M.E., Bosch, M., Bigas, A., Badiola, I., Barbé, J., Llagostera, M.
(2008). Heterologous protective immunization elicited in mice by Pasteurella
multocida fur ompH. Int Microbiol 11(1): 17-24.
Gatto, N.T., Dabo, S.M., Hancock, R.E., Confer, A.W. (2002). Characterization
of, and immune responses of mice to, the purified OmpA-equivalent outer
membrane protein of Pasteurella multocida serotype A:3 (Omp28). Vet Microbiol
87: 221-235.
Geertsema, R.S., Zekarias, B., La Franco Scheuch, L., Worby, C., Russo, R.,
Gershwin, L.J., Herdman, D.S., Lo, K., Corbeil, L.B. (2011). IbpA DR2
subunit immunization protects calves against Histophilus somni pneumonia.
Vaccine 29(29-30): 4805-4812.
Gentil, F., Bargieri, D.Y., Leite, J.A., Françoso, K.S., Patricio, M.B.,
Espíndola, N.M., Vaz, A.J., Palatnik-de-Sousa, C.B., Rodrigues, M.M., Costa,
F.T., Soares, I.S. (2010). A recombinant vaccine based on domain II of
Plasmodium vivax Apical Membrane Antigen 1 induces high antibody titres in
mice. Vaccine 28: 6183-6190.
Gupta, R.K. and Rost, B.E. (2000). Aluminum compounds as vaccine adjuvants.
In: Vaccine adjuvants: preparation methods and research protocols. Edited by
O’Hagan D.T. Humana Press, New Jersey, USA. pp. 65-90.
Hanahan D. (1985). Techniques for transformation of E. coli. In: DNA Cloning,
Vol 1. Edited by Glover, D. IRL Press Oxford, UK. pp. 109–135.
Harper, M., Boyce, J.D., Adler, B. (2006). Pasteurella multocida pathogenesis:
125 years after Pasteur. FEMS Microbiol Lett 265(1): 1-10.
92
Harper, M., Boyce, J.D., Wilkie, I.W., Adler, B. (2003). Signature-tagged
mutagenesis of Pasteurella multocida identifies mutants displaying differential
virulence characteristics in mice and chickens. Infect Immun 71(9): 5440-5446.
Harper, M., Cox, A.D., Adler, B., Boyce, J.D. (2011). Pasteurella multocida
lipopolysaccharide: The long and the short of it. Vet Microbiol
doi:10.1016/j.vetmic.2011.05.022
Hatfaludi, T., Al-Hasani, K., Boyce, J.D., Adler, B. (2010). Outer membrane
proteins of Pasteurella multocida. Vet Microbiol 144(1-2): 1-17.
He, Y., Xiang, Z., Mobley, H.L. (2010). Vaxign: the first web-based vaccine
design program for reverse vaccinology and applications for vaccine
development. J Biomed Biotechnol 2010: 297505.
Heddleston, K.L., Gallagher, J.E., Rebers, P.A. (1972). Fowl cholera: gel
diffusion precipitin test for serotyping Pasteruella multocida from avian species.
Avian Dis 16(4): 925-936.
Hsuan, S.L., Liao, C.M., Huang, C., Winton, J.R., Chen, Z.W., Lee, W.C.,
Liao, JW, Chen, T.H., Chiou, C.J., Yeh, K.S., Chien, M.S. (2009). Efficacy of
a novel Pasteurella multocida vaccine against progressive atrophic rhinitis of
swine. Vaccine 27(22): 2923-2929.
Huang, M.H., Lin, S.C., Hsiao, C.H., Chao, H.J., Yang, H.R., Liao, C.C.,
Chuang, P.W., Wu, H.P., Huang, C.Y., Leng, C.H., Liu, S.J., Chen, H.W.,
Chou, A.H., Hu, A.Y., Chong, P. (2010). Emulsified nanoparticles containing
inactivated influenza virus and CpG oligodeoxynucleotides critically influences
the host immune responses in mice. PLoS One 5: e12279.
93
Ishiguro, K., Kitajima, T., Kubota, S., Amimoto, K., Oda, K., Fukuyama, S.,
Shimizu, Y. (2005). Experimental infection of calves with Pasteurella multocida
serovar A: 3 isolated in Japan. J Vet Med Sci 67(8): 817-819.
Kieser, T., Bibb, M.J., Buttner, M.J., Chater, K.F., Hopwood, D.A. (2000).
Practical Streptomyces genetics. The John Innes Foundation, Norwich, England.
Klinman, D.M., Currie, D., Gursel, I., Verthelyi, D. (2004). Use of CpG
oligodeoxynucleotides as immune adjuvants. Immunol Rev 199:201-216.
Korde, J.P., Srivastava, R.S., Mishra, S.C., Sharma, A.K. (2005). Time
dependent immunomodulatory response of exogenous melatonin to killed
Pasteurella multocida (P52 strain) vaccine in albino rats. Indian J Physiol
Pharmacol 49: 227-235.
Koslap-Petraco, M.B., Hackley, B. (2011). Immunizations. In: Pharmacology
for women’s health. Edited by King, T.L. and Brucker, M.C. Jones and Bartlett
Publishers, USA. pp. 128-130.
