Upload
others
View
3
Download
0
Embed Size (px)
Citation preview
University of Reading School of Animal and Microbial Sciences
Development of Optical Trapping for the Isolation of Environmentally Regulated Genes
By
Neil A Schofield
Submitted in partial fulfilment of the requirement for the degree of doctor of philosophy 1998
II
I declare that this is my own account of my research and that this work has not been
submitted for a degree at any other university. I would like to acknowledge the
assistance of members of the laboratory in picking colonies for the final libraries. I
would like to acknowledge that the early vector construction, particularly pPOT, was
carried out jointly with David Allaway.
Neil A. Schofield
III
Abstract
Colonisation of the rhizosphere and nodulation of legumes by Rhizobium is a complex
process involving the expression of environmentally induced genes. The study of these
genes is important in understanding this symbiotic relationship, however the complexity of
the environment makes it impossible to model in the laboratory. In an attempt to identify
these genes, an adaptation of the in vivo expression technology (IVET) strategy using optical
trapping has been used. IVET allows gene expression to be identified in vivo, removing the
need to model the environment.
Using optical trapping, refractive particles, including cells, observed using a microscope can
be trapped and moved using laser light. An optical trap has been constructed that can trap a
single bacteria and isolate it from the population from which it derived. The single cell can
then be grown in liquid culture and studied.
To identify gene expression, a promoter probe vector, pOT1, has been developed. This
vector uses green fluorescent protein as a marker. This allows the observation of promoter
activity by excitation of GFP produced in the cell, using ultra-violet light. A genomic library
of Rhizobium leguminosarum 3841 (LB-2) has been constructed in this vector and a sub
library (LB-3), with no expression of GFP during growth on minimal media, produced.
Exposure of this sub-library to pea roots and the subsequent trapping of the recovered
Rhizobium lead to the identification of rhizosphere induced genes, including thiE. This gene
is important in thiamine biosynthesis.
IVET-OT is an important development in the identification of rhizosphere expressed genes
and its application to other organisms could provide equally important results.
IV
Acknowledgements
I am indebted to my supervisor, Dr Philip Poole, for his guidance and
encouragement. His positive enthusiasm when all I could see was the negative has
kept me going through these long years.
I am particularly grateful to Arthur Hosie, Judith Fry, Emma Lodwig, Liliana
Gilardoni and Mary Leonard without whose help I would still be picking colonies.
My thanks go to all the members of the lab, both past and present, for making it an
enjoyable place to work. In particular I would like to thank David Allaway, for his
continuous support and for having the same taste in music, and Dave Chapman for
keeping me sane during those long nights in the lab. I would also like to thank David
Walshaw and Colm Reid for getting me into this and then leaving.
I would like to express particular thanks to Tony Dawson, who constructed many of
the strange pieces of equipment I designed. His ability to produce finely crafted
apparatus from my scribbled ideas is a wonder.
I am also grateful to everyone in CSS. Their work is indispensable and very much
appreciated. In particular David Butlin who on numerous occasions has rescued me
from the lab, to share some spectacular days in the mountains.
I would like to thank my parents for their love and support, both financial and
mental, through out this project and in the preceding years. Finally, an especial
thanks to my wife, Kath, for her love and prayers, and for putting up with me being
away for so many months.
V
Abbreviations
Ala Alanine
Am ampicillin
AMS acid minimal salts
bp base pair
Cm chloramphenicol
DNA dioxyribonucleic acid
GFP green fluorescent protein
GFPuv UV optimised green fluorescent protein
Gn gentamycin
He Ne helium neon
hr hour
IR Infra red
IVET in vivo expression technology
IVET-OT in vivo expression technology using optical trapping
Kb kilobase
Kn kanamycin
LB Luria-Bertani broth
Met Methionine
min minute
Ne Yag Neodymium – yttrium aluminium garnet
OD optical density
PCR polymerase chain reaction
Phe Phenylalanine
VI
RNA ribonucleic acid
rpm revolutions per minute
Ser Serine
Sp spectinomycin
St streptomycin
Tc tetracycline
Thr Threonine
TT Transcriptional terminator
TY tryptone-yeast media
UV Ultra violet
Val Valine
XP 5-bromo-4-chloro-3-inodolyl phosphate
VII
CONTENTS
CHAPTER 1: INTRODUCTION 1
1.1 Rhizobium 1 1.1.1 Nodulation 1 1.1.2 The nod genes 2 1.1.3 Nitrogen Fixation 4 1.1.4 Nutrient Exchange in the Nodule 5 1.1.5 Carbon Sources in the Rhizosphere 5
1.2 Competition and survival of Rhizobium in the Rhizosphere 6
1.3 Strategies for Identifying Environmentally Induced Genes 10
1.4 Optical Trapping 16 1.4.1 The Characteristics of Lasers 16 1.4.2 Manipulation of particles using Light 18 1.4.3 Forces in Optical Trapping 20 1.4.4 Uses of optical trapping 26
CHAPTER 2: METHODS 30
2.1 Strains 30
2.2 Plasmids 32
2.3 Oligonucleotide primers 35
2.4 Growth conditions 36 2.4.1 Growth media 36 2.4.2 Antibiotics 36 2.4.3 Microtitre plates 37 2.4.4 Stains and fluorescent observations 38
2.5 Molecular Biology 38 2.5.1 DNA Isolation 38
2.5.1.1 Plasmid preps 38 2.5.1.2 Chromosomal preps 39
2.5.2 Restriction digests 40 2.5.3 Ligations 40 2.5.11 Transformation 41 2.5.4 De-phosphorylation of DNA 41 2.5.5 Removal of 5' single stranded DNA 41 2.5.6 Removal of 3’ single stranded DNA 42 2.5.7 Agarose gels and staining 42 2.5.8 DNA Extractions from Agarose Gels 42 2.5.9 Sequencing 42 2.5.10 Conjugations 43 2.5.12 PCR 43 2.5.13 Linker production 45
2.6 Pea growth 45 2.6.1 Surface sterilisation and Germination 45 2.6.2 Pea Growth in Flasks 45 2.6.3 Pea Growth in Universal bottles 47 2.6.4 Nodule harvesting 47 2.6.5 Rhizosphere harvesting 47
VIII
2.7 Optical Trap 48 2.7.1 Microscope 48 2.7.2 Laser 48 2.7.3 Set Up of trap 48 2.7.4 Objective lens 49 2.7.5 Viewing IR laser 50 2.7.6 Microscope Stage 50 2.7.7 Trapping single cells 50
CHAPTER 3: CONSTRUCTION OF AN OPTICAL TRAP 51
3.1 Introduction 51
3.2 Construction of the Trap-Methods and Results 51 3.2.1 Requirements for an Optical Trap 51 3.2.2 Development of the Trap 54 3.2.3 Alignment of the laser 60 3.2.4 Development of the Trapping Protocol 62 3.2.5 Attenuation of the Laser 65
3.3 Isolation and Culturing of Single Cells 69
3.4 Discussion 72
CHAPTER 4: CONSTRUCTION OF PROMOTER PROBE VECTORS 75
4.1 Introduction 75
4.2 Methods and Results 77 4.2.1 Characterisation of reporter genes for use 77 in IVET-OT 77 4.2.2 Construction of pPOT and pGOT vectors 78
4.2.2.1 Cloning of Omega Transcriptional Terminators 78 4.2.2.2 Cloning of phoA reporter gene 79 4.2.2.3 Cloning of antibiotic markers. 82 4.2.2.4 Introduction of Multiple Cloning Sites 84 4.2.2.5 Insertion of GFP reporter gene. 85
4.2.3 Cloning of test promoters in pPOT and pGOT vectors 87 4.2.3.1 Cloning the Lac Z Promoter 87 4.2.3.2 Cloning of the dctA Promoter 87 4.2.3.3 Cloning of the nodC Promoter 88
4.2.4 General fluorescence of pGOT vectors 88 4.2.5 Stability of pGOT vector 89 4.2.6 Construction of pOT1 vector 93
4.3 Discussion 102
CHAPTER 5: CONSTRUCTION OF PROMOTER LIBRARIES 105
5.1 Introduction 105
5.2 Construction of library LB-1: Methods and Results 105 5.2.1 Cloning of 3841 genomic DNA into pOT1 106 5.2.2 The distribution of genomic inserts in LB-1 109
5.3 Construction of the Promoter Library LB-2 112 5.3.1 Construction of LB-2 112
IX
5.4 Construction of Sub-libraries 116 5.4.1 Calibration of plate reader 116
5.4.1.1 The OD630 and OD600 correlate linearly to late logarithmic growth. 117 5.4.1.2 Fluorescence is directly correlated to OD630 118 5.4.1.3 The threshold value for relative fluorescence. 119
5.4.2 Screening of LB-2 using microtitre plate reader 121 5.4.3 Selection of libraries LB-3, LB-4, LB-5 and LB-6 122
5.5 Testing of the library LB-3 123
5.6 Discussion 125
CHAPTER 6: PUTATIVE MEDIA REGULATED PROMOTERS 127
6.1 Introduction 127
6.2 Screening of library LB-6: Methods and Results 127 6.2.1 Plate Observations 131 6.2.2 Sequence data 131
6.3 Discussion 140
CHAPTER 7 : ISOLATION OF ENVIRONMENTALLY INDUCED PROMOTERS USING IVET-OT 143
7.1 Introduction 143
7.2 Isolation of LB-3 Clones from the Rhizosphere 144
7.3 Characterisation of the Rhizosphere Isolates. 146
7.4 Discussion 153
CHAPTER8: DISCUSSION 158
REFERENCES 164
1
Chapter 1
Introduction
1.1 Rhizobium
Rhizobium is a small (1-2µm) Gram negative organism found free-living in soil. A
notable part of its lifecycle is its ability to form a symbiotic relationship within the
roots of legumes, culminating in the formation of nitrogen fixing nodules. There are
four genera, within the family Rhizobiaceae, that nodulate legumes: Rhizobium,
Bradyrhizobium, Azorhizobium and Sinorhizobium The work described in this thesis
primarily uses Rhizobium leguminosarum biovar viciae which nodulate pea and
vetch roots. Other Rhizobium strains nodulate different and specific legume roots.
For example, Rhizobium leguminosarum biovar trifolii nodulates clover whilst biovar
phaseoli nodulates bean and R. meliloti nodulates alfalfa.
1.1.1 Nodulation
Nodulation is based on a two-way molecular exchange between the legume and
Rhizobium. The host plant releases signal molecules that stimulate the expression of
genes (nod) within bacteria that are necessary for nodulation. These signal
molecules are flavonoids and have side groups specific to the strain of legume
(Gyorgypal et al., 1991; Peters et al., 1986; Redmond et al., 1986). The nod genes
encode enzymes that are involved in the synthesis of Nod factors, which in turn
cause changes in the morphology of the plant roots. The nod genes and many other
genes required for symbiosis are found on plasmids designated pSym in Rhizobium,
2
Azorhizobium and Sinorhizobium, however, other strains such as Bradyrhizobium
retain them on the chromosome.
The first step in the formation of a root nodule is infection. During infection, the
growth of epidermal hairs on the root surface, are altered resulting in them deforming
or curling (Dazzo & Gardiol, 1984). Bacteria are trapped by this deformation and
begin to invade the root surface. The plant is stimulated to produce a cell wall sheath
known as the infection thread (Callaham & Torrey, 1981). Within the root cortical,
cell division leads to the development of the nodule, where dividing bacteria are
delivered to the cytoplasm of individual plant cell via the infection thread. The
bacteria are engulfed by the plant membrane, which forms a peribacteriod
membrane. Here the bacteria, now termed bacteroids become terminally
differentiated and begin to fix nitrogen within the symbiotic relationship.
Once nodulation is complete, the bacterial cell undergoes the final stages of
differentiation. Cell division and DNA replication cease and the Rhizobium,
surrounded by the peribacteroid membrane, become dedicated to nitrogen fixation.
These terminally differentiated forms are known as bacteroids.
1.1.2 The nod genes
The nod genes fall into two groups, those that are common to all strains and are
necessary for nodulation to occur, and those that are found only in certain strains and
determine host specificity. NodABC comprise the common nod genes, with
mutations in any of them causing a Nod minus phenotype (Debruijn & Downie,
1991). They are found across the range of Rhizobium strains and are functionally
3
interchangeable between strains (Djordjevic et al., 1985; Fisher et al., 1985;
Kondorosi et al., 1984). There are many host specific nod genes for example R.
leguminosarum has nodFECMNTO. Amongst these nodE is particularly important
for the nodulation of peas by biovar viciae or clover by biovar trifolii (Spaink et al.,
1991).
An essential positive transcriptional regulator in the nodulation response of
Rhizobium is NodD. Nod D can occur in single copy or in multiple copies and acts in
a species-specific manner (Honma & Ausubel, 1987; Spaink et al., 1987). The gene
is the only nod gene expressed constitutively. Its N-terminus is highly conserved,
indicating a role in DNA binding. The C-terminus is more variable and it has been
suggested it may have a function such as flavonoid binding (Shearman et al., 1986).
As well as activating the transcription of other nod genes, in R. leguminosarum, it
also regulates its own expression (Rossen et al., 1985).
A conserved region known as the nod box (approximately 50bp) precedes most nod
genes (Rostas et al., 1986). NodD binds this region in two positions and can induce
bending between the two binding sites. How this bending, and the interaction
between NodD and RNA polymerase effect nod gene activation is still a mater of
speculation (Fisher & Long, 1992). The control of expression and the action of
NodD appear to be diverse and complex.
The nod genes encode a series of enzymes necessary for the synthesis of Nod factors.
Individual bacterial strains appear to make a family of Nod factors and substitutions
differ between species (Schultze et al., 1992). The basic structure of a Nod factor is
4
a β-1,4-linked oligomer of N-acetylglucosamine with an N-acyl substitution on the
non-reducing end. The diversity of active Nod factors is reflected in the variation of
nod genes (For a summary of nod genes and function see Fisher et al. table 2 (Fisher
and Long, 1992)).
1.1.3 Nitrogen Fixation
The bacterial genes for nitrogen fixation fall into two broad categories. Those that
have homologies amongst organisms that can fix nitrogen in the free living state are
known as nif. Those that are unique to symbiotic nitrogen fixation are known as fix.
Mutations within these genes result in Rhizobium that are able to nodulate legumes
but are unable to fix nitrogen (Nod+, Fix-)
In R. meliloti, symbiotic regulation of the nif genes appears to be activated by nifA,
whose expression is dependent on low oxygen (Ditta et al., 1987). FixL and fixJ are
part of a two component regulatory system that senses oxygen to activate
transcription in nifA (Davis et al., 1988). A detailed review of this is beyond the
scope of this thesis but has been extensively reviewed by Fischer (Fischer, 1994).
Within the symbiotic nitrogen fixing relationship between plant and bacteria, several
intriguing obstacles arise which need to be overcome by the two organisms. The
nitrogenase enzyme is irreversibly inactivated by oxygen, which is needed for
aerobic metabolism by the bacteroid. However, the function of nitrogenase requires
large amounts of ATP, which the bacterium must provide by aerobic respiration.
These constraints define many of the functions and structures within the symbiosis.
5
Leghemoglobin is an haem-binding protein similar to myoglobin. Its role is to bind
oxygen making it available for respiration while keeping the free oxygen levels low,
thus protecting the nitrogenase (Appleby, 1984).
1.1.4 Nutrient Exchange in the Nodule
The plant supplies carbon derived from photosynthesis to the bacteroids for use in
ATP production. In exchange the plant assimilates ammonia (Long, 1989). It is
generally thought that the carbon supplied by the plant takes the form of C4-
dicarboxylic acids, either L-malate, succinate or fumarate. The Rhizobium
dicarboxylate transport genes (dct) are required for fixation as well as the catabolic
malic enzyme. Mutations in these genes prevent nitrogen fixation, however
mutations in other sugar catabolism genes do not effect fixation (Driscoll & Finan,
1993; Finan et al., 1983). The dicarboxylate transport system is regulated by a two
component sensor-regulator system. Transcription of the gene for dicarboxylate
transport, dctA, is activated by regulation from the product of dctD. The gene dctB
encodes the sensor of dicarboxylate (Reid, 1995; Ronson et al., 1984; Wang et al.,
1989; Watson, 1990).
1.1.5 Carbon Sources in the Rhizosphere
There is a proposed exchange of carbon between the terminally differentiated
bacteroid and free-living members of its strain outside the nodule. Insight into this
came with the discovery of genes in R. meliloti that synthesise a unique compound
known as a rhizopine (Murphy et al., 1987; Murphy et al., 1988). Differentiated
6
bacteroids express the plasmid mos genes, under the control of ntrA-nifA regulation.
The unique rhizopine produced can be catabolised by free living Rhizobium of the
same strain due to set of genes, moc. It had been proposed that rhizopines act as a
exclusive growth substrate, enhancing the competitiveness of free-living members of
the producing strain in the rhizosphere. A recent study, in which moc- and mos-
mutants were compared with wildtype R. meliloti, has indicated that this may not be
the case (Gordon et al., 1996). It appears that the ability to catabolise rhizopines
enhances the rate at which a strain can form nodules when in competition with a
strain unable to catabolise the rhizopine.
1.2 Competition and survival of Rhizobium in the Rhizosphere
The importance of legumes as a crop, combined with nitrogen fixation within the
symbiotic relationship with Rhizobium, has lead to extensive studies of the survival
and competitiveness of Rhizobium. It has been shown that, in controlled conditions,
increased yields of legumes can be achieved by inoculating plants with modified
Rhizobium. However, when these modified strains are inoculated into non-sterile
soil conditions poor results are often obtained for increased yield. This appears to be
due to poor competition of laboratory strains with native strains. Due to the
economic importance of legumes competition has been extensively studied and
reviewed (Dowling & Broughton, 1986; Triplett & Sadowsky, 1992).
For successful nodulation and fixation of nitrogen, the Rhizobium needs to survive,
and to compete with other strains in a series of varied and complex environments.
First, they need to survive and be maintained in the soil. Second, they then need to
7
infect, grow and compete in the rhizosphere. Third, they must compete to initiate
nodulation of the legume.
The factors affecting growth and competition include both genetic and environmental
conditions. The host plant also plays an important role. The environmental factors
are complex, but include the soil type, pH, temperature, water content, salinity, and
competition with microorganisms. An important factor in the ability of a strain to
produce successful nodules is the relative number of that strain surviving in the
rhizosphere. Predators of microorganisms also effect the numbers of Rhizobium, as
do bactericidal agents. For example, the colonisation of Rhizobium is often inhibited
by predation by protozoa (Hossain & Alexander, 1984) as they reduce the numbers
of organisms available for infection. The motility, exopolysaccharide and antibiotic
production by Rhizobium can also effect their competitiveness.
In many cases, the final response is determined by the relationship between these
factors. For example, pH is an important determinant in the ability of Rhizobium to
survive (Glenn & Dilworth, 1994). However, a number of properties are effected by
pH, including motility and chemotaxis. All of these in turn could effect the
competitiveness of an organism, if not its ability to survive. A correlation between
exopolysaccharide production and acid tolerance has been reported (Cunningham &
Munns, 1984). During a pH shift from neutral pH to pH 5.0, no additional proteins
are required. However, within one generation of growth at pH 5.0, an adaptive acid
tolerance response (ATR), with the production of specific proteins that protects the
organism from subsequent acid shock at pH 3.0, occurs (Ohara & Glenn, 1994).
High levels of calcium may also have a significant role in acid tolerance.
8
The response to pH may vary within a strain. R. leguminosarum bv. phaseoli can be
grouped into two symbiotypes, I and II. Type I have a narrow host range whilst type
II have a wider host range as well as being heat, aluminium and acid tolerant. Type
II are more competitive in their nodulation of beans (Phaseolus vulgaris L) in acid
soils, although their numbers and growth do not seem to vary in the rhizosphere
before nodulation (Frey & Blum, 1994).