Kothari, H., Kumar, P., Singh, N. (2006). Prokaryotic expression, purification,
and polyclonal antibody production against a novel drug resistance gene of
Leishmania donovani clinical isolate. Protein Expr Purif 45(1): 15-21.
Laemmli, U.K. (1970). Cleavage of structural proteins during the assembly of the
head of bacteriophage T4. Nature 227: 680–685.
Larsen, K.C., Spencer, A.J., Goodman, A.L., Gilchrist, A., Furze, J., Rollier,
C.S., Kiss-Toth, E., Gilbert, S.C., Bregu, M., Soilleux, E.J., Hill, A.V., Wyllie,
D.H. (2009). Expression of tak1 and tram induces synergistic pro-inflammatory
signalling and adjuvants DNA vaccines. Vaccine 27: 5589-5598.
94
Lee, J., Kim, Y.B., Kwon, M. (2007). Outer membrane protein H for protective
immunity against Pasteurella multocida. J Microbiol 45: 179-184.
Lefeber, D.J., Benaissa-Trouw, B., Vliegenthart, J.F.G., Kamerling, J.P.,
Jansen, W.T.M., Kraaijeveld, K., Snippe, H. (2003). Th1-directing adjuvants
increase the immunogenicity of oligosaccharide-protein conjugate vaccines
related to Streptococcus pneumoniae type 3. Infect Immun 71: 6915-6920.
Liang, R., van den Hurk, J.V., Babiuk, L.A., van Drunen Littel-van den
Hurk, S. (2006). Priming with DNA encoding E2 and boosting with E2 protein
formulated with CpG oligodeoxynucleotides induces strong immune responses
and protection from Bovine viral diarrhea virus in cattle. J Gen Virol 87: 2971-
2982.
Liang, R., van den Hurk, J.V., Landi, A., Lawman, Z., Deregt, D., Townsend,
H., Babiuk, L.A., van Drunen Littel-van den Hurk, S. (2008). DNA prime
protein boost strategies protect cattle from bovine viral diarrhea virus type 2
challenge. J Gen Virol 89: 453-466.
Lo, M., Boyce, J.D., Wilkie, I.W., Adler, B. (2004). Characterization of two
lipoproteins in Pasteurella multocida. Microbes Infect 6(1): 58-67.
Lund, O., Nielsen, M., Lundegaard, C., Keşmir, C., Brunak, S. (2005).
Immunological bioinformatics. MIT Press, Cambridge, USA. pp. 204-208.
Luo, Y., Glisson, J.R., Jackwood, M.W., Hancock, R.E., Bains, M., Cheng,
I.H., Wang, C. (1997). Cloning and characterization of the major outer
membrane protein gene (ompH) of Pasteurella multocida X-73. J Bacteriol 179:
7856-7864.
95
Lycke, N. (2007). Mechanisms of adjuvant action. In: Vaccine adjuvants and
delivery systems. Edited by Singh, M. Wiley-Interscience, New Jersey, USA. pp.
53-80.
Mak, T.W. and Saunders, M.E. (2008). Primer to the immune response.
Academic Press, Elsevier Inc., UK. pp. 228-233.
Makidon, P.E., Bielinska, A.U., Nigavekar, S.S., Janczak, K.W., Knowlton,
J., Scott, A.J., Mank, N., Cao, Z., Rathinavelu, S., Beer, M.R., Wilkinson,
J.E., Blanco, L.P., Landers, J.J., Baker, J.R. Jr. (2008). Pre-clinical evaluation
of a novel nanoemulsion-based hepatitis B mucosal vaccine. PLoS One 3: e2954.
May, B.J., Zhang, Q., Li, L.L., Paustian, M.L., Whittam, T.S., Kapur, V.
(2001). Complete genomic sequence of Pasteurella multocida, Pm70. Proc Natl
Acad Sci USA 98(6): 3460-3465.
Mitchison, M., Wei, L., Kwang, J., Wilkie, I., Adler, B. (2000). Overexpression
and immunogenicity of the Oma87 outer membrane protein of Pasteurella
multocida. Vet Microbiol 72(1-2): 91-96.
Miyazawa, M., Kitadokoro, K., Kamitani, S., Shime, H., Horiguchi, Y.
(2006). Crystallization and preliminary crystallographic studies of the Pasteurella
multocida toxin catalytic domain. Acta Crystallogr Sect F Struct Biol Cryst
Commun 62(Pt 9): 906-908.
Mohd Yasin, I.S., Mohd Yusoff, S., Mohd, Z.S., Abd Wahid Mohd, E. (2011).
Efficacy of an inactivated recombinant vaccine encoding a fimbrial protein of
Pasteurella multocida B:2 against hemorrhagic septicemia in goats. Trop Anim
Health Prod 43(1): 179-187.
96
Mora, M., Donati, C., Medini, D., Covacci, A., Rappuoli, R. (2006). Microbial
genomes and vaccine design: refinements to the classical reverse vaccinology
approach. Curr Opin Microbiol 9(5): 532-536.
Mutters, R., Ihm, P., Pohl, S., Frederiksen, W., Mannheim, W. (1985).
Reclassification of the genus Pasteurella Trevisan 1887 on the basis of
deoxyribonucleic acid homology, with proposals for the new species Pasteurella
dagmatis, Pasteurella canis, Pasteurella stomatis, Pasteurella anatis, and
Pasteurella langaa. Int J Syst Bacteriol 35(3): 309-322.
Nielsen, M., Lundegaard, C., Lund, O. (2007). Prediction of MHC class II
binding affinity using SMM-align, a novel stabilization matrix alignment method.
BMC Bioinformatics 8: 238.
Ott, G. and van Nest, G. (2007). Development of vaccine adjuvants: a historical
perspective. In: Vaccine adjuvants and delivery systems. Edited by Singh, M.
Wiley-Interscience, New Jersey, USA. pp. 1-32.
Petersen, S.K., Foged, N.T., Bording, A., Nielsen, J.P., Riemann, H.K.,
Frandsen, P.L. (1991). Recombinant derivatives of Pasteurella multocida toxin:
candidates for a vaccine against progressive atrophic rhinitis. Infect Immun 59(4):
1387-1393.
Praveena, P.E., Periasamy, S., Kumar, A.A., Singh, N. (2010). Cytokine
profiles, apoptosis and pathology of experimental Pasteurella multocida serotype
A1 infection in mice. Res Vet Sci 89: 332-339.
Preuss, I., Kurig, B., Nürnberg, B., Orth, J.H., Aktories, K. (2009).
Pasteurella multocida toxin activates Gβγ dimers of heterotrimeric G proteins.
Cell Signal 21(4): 551-558.
97
Puchalski, A., Dec, M., Wernicki, A., Urban-Chmiel, R., Gieral, A. (2010).
Characterization of outer membrane proteins participating in iron transport in
Pasteurella multocida serotype A3. Pol J Vet Sci 13(1): 121-127.
Pullinger, G.D. and Lax, A.J. (2007). Histidine residues at the active site of the
Pasteurella multocida toxin. Open Biochem J 1: 7-11.
Pullinger, G.D., Sowdhamini, R., Lax, A.J. (2001). Localization of functional
domains of the mitogenic toxin of Pasteurella multocida. Infect Immun 69(12):
7839-7850.
Rahman, O., Cummings, S.P., Harrington D.J., Sutcliffe, I.C. (2008). Methods
for the bioinformatic identification of bacterial lipoproteins encoded in the
genomes of Gram-positive bacteria. World J Microbiol Biotechnol 24(11): 2377-
2382.
Rappuoli, R. (2001). Reverse vaccinology, a genome-based approach to vaccine
development. Vaccine 19: 2688–2691.
Reche, P.A., Zhang, H., Glutting, J.P., Reinherz, E.L. (2005). EPIMHC: a
curated database of MHC-binding peptides for customized computational
vaccinology. Bioinformatics 21(9): 2140-2141.
Register, K.B., Sacco, R.E., Brockmeier, S.L. (2007). Immune response in mice
and swine to DNA vaccines derived from the Pasteurella multocida toxin gene.
Vaccine 25: 6118-6128.
Rodriguez, F., Harkins, S., Redwine, J.M., de Pereda, J.M., Whitton, J.L.
(2001). CD4+ T cells induced by a DNA vaccine: immunological consequences of
epitope-specific lysosomal targeting. J Virol 75: 10421-10430.
98
Rojo-Montejo, S., Collantes-Fernández, E., Regidor-Cerrillo, J., Rodríguez-
Bertos, A., Prenafeta, A., Gomez-Bautista, M., Ortega-Mora, L.M. (2011).
Influence of adjuvant and antigen dose on protection induced by an inactivated
whole vaccine against Neospora caninum infection in mice. Vet Parasitol 175:
220-229.
Ruffolo, C. and Adler, B. (1996). Cloning, sequencing, expression, and
protective capacity of the oma87 gene encoding the Pasteurella multocida 87-
kilodalton outer membrane antigen. Infect Immun 64(8): 3161-3167.
Saitou, N. and Nei, M. (1987). The neighbor-joining method: A new method for
reconstructing phylogenetic trees. Mol Biol Evol 4: 406–425.
Sakano, T., Okada, M., Taneda, A., Mukai, T., Sato, S. (1997). Effect of
Bordetella bronchiseptica and serotype D Pasteurella multocida bacterin-toxoid
on the occurrence of atrophic rhinitis after experimental infection with B.
bronchiseptica and toxigenic type A P. multocida. J Vet Med Sci 59(1): 55-57.
Seo, J., Pyo, H., Lee, S., Lee, J., Kim, T. (2009). Expression of 4 truncated
fragments of Pasteurella multocida toxin and their immunogenicity. Can J Vet
Res 73(3): 184-189.
Singh, A.P., Singh, S., Ranjan, R., Gupta, S.K., Singh, V.P., Sharma, B.
(2010). Molecular heterogeneity of plpE gene in Indian isolates of Pasteurella
multocida and expression of recombinant PlpE in vaccine strain of P. multocida
serotype B:2. J Vet Sci 11: 227-233.
Singh, M. (2007). Vaccine adjuvants and delivery systems. Wiley-Interscience,
New Jersey, USA.
99
Sneath, P.H.A. (1982). Status of nomenclatural types in the approved lists of
bacterial names: Request for an opinion. Int J Syst Bacteriol 32(4): 459-460.