The natural production of antibiotics by Rhizobium can affect the ability of strains to
nodulate successful. Trifolitoxin (TFX) is a peptide with antibiotic properties,
produced by R. leguminosarum bv. trifolii T24. It inhibits many α-proteobacteria
(Triplett et al., 1994). The effect of this on competition has been established by
cloning the tfx genes into R. etil strain CE3. This strain became more competitive in
rhizosphere colonisation and nodulation (Robleto et al., 1997). A Tn5 mutation of R.
etil strain CE3 designated strain CE3003 has been produced with reduced
competitiveness (Araujo et al., 1994). A fragment containing the open reading frame
rosR compliments the insertion. The gene is homologous to transcriptional
regulators in R. meliloti and Agrobacterium tumefaciens and effects cell surface
hydrophobicity and exopolysaccharide production (Bittinger et al., 1997).
Many genetic markers could effect the competitiveness of Rhizobium. For example,
as means of containing genetically modified Rhizobium released into the
environment, it has been suggested that recA- mutants be used. These were found to
be deficient in their ability for long term survival but not in their short term
persistence (Hagen et al., 1997).
9
Vitamins play an important role in the colonisation of roots by Rhizobium. Growth
of R. meliloti is limited by the availability of biotin, thiamine and riboflavin. These
have been shown to be released from alfalfa roots and promote Rhizobium growth
under laboratory conditions. Biotin is a cofactor binding CO2 in enzymes such as
pyruvate carboxylase in R. etli (Dunn et al., 1996). The requirement for biotin could
therefore be linked to the CO2 requirement of Rhizobium and Bradyrhizobium for
growth. It has been shown that both uptake and biosynthesis of biotin contribute to
successful root colonisation (Streit et al., 1996). Rhizobium responds to plant-
derived biotin and a biotin uptake system or genes responding to biotin can be
postulated to exist. A DNA locus, bioS, has been identified that responds to external
biotin. Although cells with mutations in this locus accumulated biotin faster, they
were less competitive on low biotin laboratory media while showing no difference in
competition with wild type in the rhizosphere (Streit & Phillips, 1997). The
identification of the importance of vitamins in the symbiosis of Rhizobium has been
identified, however, the processes involved are still being characterised.
The response of Rhizobium to its environment and infection of legume roots is
probably one of the best-studied plant/bacterium symbiotic relationships. However,
the complexity of this association means that it is still poorly understood. While
determining the factors that govern competition and survival in the environment is a
complex problem, it is a key aim in environmental microbiology. A first step would
be to determine which genes are specifically switched on in the rhizosphere. These
genes must code for functions affecting growth and competition. To identify such
genes we developed a genetic system that can identify rhizosphere expressed genes
10
whilst giving spatial information about this expression. We have designated this as
in vivo expression technology using optical trapping IVET-OT. Below the original
IVET strategy, developed for studying pathogenicity in bacteria, is described.
1.3 Strategies for Identifying Environmentally Induced Genes
In recent years, the study of the genetics of the interactions between pathogens and
their hosts has developed. Physiological studies on these interactions are often
difficult due to the complexity of the relationships. For this reason, genetic and
molecular techniques are routinely used in their study.
A wide number of approaches are available for determining the genetics of these
interactions. In general the aim of determining the nature of pathogen-host
relationship has been the search for methods of controlling disease by reducing the
pathogenicity and virulence of organisms.
Numerous techniques have been developed to study the differential expression of
genes. Studying the effect of mutations can give an important insight into the
function of a gene. Mutations can be direct or random. In direct mutagenesis a
cellular function is deemed to be important. Disrupting or deleting the gene develops
a mutant strain, which is then compared with the wild type strain. This technique is
limited to identify genes with a postulated function. Random mutagenesis can be
carried out using UV or chemicals, with no postulation of a gene's function.
Mutations in a bacterial trait can be identified and the genes involved cloned.
Problems can arise with this method due to multiple mutations.
11
The use of transposons to cause random mutations can overcome the problem of
multiple mutations and results in the mutation being tagged. This has been greatly
enhanced by the development of small mini-transposons. The use of many of these
genetic techniques has been reviewed by Hensel (Hensel & Holden, 1996).
Gene fusion techniques, either transcriptional or translational, have been developed.
For example, random fragments of the bacterial genome are inserted upstream of a
promoterless reporter such as lacZ. Changes in gene expression in response can then
be monitored directly.
An alternative approach is to study gene expression by studying variations in RNA
expression. During a particular process it can be assumed that genes necessary for
that function, for example root colonisation, are transcribed only at that time. The
synthesis of cDNA from RNA allows the identification of genes transcribed during
infection. Subtractive hybridisation is often used where cDNA from an uninduced
condition is hybridised with cDNA from a test condition. The unhybridised cDNA
remaining is specifically expressed in the test environment.
An interesting development of the study of RNA and differential display is the use of
arbitrarily primed PCR (McClelland et al., 1995). When carrying out PCR on
complex templates, the primers used can be either random, where each base is
represented at each position, or arbitrary, where there is only a single base at each
position on the primer. Arbitrary primers are sequence dependent but are not chosen
to represent specific template binding sites. A good match between primer and
12
template may therefore only consist of 6-8 bases in the 10 bases at the 3' end or the
primer. With these primers, after the first round of amplification, the single stranded
PCR product has the primers at each end and can be further amplified. This results
in the most prominent PCR products resulting from the most successful primer pairs.
In RNA fingerprinting, the first stage involves reverse transcription. With eukaryotic
RNA this can be carried out using the primer based on the oligonucleotide (dT), to
prime at the poly-adenylated tail, followed by two bases at the 5' end. Since bacterial
RNA is not poly-adenylated an arbitrary primer must be used. This allows sampling
anywhere in the RNA including open reading frames. The second stage of the
procedure involves PCR with arbitrary primers.
The PCR fingerprints obtained using these methods can be compared. The profiles
between different conditions under which the organism is grown can be compared.
This has the advantage that a large number of overlapping conditions can be
compared simultaneously, allowing genes expressed under a number of conditions to
be identified. However one draw back is that rare RNAs may be underrepresented as
the probability of observing a product is a function of both the best primer match and
the abundance of the RNA. This can be overcome by using nested priming
fingerprints. In this case the original fingerprint is reamplified with an arbitrary
primer based on the original but with the bases shifted 3' with additional arbitrary
primers. These RNA fingerprinting techniques are reviewed by McClelland et al.
(McClelland, et al., 1995).
13
Messenger RNA levels can also be analysed by hybridisation to DNA dot blots
(Chuang et al., 1993). In this technique an overlapping set of clones in lambda,
spanning the genome of E. coli was constructed. Induced or repressed genes in each
cloned region are identified using hybridisation to DNA dot blots. RNA is extracted
from the cell and reverse transcription carried out with 32P labelled dCTP and a
random primer. The total cDNA is then hybridised to a library of DNA dot blots.
Comparison of the clone under control and experimental conditions indicates the
differential expression of genes.
The complexity of the molecular communication between host and pathogen makes
modelling it in the laboratory difficult, leading to limitations in many of the
approaches above. It has, for example, been very difficult to determine exactly
which genes need to be expressed by a pathogen to establish successful infection of a
host. Recent approaches that overcome the need to model the host stimulation, by
using a fully functional host, include signature tagged mutagenesis (STM) and in
vivo expression technology (IVET). Both these approaches were developed for
Salmonella typhimurium.
STM is a development of other mutagenesis techniques, overcoming one of their
major drawbacks by allowing a mutant with attenuated virulence to be identified
within a large population of mutants. In this technique, each transposon mutant is
marked with a DNA tag consisting of a 40bp variable region surrounded by a
constant region allowing PCR amplification of the tag. The mutants are plated in
microtitre plates from which DNA colony blots are prepared. An inoculum of the
pooled mutants is used on the host mouse from which a pool of recovered mutants is
14
obtained after infection. The tags from the inoculum pool and the recovered pool are
amplified and used as a probe on the DNA blots. Mutations in virulence genes, are
absent from the recovery pool as they are not virulent and do not survive in the host.
Mutations are obtained, that hybridise with the inoculum pool but not the recovery
pool, that are therefore attenuated in virulence (Hensel et al., 1995). Using this
method, a new pathogenicity region in S. typhimurium has been identified (Shea et
al., 1996). It has been noted that some mutations may be missed if another mutation
produces a virulence function that allows the mutant to grow in the host. This
system also suffers from the limitations of insertion mutagenesis. The transposon
may still have effects on genes further downstream of its insertion point. There is
also the problem of non-random insertion of transposons.
The IVET strategy is a development of the use of transcriptional and translational
fusions. In the original method, a promoter fusion was made with a promoterless
purA and LacZY gene fusion. This was inserted into the chromosome of a purA
auxotroph of S. typhimurium using the suicide vector pIVET1 based on pGP704.
Recombination between the inserts in the vector and the homologous region in the
chromosome occur to produce a tandem insert with the native gene and the reporter
gene regulated by the native promoter. In this way full functionality is maintained in
the cell. Selection for ampicillin resistance drives integration of the recombinant
plasmid into the chromosome. During infection of a mouse, only active fusions
resulting in the complementation of pur survived. These were then recovered from
the mouse spleen and screened for Lac- in vitro. Of the cells recovered from the
mouse, 5% had sufficient purA transcription to survive within the mouse but were
15
Lac- on laboratory media. Novel genes important in virulence were isolated from
this group (Mahan et al., 1993).
One of the limitations of this version of IVET is that it relies on complementation of
an auxotroph. If a gene is only transiently expressed, insufficient transcription may
occur resulting in important factors being missed. Several adaptations of IVET have
been developed that overcome this (Camilli & Mekalanos, 1995; Mahan et al.,
1995). The technique has been successful in identifying many new genes involved in
virulence. For example 11 strains of Staphylococcus aureus have been isolated
containing previously unknown virulence genes (Lowe et al., 1998).
In our adaptation of the IVET strategy, know as IVET-OT, we use a plasmid-based
system for ease of manipulation. We also do not use auxotrophs thereby eliminating
the problems of transiently expressed genes not leading to survival of an auxotrophic
host. The use of fluorescence technology and green fluorescent protein (GFP) has
allowed visualisation of the active promoters and allows transient expression to be
monitored as GFP is stable for long periods. In the study of the infection of plant
roots by Rhizobium, spatial information about the expression of genes is of
considerable value and can be visualised using GFP (Gage et al., 1996). The
physical process of nodulation has been studied using microscopy and it was our aim
to combine this with a genetic study. Combining IVET using a fluorescent marker
with the micromanipulation achievable with optical trapping has given us a powerful
tool in the study of the legume-Rhizobium symbiosis that could be adapted to many
other host-pathogen relationships.