Soehnlen, M.K., Aydin, A., Lengerich, E.J., Houser, B.A., Fenton, G.D.,
Lysczek, H.R., Burns, C.M., Byler, L.I., Hattel, A.L., Wolfgang, D.R.,
Jayarao, B.M. (2011a). Blinded, controlled field trial of two commercially
available Mycoplasma bovis bacterin vaccines in veal calves. Vaccine 29(33):
5347-5354.
Soehnlen, M.K., Tran, M.A., Lysczek, H.R., Wolfgang, D.R., Jayarao, B.M.
(2011b). Identification of novel small molecule antimicrobials targeting
Mycoplasma bovis. J Antimicrob Chemother 66(3): 574-577.
Srikumaran, S., Kelling, C.L., Ambagala, A. (2007). Immune evasion by
pathogens of bovine respiratory disease complex. Anim Health Res Rev 8(2): 215-
229.
St Michael, F., Vinogradov, E., Cox, A.D. (2011). Structural analyses of the
core oligosaccharide from the lipopolysaccharide of bovine and ovine strains of
Mannheimia haemolytica serotype 2. Carbohydr Res 346(11): 1333-1336.
Steen, J.A., Steen, J.A., Harrison, P., Seemann, T., Wilkie, I., Harper, M.,
Adler, B., Boyce, J.D. (2010). Fis is essential for capsule production in
Pasteurella multocida and regulates expression of other important virulence
factors. PLoS Pathog 6(2): e1000750.
Sthitmatee, N., Numee, S., Kawamoto, E., Sasaki, H., Yamashita, K.,
Takahashi, N., Kataoka, Y., Sawada, T. (2008). Protection of chickens from
fowl cholera by vaccination with recombinant adhesive protein of Pasteurella
multocida. Vaccine 26: 2398-2407.
100
Takada-Iwao, A., Uto, T., Mukai, T., Okada, M., Futo, S., Shibata, I. (2007).
Evaluation of an indirect enzyme-linked immunosorbent assay (ELISA) using
recombinant toxin for detection of antibodies against Pasteurella multocida toxin.
J Vet Med Sci 69(6): 581-586.
Tamura, K., Dudley, J., Nei, M., Kumar, S. (2007). MEGA4: Molecular
Evolutionary Genetics Analysis (MEGA) software version 4.0. Mol Biol Evol 24:
1596–1599.
Tan, H.Y., Nagoor, N.H., Sekaran, S.D. (2010). Cloning, expression and
protective capacity of 37 kDa outer membrane protein gene (ompH) of
Pasteurella multocida serotype B:2. Trop Biomed 27: 430-441.
Tang, D.C., DeVit, M., Johnston, S.A. (1992). Genetic immunization is a simple
method for eliciting an immune response. Nature 356(6365): 152-154.
Tatum, F.M., Yersin, A.G., Briggs, R.E. (2005). Construction and virulence of a
Pasteurella multocida fhaB2 mutant in turkeys. Microb Pathog 39(1-2): 9-17.
Taylor, J.D., Fulton, R.W., Lehenbauer, T.W., Step, D.L., Confer, A.W.
(2010a). The epidemiology of bovine respiratory disease: what is the evidence for
predisposing factors? Can Vet J 51(10): 1095-1102.
Taylor, J.D., Fulton, R.W., Lehenbauer, T.W., Step, D.L., Confer, A.W.
(2010b). The epidemiology of bovine respiratory disease: what is the evidence for
preventive measures? Can Vet J 51(12): 1351-1359.
Towbin, H., Staehelin, T., Gordon, J. (1979). Electrophoretic transfer of
proteins from polyacrylamide gels to nitrocellulose sheets: procedure and some
applications. Proc Natl Acad Sci USA 76: 4350-4354.
101
Ülbegi-Mohyla, H., Hijazin, M., Alber, J., Lämmler, C., Hassan, A.A.,
Abdulmawjood, A., Prenger-Berninghoff, E., Weiss, R., Zschöck, M. (2010).
Identification of Arcanobacterium pyogenes isolated by post mortem
examinations of a bearded dragon and a gecko by phenotypic and genotypic
properties. J Vet Sci 11(3): 265-267.
van Drunen Littel-van den Hurk, S., Lawman, Z., Wilson, D., Luxembourg,
A., Ellefsen, B., van den Hurk, J.V., Hannaman, D. (2010). Electroporation
enhances immune responses and protection induced by a bovine viral diarrhea
virus DNA vaccine in newborn calves with maternal antibodies. Vaccine 28(39):
6445-6454.
Verma R. and Jaiswal, T.N. (1997). Protection, humoral and cell-mediated
immune responses in calves immunized with multiple emulsion haemorrhagic
septicaemia vaccine. Vaccine 15: 1254-1260.
Watanabe, S.Y., Albsoul-Younes, A.M., Kawano, T., Itoh, H., Kaziro, Y.,
Nakajima S., Nakajima, Y. (1999). Calcium phosphate-mediated transfection of
primary cultured brain neurons using GFP expression as a marker: application for
single neuron electrophysiology. Neurosci Res 33: 71-78.
Watt, J.M., Swiatlo, E., Wade, M.M., Champlin, F.R. (2003). Regulation of
capsule biosynthesis in serotype A strains of Pasteurella multocida. FEMS
Microbiol Lett 225(1): 9-14.
Welsh, R.D., Dye, L.B., Payton, M.E., Confer, A.W. (2004). Isolation and
antimicrobial susceptibilities of bacterial pathogens from bovine pneumonia:
1994-2002. J Vet Diagn Invest 16: 426-431.