16
In this strategy, a plasmid based promoter library is constructed in Rhizobium. The
constitutive promoter fusions are removed to produce a silent promoter library. This
sub-library is inoculated into the rhizosphere and allowed to grow. Individual cells
that express a reporter under these conditions are recovered using a light based
micromanipulator known as an optical trap. The isolated cell is grown up and
analysed.
1.4 Optical Trapping
Microscopy is a powerful tool for observing and identifying biological specimens.
However, light is versatile and can be used for far more than the simple observation
of microscopic organisms. Light is the basis of microscopy and spectroscopy and the
use of fluorescent and phosphorescent probes have allowed the measurement of a
wide range of cellular processes. Light based systems are also being used to replace
radioisotopes. The properties of laser (Light Amplification by Stimulated Emission
of Radiation) light are being utilised in a wide range of tools, including confocal
microscopes, gene sequencers and cell sorters.
1.4.1 The Characteristics of Lasers
Lasers use stimulated emission to produce a light beam with specific properties.
This occurs when electromagnetic radiation causes an atom in a high-energy state to
emit radiation and fall to a lower energy state. The emitted radiation adds to the
incident radiation causing an amplification effect. There are four main types of laser;
gas lasers, solid state lasers, dye lasers and semiconductor lasers. These produce
light beams with similar general properties. The beam has a high intensity and
17
combining this with the collimation of the light, it can be projected over a large
distance as a defined beam. The coherence of the light allows high contrast
interference fringes to be formed. This is important in imaging and focusing of the
laser. Lasers also have spectral purity that has allowed them to be used in high-
resolution spectroscopy.
Another important property of lasers utilised in optical trapping is the precise cross
sectional profile of the beam. For optical trapping the beam needs a Gaussian
distribution of light intensity across the beam. For a laser oscillation to occur the
mirrors at each end of the laser cavity must be positioned to form a resonant cavity.
A wave within the cavity will then replicate itself so that the electrical fields add in
phase. The axial modes produced in this way are discrete narrow spectral lines and
form the basis of the fluorescence line width for the laser output. These modes are
formed by plane waves travelling exactly along the axis joining the centre of the
mirrors and contribute to a single spot of light in the laser output. Within the cavity
however there are waves travelling just off axis. These replicate along a more
complex path and give rise to transverse electromagnetic or TEM modes. These
modes are characterised by a pattern of spots if the laser is shone on a screen. The
minima in the horizontal plane is given by the term q whilst those in the vertical
plane are given as r. Thus the modes can be described as TEMqr (Fig1.1). For
optical trapping a TEMoo laser is generally used (Hecht, 1992; Wilson & Hawkes,
1987).
18
TEM00 TEM01 TEM02
TEM10 TEM11 TEM12
TEM20 TEM21 TEM01*
1.4.2 Manipulation of particles using Light
A more unusual property of light is its ability to produce radiation pressure. When
dielectric material refracts light, tiny forces are produced. Using these forces a
microscope becomes a tool for manipulating biological material not just for
observing it. Mechanical tools such as glass capillaries and needles have been used
for manipulations however these have several disadvantages. They are limited in
their use as they can cause damage to delicate biological material. Sterility is
difficult to maintain and they are limited in their use by the size that tools can be
Fig. 1.1. The patterns of some of the possible transverse electromagnetic modes (TEM) achievable with lasers are shown. TEMqr gives the number of minima in the horizontal (q) and vertical (r) plane. TEM01* represents the donut like pattern achieved by combining TEM01 with TEM10 profiles, giving a central minima.
19
produced. Light on the other hand overcomes these problems. Sterility is easily
maintained as no mechanical parts are introduced to the sample. The limit on the
size of the material to be manipulated is on the scale of the wavelength of the light.
This opens up the possibility of manipulating bacteria and viruses. Damage to
biological material can be limited as the pressures are smaller on any one part of the
cell and the forces associated with the light can be limited to a volume a few
wavelengths across. This also introduces one of the great advantages of light as a
manipulator, namely the ability to work within a cell without opening the cell first.
This is most notably seen when using Laser microbeams to cut or perforate an
organelle within a cell. A High numeric aperture 100X objective lens focuses the
light under a high angle. This means the power density just 3µm from the focus is an
order of magnitude smaller than at the focus. In practical terms this means that if
work is carried out a factor of 2 above the threshold for an effect, the effect is no
longer produced 1-2µm from the focus. This allows an organelle to be cut with a
microbeam without damaging the cell wall or, in the case of the optical trap, a cell to
be trapped without affecting or trapping its neighbours (Greulich & Weber, 1992).
The use of light to manipulate bacteria cells and viral particles using an argon laser
trap was first demonstrated by Ashkin et al.(Ashkin & Dziedzic, 1987). Later optical
traps used less damaging infrared (IR) lasers to trap and move both free bacteria and
particles within the cytoplasm of spirogyra (Ashkin & Dziedzic, 1989; Ashkin et al.,
1987). Since then numerous applications have been suggested and tried (Ashkin,
1980; Block, 1992; Chu, 1991) including the isolation and culturing of single yeast
(Grimbergen et al., 1993) and bacteria (Mitchell et al., 1993).
20
1.4.3 Forces in Optical Trapping
Optical trapping utilises the property of coherent light to produce tiny forces when
refracted. These forces, known as radiational pressure, are very small; several
milliwatts of laser power giving only a few piconewtons of force. This is however
sufficient to pull a bacterium 10 times faster than it can swim (Block, 1992).
For trapping to occur, a complex balance of forces is necessary. The net force is a
balance between refractive or gradient forces and radiational pressure due to
reflection and absorption. Radiometer forces due to thermal gradients are also
produced (Afzal & Treacy, 1992)
For particles larger than the wavelength of the light, a simple ray optics model using
radiation pressure is sufficient to explain the forces needed for trapping. Forces due
to refraction occur because of momentum changes in the photons within the light
beam. Before entering the cell the parallel beams of light can be thought of as
having primarily vertical momentum. After refraction however the light has picked
up horizontal momentum. Due to conservation of momentum, an equal and opposite
force is conveyed to the cell (Fig.1.2) (Block, 1992).
21
The Radiation pressure is dependent on the refractive indices of the particle and its
surrounding medium. Fig 1.3 shows the optical forces on a particle larger than the
wavelength of the light. In a, the refractive indices of the particle (n1) is greater than
the medium (n2). Refraction of the light ray (a) by the particle causes a momentum
change ∆P=P1-P0 where P1 is the momentum after refraction and P0 is the momentum
before refraction (see insert Fig 1.3). Due to the laws of conservation, a force, -∆P is
conveyed on the particle. This is also true for ray (b) and the sum of -∆P for all the
rays results in an overall radiation force, F, in the direction of the focal point, f.
Path of photon
Cell membrane
Refraction of photon by membrane
Resultant force on cell
Change in momentum
Fig. 1.2. A photon hitting the cell wall is refracted. Due to conservation of momentum, the change in momentum causes a momentum change on the membrane.
22
-∆P
Fig. 1.3. Ray optics diagram showing the effect of two rays, a and b striking a particle when the refractive index of the particle (n1) is a) greater than the refractive index of the medium (n2), b) less than the refractive index of the medium and c) when the particle is reflective. f is the focal point of the incident laser beam. The radiation force (F) is the sum of the change in momentum (-∆P) induced by the refraction of the light rays (Insert) [Sasaki, 1992 #71].
a
a
a
b
b
b
P1
P0
∆P
-∆P
-∆P
-∆P-∆P
-∆P
-∆P
-∆P
-∆P
-∆P
f
F
f F
f
a) n1>n2
c) Particle highly reflective
b) n1<n2
23
If n1 is less than n2 then the situation is reversed and the overall force is opposite to
that of the laser (Fig 1.3b). In this case the particle is repelled from the focal point.
If the particle is reflective, simple ray optics indicate that it will be repelled in a
similar fashion to particles with n1<n2 (Fig 1.3c)(Sasaki et al., 1992). To be able to
trap particles repulsed from the laser, Sasaki et al. developed a trap using a scanning
laser of TEM00 type. This configuration causes a "well" of low intensity light on the
axis of rotation, into which a particle is repelled from the spinning high intensity area
around it. A similar effect can be achieved using TEM*01 lasers. An alternative
method for trapping particles with low refractive index, proposed for using optical
traps in micromechanics, is to fabricate the object to be trapped into a donut shape.
In this way, it has been shown that a non-scanning TEM00 laser can trap the object by
exerting force on the inner wall (Higurashi et al., 1995).
For particles less than the wavelength of the light, particularly dielectric particles
such as cells, models where light is described as an electromagnetic field need to be
considered. The basic process involves the induction of dielectric dipoles within the
object to be trapped. The electromagnetic field causes a charge separation within the
object and attracting forces are generated between the field and object. These forces
were first used in trapping and cooling atoms, where the particle achieves a lower
energy state by moving into the focal point of the Laser (Chu, 1991).
24
Intensity of laser light
Cross-section of laser A B
A B
Laser prior to focusing by objective
Fig. 1.4. The cross section of a TEM00 laser has a Gaussian distribution.
If the energy intensity within the incoming beam were uniform the forces on the cell
would balance out resulting in no net movement. However the intensity within a
TEM00 beam is greatest at its centre (Gaussian distribution) creating a gradient
(Fig.1.4). This causes an imbalance in the forces on the cell resulting in a net
movement towards the brightest point of the gradient where the photons have
greatest energy (Block, 1992).
Rays of light hit the cell across its whole diameter, however only those further from
its centre cause relevant trapping forces (Fig 1.5). Light passing through the centre
of the cell cause forces due to the change of momentum at the two membrane
boundaries that are equal and opposite. These forces therefore cancel out. Rays'
25
incident nearer the edges of the cell are refracted in such a way as to give momentum
changes with a resultant backward component (Afzal and Treacy, 1992). It can
therefore be seen that within a cone of rays, those near the axis contribute little to
trapping whereas those nearer the periphery give the greatest trapping forces.
a)
c)b)
iii ii
i
ii ii i i
Fig. 1.5. Within the focal cone of the laser (a), beams of light (i)that pass through the centre of the cone do not contribute to the trapping forces as the forces created (F) cancel out (b). Those that are acutely focused (ii) contribute most significantly to the trapping forces (c).
F
F FF F
FF
FF
26
This is further confirmed by work done by Sako et al. (Sato et al., 1991). They used
a TEM*01 laser to achieve trapping. This beam has a doughnut like profile with the
highest intensity in a disk around the outside. It was found that a TEM*01 laser gave
20% stronger horizontal force in the trap than a TEM00 laser at the same power.
To achieve gradient forces large enough to balance the radiational forces, the cone
angle must be large. This is achieved by using a high numeric aperture (NA) lens.
Afzal et al. found that a lens with NA 0.85 gave a 40° cone angle whilst a lens with
NA 1.25 gave a 70° cone angle (Afzal and Treacy, 1992). The NA 0.85 was
sufficient to trap polystyrene beads or 2 and 3µm but for 1µm beads the NA 1.25 was
necessary.
The stability of optical traps has now been predicted using computer models (Bakker
Schut et al., 1991).
1.4.4 Uses of optical trapping
The ability to use light to manipulate material at a microscopic level, and to
manipulate internal structures within a cell without damaging the cell membrane
(Ashkin and Dziedzic, 1989) has lead to a wide range of applications being
developed. Single beam optical traps have been incorporated into a confocal
microscope to extend its capabilities (Visscher & Brakenhoff, 1991). It is possible to
accurately calibrate the forces involved in trapping (Sato et al., 1991) and this has
lead to the technique being used to measure internal cellular forces. The forces
27
needed to drive organelles along microtubules in the amoeba Reticulomyxa were
calculated to be 2.6x10-7 dynes for a single motor molecule. This was calculated by
trapping mitochondria and measuring the trapping force at the point the mitochondria
escapes the trap (Ashkin et al., 1990). Optical trapping protocols have been
developed for the study of kinesin molecules interacting with microtubules (Block et
al., 1990) and have been used to measure the forces involved in the interaction (Kuo
& Sheetz, 1993). Actin and myosin interactions have also been measured using
optical trapping (Finer et al., 1994; Spudich, 1994). In this case two optical traps
were focused on beads attached to a single actin filament. A microscope slid was
coated with skeletal muscle heavy meromyosin (HMM). Polystyrene beads coated in
HMM were applied to the actin filament, which was brought close to the slide. The
displacement and force on the filament stretched between the two traps could then be
studied. Optical traps have also been used to measure the unbinding and rebinding
forces of actin and myosin molecules (Nishizaka et al., 1995). Another important
molecular motor, driving flagella, has also being studied using optical trapping
(Block et al., 1989; Block et al., 1991).
Another target molecule for study using optical trapping is DNA. Microsurgery
using laser based optical scalpels has been carried out on chromosomes (Seeger et
al., 1991). The use of optical traps has allowed specific interactions to be produced
between dissected fragments, for example dissected chromatids during metaphase
could be kept together until anaphase (Liang et al., 1993). This ability to combine
optical traps with optical scalpels to produce non-contact manipulation techniques
that can be used in sterile environmentally controlled chambers could be used to
supersede established techniques. For example, the study of fertilisation and embryo
28
development by trapping gametes could be carried out (Schütze & Clement-
Sengewald, 1994).
Another form of microsurgery using optical traps was demonstrated by Steubing et
al. (Steubing et al., 1991). Highly selective cell fusion was carried out by placing
two cells (myeloma cell line NS-1) together using an optical trap. The cells were
fused to form a viable hybrid cell using pulses from an UV laser microbeam. The
pinching and local binding of membranes has been studied and a theoretical model
proposed (Bar-Ziv et al., 1995). Bar-Ziv et al. have also studied the effect that
trapping has on the tension in lipid vesicles (Bar-Ziv et al., 1995). They observed
that tension was induced in membranes by lipid material being attracting into the
trap. Fluctuations in the vesicles are suppressed causing them to become pressurised
and when the trap is shut off, to expel inner vesicles.
The ability to bring cells together has also been used to study of the interactions
between cells in the immune response. For example natural killer cells and human
erythroleukemia cells have been forced together using an optical trap, resulting in the
blebbing of the target cell membrane (Seeger, et al., 1991). Further work of this type
could increase understanding of the immune response.
An interesting use of optical trapping was its use in the induction of cell wall growth
in the green alga Chara vulgaris (Leitz et al., 1995). This alga senses gravity using
rhizoids. If the statoliths are positioned at one end of a horizontal rhizoid, simulating
the effect of gravity, differential growth of the opposite cell wall was observed.
29
The ability to isolate single cells from a mixed population of cells has been utilised in
the isolation of a hyperthermophilic archaeum from an environmental sample (A hot
pool in Yellowstone Park, Wyoming). The strain, which could not be isolated by
classical enrichment and plating techniques, was identified by 16S rRNA sequence to
be part of the population. A fluorescent oligonucleotide probe identified the cell
morphology and a cell with that morphology was trapped, isolated and grown (Huber
et al., 1995).
As can be seen from this summary, optical trapping is a powerful and versatile tool.
Its uses are widespread and it is set to become a major tool in the biologists arsenal.
In this project we apply optical trapping to the problem of gene expression by
combining it with IVET. It is used to isolate individual clones expressing a marker
from a complex environment without the need for intermediate growth. This
technique has been designated IVET-OT.
30
Chapter 2
Methods
2.1 Strains
Strain Description Reference/source
DH5α E. coli: supE44 DlacU169 (f80 lacZDM15) hsdR17 recA1 endA1 gyrA96 thi-1 relA1
(Hanahan, 1983)
R. leguminosarum 3841
Spontaneous streptomycin resistant derivative of R. leguminosarum bv. viciae strain 300
(Johnston & Beringer, 1975)
RU1080 Conjugation of pGOT-K into 3841 This work RU1081 Conjugation of pGOT-K-lacZ into 3841 This work RU1087 Conjugation of pGOT-K-dct into 3841 This work RU1088 Conjugation of pGOT-K-nodC into 3841 This work RU1158 pOT1 library controls, high expression of GFP This work RU1159 pOT1 library controls, low expression of GFP This work RU1160 pOT1 library controls, no expression of GFP This work RU1182 LB-6 library isolate (pOT1) This work RU1183 LB-6 library isolate (pOT1) Insert DNA
homologous to fixND This work
RU1184 LB-6 library isolate (pOT1) Insert DNA homologous to 16S rRNA dimethyltransferase
This work
RU1188 LB-6 library isolate (pOT1) Insert DNA homologous to metX. Expression increased in late stationary phase.
This work
RU1197 LB-6 library isolate (pOT1) This work RU1198 LB-6 library isolate (pOT1) This work RU1199 LB-6 library isolate (pOT1) This work RU1201 LB-6 library isolate (pOT1) This work RU1202 LB-6 library isolate (pOT1) This work RU1203 LB-6 library isolate (pOT1) This work RU1204 LB-6 library isolate (pOT1) This work RU1207 LB-6 library isolate (pOT1) This work RU1209 LB-6 library isolate (pOT1) This work RU1212 LB-6 library isolate (pOT1) This work RU1214 LB-6 library isolate (pOT1) This work RU1215 LB-6 library isolate (pOT1) This work RU1216 LB-6 library isolate (pOT1) Insert DNA
homologous to Phytochrome This work
RU1220 LB-6 library isolate (pOT1) This work RU1226 LB-6 library isolate (pOT1) This work RU1230 LB-6 library isolate (pOT1) This work RU1234 LB-3 library isolate induced by phosphate
limitation This work
31
Strain Description Reference/sourceRU1235 LB-3 library isolate induced by phosphate
limitation This work
RU1236 LB-3 library isolate induced by Succinate and hesperitin
This work
RU1242 LB-3 library isolate induced by phosphate limitation
This work
RU1243 LB-3 library isolate induced by phosphate limitation
This work
RU1244 LB-3 library isolate induced by phosphate limitation
This work
RU1245 LB-3 library isolate induced by hesperitin This work RU1246 LB-3 library isolate induced by phosphate
limitation This work
RU1247 LB-3 library isolate induced by phosphate limitation
This work
RU1248 LB-3 library isolate induced by phosphate limitation
This work
RU1249 LB-3 library isolate induced by Succinate and hesperitin
This work
RU1250 LB-3 library isolate induced by phosphate limitation
This work
RU1251 LB-3 library isolate induced by Succinate and hesperitin
This work
RU1253 LB-6 library isolate (pOT1) This work RU1256 LB-6 library isolate (pOT1). Expression
increased in late stationary phase. This work
RU1257 LB-6 library isolate (pOT1) This work RU1302 LB-3 library isolate. Insert DNA homologous
to thiE and thiM This work
RU1311 pOT1 library standard 2000 fluorescence units This work RU1312 pOT1 library standard 10,000 fluorescence
units This work
RU1313 pOT1 library standard 20,000 fluorescence units
This work
RU1314 pOT1 library standard 30,000 fluorescence unit This work RU1315 pOT1 library standard 40,000 fluorescence
units This work
RU1316 pOT1 library standard 62,000 fluorescence units
This work
RU1317 pOT1 library standard 91,000 fluorescence units
This work
RU1318 pOT1 library standard 199,000 fluorescence units
This work
RU1319 pOT1 library standard 369,000 fluorescence units
This work
32
2.2 Plasmids
Plasmid Host strain
Details Reference/source
pBB-Gm-Gfpuv DH5α Intermediate in promoter probe construction: GFPuv NcoI/StuI reporter cartridge including TT cloned into pBBR1-MCS-5
This work
pBBR1MCS DH5α Broad host range cloning vector. CmR
(Kovach et al., 1994)
pBBR-MCS-5 DH5α Broad host range cloning vector. GnR
(Kovach et al., 1995)
pGEM-T DH5α Cloning vector for PCR products. Supplied pre digested with 3’ thymidine. AmR
Promega Ltd.