102
Wildman, B.K., Perrett, T., Abutarbush, S.M., Guichon, P.T., Pittman, T.J.,
Booker, C.W., Schunicht, O.C., Fenton, R.K., Jim, G.K. (2008). A comparison
of 2 vaccination programs in feedlot calves at ultra-high risk of developing
undifferentiated fever/bovine respiratory disease. Can Vet J 49: 463-472.
Wolff, J.A., Malone, R.W., Williams, P., Chong, W., Acsadi, G., Jani, A.,
Felgner, P.L. (1990). Direct gene transfer into mouse muscle in vivo. Science
247(4949 Pt 1): 1465-1468.
Wu, J.R., Shien, J.H., Shieh, H.K., Chen, C.F., Chang, P.C. (2007). Protective
immunity conferred by recombinant Pasteurella multocida lipoprotein E (PlpE).
Vaccine 25: 4140-4148.
Xue, W., Mattick, D., Smith, L. (2011). Protection from persistent infection with
a bovine viral diarrhea virus (BVDV) type 1b strain by a modified-live vaccine
containing BVDV types 1a and 2, infectious bovine rhinotracheitis virus,
parainfluenza 3 virus and bovine respiratory syncytial virus. Vaccine 29: 4657-
4662.
Yu, N.Y., Wagner, J.R., Laird, M.R., Melli, G., Rey, S., Lo, R., Dao, P.,
Sahinalp, S.C., Ester, M., Foster, L.J., Brinkman, F.S.L. (2010) PSORTb 3.0:
Improved protein subcellular localization prediction with refined localization
subcategories and predictive capabilities for all prokaryotes. Bioinformatics
26(13): 1608-1615.
Zhu, L., Liu, H.F., Lu, M.B., Long, Q.K., Shi, Y.E., Yu, L.J. (2011).
Construction, purification, and evaluation of multivalent DNA vaccine against
Schistosoma japonicum. Parasitol Res 108: 115-121.
103
APPENDIX A
STRUCTURES OF PLASMID VECTORS AND SIZE
MARKERS
Figure A1. pGEM®
-T Easy Cloning Vector (Promega #A1360)
104
Figure A2. pCMV-LII DNA Vaccine Vector
Figure A3. pET-28a(+) His-tag Expression Vector (Novagen #69864-3)
105
Figure A4. PageRuler™
Plus Prestained Protein Ladder (Fermentas #SM1811) (A)
and Unstained Protein Molecular Weight Marker (Fermentas #SM0431) (B).
Figure A5. Lambda DNA/PstI Marker (Fermentas #SM0361)
kDa A B
106
APPENDIX B
COMPOSITION AND PREPARATION OF CULTURE MEDIA
B1. Luria Broth:
Tryptone 10 g
Yeast Extract 5 g
NaCl 10 g
Distilled water up to 1000 ml
Final pH is 7.0; sterilized at 121oC for 15 min.
B2. Luria Agar:
Tryptone 10 g
Yeast Extract 5 g
NaCl 10 g
Agar 15 g
Distilled water up to 1000 ml
Final pH is 7.0; sterilized at 121oC for 15 min.
B3. Brain-Heart Infusion Broth:
Nutrient substrate 27.5 g
D(+)Glucose 2 g
NaCl 5 g
Na2HPO4 2.5 g
107
Distilled water up to 1000 ml
Final pH is 7.5; sterilized at 121oC for 15 min.
B4. Blood Agar:
Pancreatic casein 15 g
Papaic digest of soy flour 5 g
NaCl 5 g
Agar 15 g
Sheep blood (v/v) 5%
Distilled water up to 1000 ml
Final pH is 7.3; sterilized at 121oC for 15 min.
108
APPENDIX C
SOLUTIONS AND BUFFERS
C1. Agarose Gel Electrophoresis
C1.1. TAE Buffer (50X)
Tris-base 242 g
Glacial acetic acid 57.1 mL
EDTA (0.5 M, pH 8.0) 100 mL
Distilled water up to 1000 mL
C1.2. Loading Buffer (10X)
Bromophenol blue (w/v) 0.25%
Xylene cyanol FF (w/v) 0.25%
Sucrose (w/v) 40%
C2. SDS-Polyacrylamide Gel Electrophoresis (PAGE)
C2.1. Acrylamide/Bis
Acrylamide 146 g
N.N’-Methylene-bis acrylamide 4 g
Distilled water up to 500 mL
Filtered and stored at 4°C. Protected form light.
109
C2.2. Tris HCl (1.5 M)
Tris-base 54.45 g
Distilled water 150 ml
pH is adjusted to 8.8 with HCl, distilled water to 300 ml and stored at 4°C.
C2.3. Tris HCl (0.5 M)
Tris-base 6 g
Distilled water 60 ml
pH is adjusted to 6.8 with HCl, distilled water to 100 ml and stored at 4°C.