pGFP DH5α Source vector for gfp. pUC19 ori AmR
Clontech laboratories inc.
pGFPuv DH5α Source vector for gfpuv. pUC19 ori AmR
Clontech laboratories inc.
pGOT-k DH5α Promoter probe vector. pBBR1MCS replicon with promoterless gfp reporter. knR
This work
pGOT-k-dct DH5α dctA promoter cloned into pGOT-k. knR
This work
pGOT-k-lacZ DH5α LacZ promoter cloned into pGOT-k. knR
This work
pGOT-k-nodC DH5α nodC promoter cloned into pGOT-k. knR
This work
pGOT-S DH5α Promoter probe vector. pBBR1MCS replicon with promoterless gfp reporter. spR
This work
pHP45 Ω DH5α Omega interposon stR spR (Prentki & Krisch, 1984) pIJ1814 ET12567 pUC18 derivative containing nod
box and nodC. AmR A.Downie
pJQ254 DH5α Cloning plasmid with NotI–SmaI-NotI in MCS. KnR
(Quandt & Hynes, 1993)
pMP220 IncP transcriptional fusion vector. TcR
(Spaink, et al., 1987)
pND-1 DH5α Intermediate in promoter probe construction: TT and phoA cloned into pSK as SacII/NotI fragment
This work
pND-2 DH5α Intermediate in promoter probe construction: TT and KnR cloned into pND-1 upstream of phoA
This work
pND-4 DH5α Intermediate in promoter probe construction: gfpuv and TT (Pharmacia) cloned into pOTK as SpeI cartridge. knR
This work
33
Plasmid Host strain
Details Reference/source
pNEB193 PUC19 derivative with unique cloning sites: AscI, PacI, PmeI. AmR
New England Biolabs
inc.
pOT1 DH5α Promoter probe vector based on pBBR-1-MCS-5 replicon. Contains promoterless gfpuv and MCS between two unique transcriptional terminators. GnR
This work
pOTK DH5α pBBR1MCS replicon with phoA reporter between two TTs. knR
This work
pOTS DH5α pBBR1MCS replicon with phoA reporter between two TTs. SpR
This work
pPOT-k DH5α Promoter probe vector. pBBR1MCS replicon with promoterless phoA reporter. knR
This work
pPOT-S DH5α Promoter probe vector. pBBR1MCS replicon with promoterless phoA reporter. StR
This work
pRAT1 DH5α Plasmid containing KnR cartridge D. Evans
pRK2013 ColE1 replicon with RK2 tra genes. Used for mobilising incP and incQ plasmids. KnR
(Figurski & Helinski,
1979)
pRU160 DH5α Omega transcriptional terminator from pHP45 Ω cloned into pGEMT
This work
pRU161 DH5α Omega transcriptional terminator from pHP45 Ω cloned into pGEMT
This work
pRU162 DH5α SacRB PCR fragment cloned into pGEM-T
This work
pRU279 DH5α Intermediate in promoter probe construction: knR BamHI fragment from pRAT1 cloned into pRU160
This work
pRU496 RU1182 pOT1 derivative isolated from RU1182. GnR
This work
pRU498 RU1188 pOT1 derivative isolated from RU1188. Insert DNA homologous to metX. Expression increased in late stationary phase. . GnR
This work
pRU499 RU1183 pOT1 derivative isolated from RU1183. Insert DNA homologous to fixND. GnR
This work
pRU500 RU1184 pOT1 derivative isolated from RU1184. Insert DNA homologous to 16S rRNA dimethyltransferase. GnR
This work
34
Plasmid Host strain
Details Reference/source
pRU504 RU1302 pOT1 derivative isolated from RU1302Insert DNA homologous to thiE and thiM. GnR
This work
pRU509 RU1197 pOT1 derivative isolated from
RU1197. GnR This work
pRU511 RU1198 pOT1 derivative isolated from RU1198. GnR
This work
pRU512 RU1199 pOT1 derivative isolated from RU1199. GnR
This work
pRU514 RU1201 pOT1 derivative isolated from RU1201. GnR
This work
pRU515 RU1202 pOT1 derivative isolated from RU1202. GnR
This work
pRU517 RU1203 pOT1 derivative isolated from RU1203. GnR
This work
pRU518 RU1204 pOT1 derivative isolated from RU1204. GnR
This work
pRU521 RU1207 pOT1 derivative isolated from RU1207. GnR
This work
pRU523 RU1253 pOT1 derivative isolated from RU1253. GnR
This work
pRU524 RU1209 pOT1 derivative isolated from RU1209. GnR
This work
pRU525 RU1257 pOT1 derivative isolated from RU1257. GnR
This work
pRU526 RU1212 pOT1 derivative isolated from RU1212. GnR
This work
pRU527 RU1214 pOT1 derivative isolated from RU1214. GnR
This work
pRU528 RU1215 pOT1 derivative isolated from RU1215. GnR
This work
pRU529 RU1216 pOT1 derivative isolated from RU1216. Insert DNA homologous to Phytochrome. GnR
This work
pRU530 RU1256 pOT1 derivative isolated from RU1256. GnR
This work
pRU531 RU1220 pOT1 derivative isolated from RU1220. GnR
This work
pRU534 RU1256 pOT1 derivative isolated from RU1256. Expression increased in late stationary phase. GnR
This work
pRU536 RU1226 pOT1 derivative isolated from RU1226. GnR
This work
pRU539 RU1230 pOT1 derivative isolated from RU1230. GnR
This work
pRU569 DH5α Inset from pRU504 cloned into pNEB193 as pacI fragment
This work
35
Plasmid Host
strain Details Reference/source
pRU61 DH5α 0.9Kb dcta-B in BluescriptII SK-. AmR
(Reid & Poole, 1998)
BluescripII pSK-
DH5α Phagimid, pUC19 derivitive, f1(-) origin of replication, ColE1 replicon. AmR
Stratagene Ltd
BluescripII pSK+
DH5α Phagimid, pUC19 derivitive, f1(+) origin of replication, ColE1 replicon. AmR
Stratagene Ltd.
pTR101 TG1 Broad host range cloning vector containing ParDE. RK2 derivative. AmR tcR
(Roberts et al., 1990)
pWS233 HB101 pSUP101 derivative containing sacRB
A. Puhler
2.3 Oligonucleotide primers
NAME SEQUENCE 5' to 3' DESCRIPTION USE Supplier P12 GGCTTTACTAAGCTGATC
CGGTGG 5' end of omega transcriptional terminator
PCR Genosys
P13 GGGGATCCGGTGATTGATTGAGCA
3' end of omega transcriptional terminator
PCR Genosys
P19 CCACCCGACAGCGAAAATTCAC
C terminus of phoA from E. coli
PCR cloning Genosys
P20 CATGGAGAAAATAAAGTGAAACACAGC
N terminus of full length phoA from E coli.
PCR cloning Genosys
P69 GAGAGAGAACTAGTGGAGGAAGAAAAAATGAGTAAAGGAGAAGAAC
SpeI GFPuv forward primer
PCR Genosys
P70 ACCGACTAGTAGGCCTATTATT
SpeI GFPuv reverse primer
PCR Genosys
P79 CCATTACCTGTCCACACAATCTGCCC
SalI site directed mutagenesis (sdm) for GFPUV bp884-907
sdm Genosys
P80 GGGCAGATTGTGTGGACAGGTAATGG
SalI sdm for GFPUV bp884-907 reverse
Sdm and PCR Genosys
P81 CGATTAATTAAGTCGACATCTAGAGTTTAAACTTTAATTAAGCCCGGGCTGCA
Linker for pOT1 with ClaI-PstI ends and internal SalI
LINKER Genosys
P82 GCCCGGGCTTAATTAAAGTTTAAACTCTAGATGTCGACTTAATTAAT
Linker for pOT1 with ClaI-PstI ends and internal SalI, compliment of P81 minus overhanging ends
LINKER Genosys
P86 GCTTCGCAACGTTCAAATCCGC
mapping primer for Pharmacia transcriptional terminator
PCR Genosys
pOT-reverse
CATTTTTTCTTCCTCCACTAGTG
cy5 label for sequencing inserts in pOT1
SEQUENCING Pharmacia
36
2.4 Growth conditions
2.4.1 Growth media
Rhizobium were grown at 27°C on TY medium with CaCl2 (6mM) (Beringer, 1974)
or acid minimal salts (AMS) based on Brown and Dilworth (Brown & Dilworth,
1975) with the following adaptations: potassium phosphate (0.5mM), MgSO4
(2mM), CaCl2 (0.17mM) and MOPS buffer (20mM, pH 7.0). Minimal media was
supplemented with either glucose (10mM) or succinate (10mM) and ammonia
(10mM) Agar was added to media at 1.5% (Difco Bitec). E.coli were grown at 37°C
in Luria-Bertani broth (LB) consisting of tryptone (10 g.l-1), yeast extract (5 g.l-1),
NaCl (5 g.l-1). Agar was added to the media as necessary (Difco, Bitek: 1.5%).
Strains were routinely stored at -80°C in 15% glycerol after snap freezing in liquid
nitrogen.
2.4.2 Antibiotics
Media was supplemented with antibiotics where appropriate. The routine
concentrations are stated below with variations stated in the text:
37
Antibiotic Rhizobium E. Coli
Streptomycin 500 µg.ml-1 25 µg.ml-1
Kanamycin 40-160 µg.ml-1 25 µg.ml-1
Tetracycline 5 µg.ml-1 (TY)
2 µg.ml-1 (AMS)
10 µg.ml-1
Gentamycin 20 µg.ml-1 10 µg.ml-1
Ampicillin - 50 µg.ml-1
Trimethoprim - 10 µg.ml-1
Spectinomycin 100 µg.ml-1 50 µg.ml-1
2.4.3 Microtitre plates
For the library construction (Chapter 5) Rhizobium strains were grown in 96 well,
flat bottom microtitre plates (Iwaki, Japan). Growth medium was AMS (200µl) the
plates were incubated at 27°C, 125 rpm in a custom built holder mounted on a New
Brunswick gyratory shaker. The holder built in the departmental workshop by Mr A.