C2.4. Running Buffer (10X)
Tris-base 30 g
Glycine 144 g
SDS 10 g
Distilled water up to 1000 ml
C2.5. Sample Loading Buffer (4X)
Tris-HCl (1 M, pH 6.8) 2 ml
EDTA (0.5 M) 1 ml
Glycerol 4 ml
SDS 0.8 g
β-mercaptoethanol 0.4 ml
Bromophenol blue 0.008 g
Distilled water up to 10 ml
C2.6. Fixation Solution
Ethanol 40%
Glacial acetic acid 10%
Distilled water 50%
110
C2.7. Coomassie Blue R-250 Stain
Coomassie Blue R-250 0.25 g
Methanol 125 ml
Glacial acetic acid 25 ml
Distilled water 100 ml
C2.8. Destaining Solution
Methanol 100 ml
Glacial acetic acid 100 ml
Distilled water 800 ml
C3. Western Blot
C3.1. Transfer Buffer (1X)
Methanol 200 ml
Tris-base 3.63 g
Glycine 14.4 g
SDS 0.37 g
Distilled water up to 1000 ml
C3.2. Tris-buffered Saline, TBS (1X)
Tris-base 2.42 g
NaCl 29.2 g
Distilled water up to 1000 ml
111
C4. Protein Purification
C4.1. LEW (Lysis-Elution-Wash) Buffer (pH 8.0)
Urea 8 M
NaCl 300 mM
NaH2PO4 50 mM
C4.2. DB (Dialysis Buffer, pH 8.0)
NaH2PO4 50 mM
NaCl 500 mM
Urea 4 M
C5. E. coli Competent Cell Preparation
C5.1. Buffer 1
RuCl 100 mM
KAc 30 mM
CaCl2 10 mM
Glycerol 15%
pH is adjusted to 5.8 with dilute acetic acid and filter sterilized.
C5.2. Buffer 2
CaCl2 75 mM
RuCl 10 mM
MOPS 10 mM
Glycerol 15%
pH is adjusted to 6.5 with 0.2 M KOH and filter sterilized.
112
C6. IPTG (Isopropyl-β-D-thiogalactoside) for Colony Selection
IPTG 100 mg
Distilled water 1 ml
The solution was filter sterilized and stored at –20°C.
C7. X-Gal (5-bromo-4-chloro-3-indolyl-B-D-galactoside)
X-Gal 20 mg
Dimethylformamide 1 ml
The solution was stored at –20°C protected from light.
C8. Plasmid Isolation
C8.1. STE Buffer
Sucrose (w/v) 10.3%
Tris-HCl (pH 8.0) 25 mM
EDTA (pH 8.0) 25 mM
C8.2. Lysis Buffer
NaOH 0.3 M
SDS (w/v) 2%
C9. ELISA for Detection of Antibody Titers
C9.1. Carbonate/Bicarbonate Buffer (0.05 M)
Na2CO3 1.59 g
NaHCO3 3.88 g
Distilled water up to 1000 ml
pH is adjusted to 9.6 and stored at 4oC.
113
C9.2. Washing Solution (1X PBS - 0.1% Tween-20)
NaCl 8 g
KCl 0.2 g
Na2HPO4 1.44 g
KH2PO4 0.24 g
Tween-20 1 ml
Distilled water up to 1000 ml
pH is adjusted to 7.2 and stored at 4oC.
C9.3. Blocking Solution
2% (w/v) BSA in 1X PBS - 0.1% Tween-20.
C10. ELISA for Detection of Serum IFN-γ Titers
C10.1. Coating Buffer (1X PBS)
NaCl 8 g
KCl 0.2 g
Na2HPO4 1.44 g
KH2PO4 0.24 g
Distilled water up to 1000 ml
pH is adjusted to 7.4 and stored at 4oC.
C10.2. Blocking Buffer
4% (w/v) BSA and 5% (w/v) sucrose in 1X PBS.
C10.3. Assay Buffer
2% (w/v) BSA in 1X PBS.
114
C10.4. Wash Buffer (1X PBS-0.2% Tween-20)
NaCl 8 g
KCl 0.2 g
Na2HPO4 1.44 g
KH2PO4 0.24 g
Tween-20 2 ml
Distilled water up to 1000 ml
pH is adjusted to 7.4 and stored at 4oC.