Dawson, consists of an open toped aluminium box with two walls that can be
adjusted to hold the plates in place. The plates are incubated in batches of 28 plates
as this number fills one layer of the box. A maximum of 5 layers (140 plates) can be
incubated in this way.
Microtitre plates were assayed using a Biolumin960 plate reader (Molecular
Dynamics) controlled by an Apple PC. Plates were assayed in batches of 28 plates,
for optical density (630nm) and fluorescence (405/10nm excitation, 505/10
emission). The data was analysed using an Excel spreadsheet. Wells with OD630
38
below 0.15 were excluded. For the remaining wells, the relative fluorescence, V,
was calculated according to the equation:
V=F-X/OD630-Y
Where F is the measured fluorescence, X is the average fluorescence for a blank
uninoculated well on each plate, OD630 is the optical density for a particular well and
Y is the average OD630 for the blank wells.
2.4.4 Stains and fluorescent observations
Phosphatase activity was detected on plates by supplementing them with 5-bromo-4-
chloro-3-inodolyl phosphate (XP)(50µg ml-1)(Sigma). Samples for microscopic
study were stained with ELF stain (1:20 dilution)(Molecular Probes inc.)
Observation of colonies expressing GFP and GFPuv were made using a
transilluminator (UVP model TL-33E) fitted with four 20nm bulbs and a long wave-
length emission filter
2.5 Molecular Biology
2.5.1 DNA Isolation
2.5.1.1 Plasmid preps
Routine plasmid extractions were carried out using alkaline lysis as previously
described (Sambrook et al., 1989). Some plasmids were prepared using the boiling
39
method described by Arnold et al. (Arnold & Pühler, 1988). For sequence analysis
and other high quality plasmid DNA isolations, FlexiPrep kits (Pharmacia Biotech)
were used according to the manufacturer instructions. To obtain plasmid DNA of
suitable quality from Rhizobium, alkaline lysis was carried out and the DNA
transformed into DH5α, from where a second plasmid isolation was made.
For the PCR screening of library strains the following DNA isolation was used:
Colonies were transferred into TE (50µl) using a toothpick. The suspension was
boiled in a water-bath for 10 minutes and the cell debris removed by centrifugation
(13,000rpm 5min). For PCR amplification, 1µl of the supernatant was used.
TE is Tris-HCL (10mM, pH as appropriate), EDTA (1mM)
2.5.1.2 Chromosomal preps
Chromosomal DNA from Rhizobium was prepared as follows:
The strain was grown in TY (50 ml) with appropriate antibiotics to late logarithmic
phase. The culture was transferred to a 50 ml SS34 Sorval tube and centrifuged
(7000 rpm for 10min). The cells were resuspended in TES (4ml; 0.2 M Tris-HCl pH
7.5, 5mM EDTA, 100 mM NaCl) and the centrifugation and resuspension repeated.
Lysozyme (0.2ml; 10mg/ml in TES) and RNAase (0.04ml; 10mg/ml heat shocked)
was added and the reaction incubated (37oC, 30 min). TES (4ml), pronase (0.4ml;
10 mg/ml in TES self digested at 37o for 1 h (Sigma protease type E)) and sarkosyl
(0.24ml, 10%) were added and the reaction incubated (37oC, 30 min). The solution
40
was phenol/chloroform (Phenol:Chloroform:isoamyl alcohol, 25:24:1) extracted on
ice (Swirling) for 30 min (Equal volume of phenol/chloroform). The sample was
centrifuged (16000 rpm for 20 min) and the top (aqueous) layer collected using a
Gilson tip (1ml) with the end cut off. The phenol extraction was then repeated twice.
The aqueous layer was collected and Na-Acetate (0.1 volume, 3M) and ethanol (2
volumes, 100%) added. The clumped DNA was removed to an Eppendorf and
centrifuged to pellet the DNA. The DNA was then washed in ethanol (70%) and
dried in a vacuum dessicator, taking care not to over dry the DNA. Resuspension of
the DNA (0.75ml TE pH8.0) took place overnight (On a windmill at 4oC). The
resuspended DNA was phenol/chloroform extracted four times followed by an
extraction overnight (On a windmill at 4oC). The DNA sample was precipitated
using Na-Acetate (0.1 volume) and ethanol (2 volumes) and resuspended overnight
in TE (0.3ml, pH8.0).
2.5.2 Restriction digests
Restriction digests were carried out according to manufacturer specifications (Gibco
BRL).
2.5.3 Ligations
Ligations were carried out using T4 DNA ligase (Promega). Reactions were
routinely carried out overnight at 4°C or for 4 hr at 15°C.
41
2.5.11 Transformation
Competent DH5α cells were prepared using calcium and transformations were
carried out as previously described (Sambrook, et al., 1989) using LB in place of
SOC.
To achieve high transformation frequencies for the library construction,
Supercompetent E. coli XL2 (Stratagene) were used according to manufacturer
instructions.
2.5.4 De-phosphorylation of DNA
DNA (5-10 µg) was digested with calf intestinal phosphatase (Boehringer
Mannheim: 1 to 10 units) in 1X reaction buffer (Boehringer Mannheim) at 37oC.
After digestion the sample was phenol extracted twice. The DNA was recovered by
ethanol precipitation and resuspend in TE.
2.5.5 Removal of 5' single stranded DNA
5' DNA overhangs were filled to produce blunt ends using Klenow (1-3 units) in the
presence of dNTPs (20µM each). The reaction was incubated at 37 °C for 30min.
Termination of the reaction was achieved by heat shock (75 °C for 10min) followed
by phenol:chloroform extraction and ethanol precipitation.
42
2.5.6 Removal of 3’ single stranded DNA
Single stranded 3’ DNA overhangs were removed by reacting with T$ DNA
polymerase (Gibco BRL) according to the manufacturers instructions. Reactions
were carried out at 11°C for 20 min in the presence of dNTPs (0.33mM). The
reaction was stopped by adding EDTA (0.5M) followed by phenol:chloroform
extraction and ethanol precipitation.
2.5.7 Agarose gels and staining
Electrophoreses of DNA was routinely carried out in 0.8% agarose gel with 1X TAE
buffer (Tris-acetate (40mM), EDTA (1mM) ). The DNA was visualised by staining
in ethidium bromide and viewing under UV excitation.
2.5.8 DNA Extractions from Agarose Gels
DNA was extracted from agarose gels by excising the relative DNA band from the
gels and extracting the DNA using Prep-A-Gene (Biorad), or Geneclean (Bio 101)
according to manufacturer instructions.
2.5.9 Sequencing
DNA sequencing was carried out by the departmental (AMS) sequencing service
using the ALF Express system (Pharmacia Biotech). Plasmid DNA prepared using
FlexiPrep kits (Pharmacia Biotech) and primers were Cy5 labelled. Sequencing was
carried out using the thermal sequencing protocol.
43
2.5.10 Conjugations
Tri-parental conjugations were carried out using the plasmid pRK2013 in E. coli
strain 803 to provide transfer genes. Throughout the procedure, cell suspensions
were manipulated using pipette tips that had their tips aseptically removed.
Cultures (10ml) of helper (pRK2013) and any donor plasmids were grown overnight.
Early the next day fresh LB (10ml) with appropriate antibiotics was inoculated with
the overnight cultures (0.2 ml). These were grown for 2-3 hours at slow speed
(approximately 100rpm) until the cells were at mid-logarithmic phase. The donor
strain (1ml) and pRK2013 (1ml) were centrifuged (6500rpm, 4 min.) and the pellet
resuspended in TY (1ml). This wash stage was repeated. To prepare the recipient
strain, a slope of Rhizobium 3841 was washed in TY (3ml). The donor (0.4ml),
Rhizobia (0.4ml) and pRK2013 (0.2ml) were mixed and centrifuged (6500rpm, 4
min). The pellet was resuspended in TY (30µl) and spread on sterile filters (Hybond
N, Amersham) placed on dried TY plates and incubated (Overnight, 27°C). The
following morning the filters were removed using sterile forceps and placed in a
universal bottle containing TY and glycerol (15%). The cells were suspended by
agitation and a sample streaked on selective plates. The remaining cell suspension
was Snap frozen in liquid nitrogen and stored (-20°C).
2.5.12 PCR
Polymerase Chain reaction (PCR) amplification was carried out using Bio-x-act
polymerase (Bioline, 2-5 units) on a Omnigene thermal cycler (Hybaid). A 100µl
44
reaction mix (1x polymerase buffer) was used containing Template DNA, primer
(200ng of each), dNTP (0.2mM of each), MgCl2 (2mM) and Polymerase.
The reactions were carried out in thin walled 0.5ml Eppendorf, with mineral oil
covering the reaction solution. The reaction conditions used for library screening are
as follows:
One cycle:
Denaturation 94°C 4min
Thirty cycles:
Denaturation 94°C 45sec
Annealing 55°C 45sec
Extension 72°C 10min
One cycle:
Extension 72°C 10min
For PCR of DNA for cloning the following reaction times were routinely used:
Thirty cycles:
Denaturation 95 oC 1.5min
Annealing 55 oC 1.5min
Extension 72 oC 1.5min
One cycle:
Extension 72 oC 1.5min
45
2.5.13 Linker production
The two oligonucleotides to be annealed were mixed in equimolar amounts in
approximately 20µl TE. They were boiled for 5min in an Eppendorf with the lid on
and the reaction mix centrifuged to the bottom of the tube (Pulse). The reaction was
returned to the boiled water and allowed to anneal as it cooled to room temperature.
2.6 Pea growth
Pisum sativum cultivar Feltham First (Sutton seeds) were used throughout this
project.
2.6.1 Surface sterilisation and Germination
Peas were surface sterilised by soaking in ethanol (70%, 30 sec), washed in sterile
distilled water, soaked in sodium hypochlorite (2%, 10 min), followed by at least 3
washes in sterile distilled water. All solutions were used at volumes to cover the
peas.
The sterilised peas were placed in a petridish with sterile distilled water soaked filter
paper and allowed to germinate in the dark for between 6 and 16 hr. Growth of the
peas was carried out either in flasks or universal bottles as required.