C10.5. Stop Solution
0.18 M sulfuric acid.
115
APPENDIX D
SUPPLIERS OF CHEMICALS, ENZYMES AND KITS
D1. Chemicals Suppliers
Acrylamide Sigma
Agar-agar Merck
Agarose Biomax (Prona)
Ammonium persulfate AppliChem
Ampicillin Sigma
Anti-mouse IgG Sigma
Bovine serum albumin Sigma
Brain Heart Broth Merck
Bromophenol blue Merck
CaCl2.2H2O Merck
Coomassie Blue G-250 Fluka
Coomassie Blue R-250 Fluka
Dimethylformamide Merck
dNTPs Fermentas
DTT Fluka
Dulbecco's modified Eagle's medium Biochrom
EDTA Sigma
Ethanol Sigma
Ethidium bromide Sigma
Fetal bovine serum Biochrom
116
Formaldehyde Merck
Glacial acetic acid Merck
Glycerol Merck
Glycine Merck
H2SO4 Merck
HCl Merck
IPTG Sigma
Isopropanol Merck
Kanamycin Sigma
KCl Merck
KH2PO4 Merck
Luria Broth Merck
Methanol Merck
MnCl2 Merck
MOPS AppliChem
N.N’-Methylene-bis acrylamide Sigma
Na2CO3 Merck
Na2HPO4 Merck
NaCl Sigma
NaHCO3 Merck
NaOH Merck
Non-essential amino acids Biochrom
Penicillin/streptomycin Biochrom
Phenol/chloroform/isoamylalcohol Amresco
Phosphoric acid Merck
Potassium acetate Merck
RuCl Merck
SDS Merck
Skim milk Fluka
Streptavin-HRP Pierce
Sucrose Merck
117
TEMED Merck
TMB Thermo Sci
Tris-base Sigma
Tris-HCl Fluka
Tween-20 Merck
Urea Sigma
X-gal Sigma
Xylene cyanol FF Merck
2-mercaptoethanol Merck
D2. Enzymes
Alkaline phosphatase Roche
BamHI Fermentas
BglII Fermentas
EcoRI Fermentas
HindIII Fermentas
NotI Fermentas
T4 DNA ligase Fermentas
Taq DNA polymerase Fermentas
D3. Kits
AP Conjugate Substrate Kit Bio-Rad
Endofree Plasmid Mega Kit Qiagen
FuGENE 6 Transfection Reagent Roche
Gel Extraction Kit Qiagen
Mouse IFN-γ Minikit Pierce
Ni-NTA Spin Columns Qiagen
pGEMT Easy Vector Promega
Plasmid Midi Kit Qiagen
Plasmid Mini Kit Qiagen
Protino Ni-TED 2000 Packed Columns Macherey-Nagel
118
CURRICULUM VITAE
PERSONAL INFORMATION
Surname, Name: Okay, Sezer
Nationality: Turkish
Date and Place of Birth: 3 June 1980, Mersin
Marital Status: Single
Phone: +90 312 210 51 90
Fax: +90 312 210 79 76
E-mail: [email protected], [email protected]
EDUCATION
Degree Institution Year of Graduation
M. Sc. METU Biology 2005
B. Sc. Anadolu University Biology 2002
WORK EXPERIENCE
Year Place Enrollment
2002-2011 METU Biology Research Assistant
FOREIGN LANGUAGES
Advanced English, Fluent Spanish
PUBLICATIONS
Theses:
M. Sc. Thesis: Cloning of chitinase A (chiA) gene of Serratia marcescens Bn10
and its expression in Coleoptera-specific Bacillus thuringiensis.
B. Sc. Thesis: Kekik (Origanum onites) yağının mutajenik ve antimutajenik
etkisisnin Ames Testi ile değerlendirilmesi.
119
Research Articles:
1. Okay, S., Özcengiz, E., Gürsel, İ., Özcengiz, G. Immunogenicity and protective
efficacy of the recombinant PlpE and OmpH from Pasteurella multocida A:3 in
mice. Clinical and Vaccine Immunology (submitted).
2. Okay, S., Özcengiz, G. (2011). Molecular cloning, characterization and
homologous expression of an endochitinase gene from Bacillus thuringiensis
serovar morrisoni. Turkish Journal of Biology 35: 1-7.
3. Özcengiz, G., Okay, S., Ünsaldı, E., Taşkın, B., Liras, P., Piret, J. (2010).
Homologous expression of aspartokinase (ask) gene in Streptomyces clavuligerus
and its hom-deleted mutant: Effects on cephamycin C production. Bioengineered
Bugs 1 (3): 191-197.
4. Okay, S., Tefon, B.E., Ozkan M. and Ozcengiz, G. (2008). Expression of
chitinase A (chiA) gene from a local isolate of Serratia marcescens in Coleoptera-
specific Bacillus thuringiensis. Journal of Applied Microbiology 104: 161-170.
5. Ipek, E., Zeytinoglu, H., Okay, S., Tuylu, B.A., Kurkcuoglu M. and Baser,
K.H.C. (2005). Genotoxicity and antigenotoxicity of Origanum oil and carvacrol
evaluated by Ames Salmonella/microsomal test. Food Chemistry 93(3): 551-556.
International Congress Presentations:
Oral presentation:
1. Okay, S., Özcengiz, E., Özcengiz, G. (2010). Development of new vaccine
strategies against Pasteurella multocida. Prato Conference on the Pathogenesis of
Bacterial Diseases of Animals (6-9 October 2010, Prato, Italy). Abstract Book p.
47.
Poster presentations:
1. Okay, S., Ipek, E., Zeytinoğlu, H., Kurkcuoğlu, M. (2003). Antimutagenicity
testing of Origanum oil and carvacrol in the Ames assay. 13th Balkan
Biochemical Biophysical Days & Meeting on Metabolic Disorders (October 12-
15, 2003 Aydın, Turkey) Programme & Abstracts. Turkish Journal of
Biochemistry 28(3): 140.
2. Okay, S., Ozkan, M. and Ozcengiz, G. (2006). Expression of an endochitinase
(chiA) gene from Serratia marcescens Bn10 in a Cry3A producer Bacillus
thuringiensis. 2nd FEMS Congress of European Microbiologists (July 4-8, 2006
Madrid, Spain) Abstract Book p.124.
120
3. Okay, S. and Ozcengiz, G. (2008). Characterization and homologous
expression of endochitinase gene (chi3023) from Bacillus thuringiensis serovar
morrisoni. XII. International Congress of Bacteriology and Applied Microbiology
(5-9 August 2008, İstanbul, Turkey) Abstract Book p. 75.
4. Ünsaldı, E., Okay, S. and Özcengiz, G. (2008). Cephamycin C overproduction
upon releasing relaxing precursor flux by genetic engineering and medium
formulation. XII. International Congress of Bacteriology and Applied
Microbiology (5-9 August 2008, İstanbul, Turkey) Abstract Book p. 98.
5. Okay, S., Aragon, V., Rosell, R., Pujols, J., Ozcengiz, G., Rodriguez, F. (2009).
Use of FHA from Bordetella bronchiseptica as an adjuvant to improve DNA
vaccination in small and large animals. 3rd annual meeting EPIZONE “Crossing
borders” (12-15 May 2009, Antalya, Turkey) Abstract Book p.137.
6. Okay, S., Ünsaldı, E., Taşkın, B., Kurt, A., Piret, J., Liras, P., Özcengiz, G.
(2009). Metabolic engineering of aspartate pathway for increased production of
cephamycin C in Streptomyces clavuligerus. International Symposium on
Biotechnology: Developments and Trends (27-30 September 2009, METU,
Ankara, Turkey) Abstract Book p. 99.
National Congress Presentations:
Oral presentations:
1. Okay, S., Özcengiz, G. (2007). Bacillus thuringiensis alttür morrisoni kitinaz
geninin karakterizasyonu. 15. Ulusal Biyoteknoloji Kongresi (28-31 Ekim,
Antalya). Bildiri Kitabı Sayfa: 303-304.
2. Ünsaldı, E., Okay, S., Özcengiz, G. (2009). Yabanıl tip Streptomyces
clavuligerus ve hom geni delesyona uğramış mutantında aspartokinaz (ask) geni
çoklu kopyasının homolog ekspresyonu: Hücre içi serbest aminoasit
seviyesindeki değişimler. 16. Ulusal Biyoteknoloji Kongresi (13-16 Aralık,
Antalya). Bildiri Kitabı Sayfa: 314-317.
Poster presentations:
1. Okay, S., Özkan, M., Özcengiz, G. (2005). Kitinaz A geninin Serratia
marcescens'ten klonlanması ve Coleoptera-spesifik Bacillus thuringiensis'te ifade
edilmesi. 14. Ulusal Biyoteknoloji Kongresi (31 Ağustos-2 Eylül, Eskişehir)
Bildiri ve Poster Kitabı Sayfa: 586.
2. Okay, S., Tefon, B.E., Özkan, M., Özcengiz, G. (2007). Serratia marcescens
Kitinaz A Geninin Rekombinant Bacillus thuringiensis'te Ekspresyonunun
Analizi. 15. Ulusal Biyoteknoloji Kongresi (28-31 Ekim, Antalya). Bildiri Kitabı
Sayfa: 44.
121
3. Okay, S., Özcengiz, E., Özcengiz, G. (2009). Pasteurella multocida P-1062
suşuna ait ompH geninin klonlanması ve biyoinformatik analizi. 16. Ulusal
Biyoteknoloji Kongresi (13-16 Aralık, Antalya). Bildiri Kitabı Sayfa: 15.
4. Okay, S., Baloğlu, M.C., Eroğlu, A., Battal, A., Özcengiz, G., Öktem, H.A.,
Yücel, M. (2009). Serratia marcescens’e ait kitinaz A geninin tütün bitkisine
aktarılması. 16. Ulusal Biyoteknoloji Kongresi (13-16 Aralık, Antalya). Bildiri
Kitabı Sayfa: 14-15.
5. Yılmaz, Ç., Okay, S., Tefon, B. E., Özcengiz, E., Özcengiz, G. (2009).
Bordetella pertussis Tohama I ve Saadet suşuna ait PPIase, POMP ve FIMX
genlerinin klonlanması. 16. Ulusal Biyoteknoloji Kongresi (13-16 Aralık 2009,
Antalya) Bildiri Kitabı, sayfa: 71-72.
PROJECTS:
1. Development of new vaccine strategies of utility in animal health (PCI2005-
A7-0092; 2006-2008). Complementary action between Spain and Turkey financed
by Spanish Ministry of Education.
2. Genetik manipulasyonlarla Bacillus thuringiensis alttür tenebrionis'in larvisidal
aktivitesinin ve spektrumunun artırılması. TÜBİTAK TBAG Proje 2413 104T023,
2006: 101
3. Cloning of chitinase A (chiA) gene from Serratia marcescens Bn10 and its
expression in Coleoptera-specific Bacillus thuringiensis (BAP-08-11-DPT-
2002K120510-BTEK12). ÖYP-DPT Project.
RESEARCH ACTIVITY:
Studies on DNA vaccine strategies at CReSA (Animal Health Research Center),
UAB (Autonomous University of Barcelona), Barcelona, Spain; for one year
starting from January 2008 (supervised by Dr. Fernando Rodriguez).
AWARDS/GRANTS:
1. First Honor in B. Sc., Anadolu University, June 2002
2. Graduate Courses Performance Award, METU, 2005-2006 Academic Year
3. TÜBİTAK International Scientific Publication Awards, 2005, 2008, 2011
4. METU Scientific Publication Award, 2008
5. ÖYP Grant for one year research in CreSA, Barcelona, Spain, 2008
6. Travel Grant, VetPath Conference, Prato Italy, 6-9 October 2010