2.6.2 Pea Growth in Flasks
Flasks (250ml) were prepared with vermiculite (100ml), cottonwool plugs and
autoclaved. The vermiculite was saturated in sterile N-free rooting solution and a
46
germinated pea placed on the surface. Flasks were inoculated with appropriate
strains (See text for details). A routine inoculum consists of the appropriate strain
grown overnight in TY or AMS with antibiotics. The inoculum was washed twice in
N-free rooting solution and inoculated onto the pea (0.5ml). The flasks, wrapped in
aluminium foil, were incubated at room temperature until the pea shoot reached the
cottonwool plug, when it was pulled above the flask neck and the plug replaced.
Growth was continued in the presence of a grow light (Sonti Agro, 16/8 hr light/dark
cycle) at room temperature until harvest (up to 5 weeks after germination). During
growth plants were watered with sterile N-free rooting solution as appropriate.
N-free rooting solution consists of:
CaCl2.2H20 1mM
KCl 100µM
MgSO4.7H2O 800µM
Fe EDTA 10µM
H3BO3 35µM
MnCl2.4H2O 9µM
ZnCl2 0.8µM
Na2MoO4.2H2O 0.5µM
CuSO4.5H2O 0.3µM
After sterilisation, the following are added:
KH2PO4 3.7mM
Na2HPO4 4mM
47
2.6.3 Pea Growth in Universal bottles
Universal bottles were filled to capacity with vermiculite and autoclaved.
Autoclaving reduces the volume of the vermiculite allowing room for a pea to be
placed on the surface of the vermiculite. Sterile N-free rooting solution (12ml) was
added along with respective inoculum and the pea covered in sterile fine sand. The
universal bottle, wrapped in aluminium foil, was placed under the grow light (as
above) and the pea incubated for up to 10 days before harvest.
2.6.4 Nodule harvesting
Nodules were harvested from pea plants after 4 weeks growth. The nodules from
root systems were collected on ice and surface sterilised. Sterilisation consisted of
soaking the nodules in sodium hyperchlorite (2%, 10 min). Three washes in sterile
distilled water were carried out. The nodules were then crushed in 10µl sterile
distilled water using a disposable pipette tip. The resulting solution was frozen (2µl
in 98µl of TY and 15% glycerol) and patched onto TY with appropriate antibiotics.
2.6.5 Rhizosphere harvesting
To harvest Rhizobium from the rhizosphere of pea plants grown in universal bottles,
individual roots (Shoot and pea removed) and vermiculite were ground in N-free
rooting solution (20ml) using a sterile pestle and mortar. The cell suspension was
filtered through a Whattman filter paper to remove large particles. The filtrate (8ml)
was centrifuged (8,500rpm, 30 sec) to remove particulate matter and the supernatant
centrifuged (13,000, 5 min) to collect the Rhizobium. The pelleted cells were
48
resuspended (50µl N-free rooting solution, 7.5% ficol) for observation and optical
trapping.
2.7 Optical Trap
For full details of the construction of the optical trap see chapter 3.
2.7.1 Microscope
A standard Nikon Optiphot epifluorescence microscope was adapted for trapping
(see Chapter 3)
2.7.2 Laser
An infrared (IR) Nd YAG laser (1064nm) was used with a He Ne laser mounted
coaxialy behind it (SL50IT; Spectron). An electrical shutter and a beam-expanding
telescope were mounted in front of the laser units. Lasers were run according to
manufacturer instructions between 0.8 and 1.2W.
2.7.3 Set Up of trap
The laser housing and microscope were mounted on a custom built rack. This brings
the horizontal plane of the laser level with the epifluorescence port and maintains
continuity between the laser and microscope. The height of the laser with respect to
the microscope can be adjusted using thin wedges below the laser supports.
49
The microscope was mounted at 90° to the normal angle of operation so that the
epifluorescence tube runs parallel to the laser housing. Adjusting the eyepiece 90° to
allow viewing of the sample accommodated this.
The laser was steered by a series of mirrors and dichroic mirrors. After emerging
from the laser housing, the beam is steered through 90° horizontal using an
adjustable IR mirror. This is mounted on the invar rails and allows both coarse and
fine adjustment in the vertical plane of the laser.
The beam enters the microscope via a custom-built port and dichroic mounting
(Micro Instruments; Longhanborugh UK) turning the beam through a further 90°
horizontally. This unit consists of a sliding mount for 3 dichroic mirrors (D1)
originally designed to allow the passage of the ultra violet (UV) excitation beam
directly through the tube whilst reflecting the laser into the same beam path. Finally
the laser was reflected vertically down onto the objective lens by a dichroic mirror
mounted on a custom built slider. A standard epifluorescence unit was mounted
above this to facilitate fluorescence microscopy.
2.7.4 Objective lens
Standard phase contrast lenses were used. For trapping a 100x oil immersion lens
with numeric aperture (NA) 1.25 was used (Nikon)
50
2.7.5 Viewing IR laser
To view the IR radiation three methods were employed. The TV and video system is
sensitive to long wavelengths allowing the sample to be safely viewed along with the
IR laser. To view the passage of the IR laser through the optics of the system, an IR
imaging device was used (Find-R-Scope; FJW Optical Systems. inc.). This hand
held electronic viewer extends the visual range of the human eye to longer
wavelengths by producing an image on a phosphorescent screen. A fluorescent
screen (Spectron) was also used to produce an image of the laser along its path.
2.7.6 Microscope Stage
A microscope stage with micrometer controls (Micro instruments) was used to allow
the fine control of the movement of trapped cells.
2.7.7 Trapping single cells
Isolation of a single cell was achieved using 0.05mm and 0.1mm path length
microcapillary slides (Camlab Ltd. UK) sealed with Vaseline as previously described
(Mitchell, et al., 1993). Flaming forceps, scalpels and glass slides with ethanol and
wiping the objective with ethanol maintain the sterility of the system. Once trapped
manipulating the focus and microscope stage moved the cells with respect to their
surroundings.
51
Chapter 3
Construction Of An Optical Trap
3.1 Introduction
Optical trapping allows the isolation of a single identifiable bacterial cell from a
population viewed by microscopy. The cell can be subsequently studied or grown in
isolation from the population in which it was derived. In the classical studies of gene
expression, cells are screened under laboratory conditions. This restricts the scope of
the study to promoter induction that can be simply modelled. The genetic response
of bacteria in natural environments where conditions are complex and cannot be
artificially created in the lab, are difficult to study. The optical trap can be used to
look at and isolate bacteria either during or immediately after exposure to a complex
environment, such as a plant root. This removes the need to screen under laboratory
conditions.
In this chapter, the design criteria and construction of an optical trap are discussed.
3.2 Construction of the Trap-Methods and Results
3.2.1 Requirements for an Optical Trap
The basic principle of optical trapping involves the refraction of light by the object
being trapped causing a momentum change to the object. To make use of this the
52
system must be designed so that the momentum change results in the object being
restrained at a defined point.
As discussed in section 1.4, several criteria are necessary to achieve trapping. The
first consideration is the light source. The collimation and coherence obtained from
laser sources is essential as the initial momentum of the photons within the beam
must have the same vector to achieve uniform momentum changes on the trapped
particle. The light intensity across the beam diameter needs to have a Gaussian
distribution to achieve maximum trapping at the focal point. This was achieved by
using a TEMOO laser profile.
The wavelength of the laser was another important consideration. A wavelength in
the infrared spectrum, 1064nm, was chosen as this wavelength is not absorbed much
by the biological material and is generally thought to be the least damaging. In
studies using traps to manipulate chromosomal structures in animal and fungal cells,
wavelengths between 700 and 100nm were compared with 1064nm. These were
found to induce less heat production by water absorption and so may be less
damaging, allowing higher trapping powers to be used (Berns et al., 1992). We used
a Nd YAG laser (1064nm) with a He Ne laser mounted coaxially behind it (SL50IT;
Spectron). The HeNe Laser produces a visible red beam that allows the IR beam to
be aimed.
In consideration of the requirements for the microscope, the objective lens used for
focusing the laser needs a high numeric aperture. The resultant acute focusing angle
achieves maximum trapping forces (Afzal and Treacy, 1992).
53
Fig. 3.1. Development of the optical trap from a, the original design to b, the final operational system. Laser path shown in red, UV path shown in blue. Additional parts added to the system are shown in hatched lines. For details see text. For full labels see Fig. 1.2.
a)
b)
Custom made Dichroic holder inserted between UV input port and UV lamp
Dichroic - reflects IR and transmits some UV - allows input of laser.
Special dichroic - reflects UV and IR, transmits visual wavelengths.
Note laser passes through optics for focusing UV, and path length correcting lens.
IR Safety filters inserted to protect user and CCTV
UV lamp and input port turned through 180°
Custom built input port and dichroic holder inserted between UV dichroic and objective - contains no pathlength correcting lens
Standard UV excitation blocks
Custom dichroic - Reflects IR, transmits UV and visual wavelengths
54
3.2.2 Development of the Trap
The initial design for the trap involved the laser entering the microscope via a port in
the side of the epifluorescence tube. It was then reflected through 90° by a dichroic
mirror that allowed the passage of the UV excitation wavelengths. The excitation
filter was mounted between this dichroic and the UV lamp. This allowed the laser
and UV to follow the same path to the objective lens being reflected by a second
complex dichroic which transmitted visible wavelengths (transmission 525 to
825nm; reflection 475 to 535nm and above 825nm) (Fig. 3.1a). This initial set up
caused several problems.
The epifluorescent tube contains a shutter for controlling the UV illumination. This
incorporated a heat filter that absorbed IR radiation. Removal of the shutter allowed
operation of the laser but prevented control of the UV and risked overheating the
cells when exposed to UV light.
When operating with this set-up, the IR image viewed on the CCTV monitor
revealed a series of diffraction rings and reflections. We were also unable to obtain a
focal point for the laser. This may have been due to the laser not filling the back
aperture of the objective, the laser being 2.4mm (1.2mm through a 2x telescope)
diameter and the back aperture being 5.5mm. Diverging the beam to fill the back
aperture of the objective was considered. A lens holder was built to hold eyepiece
lenses on the invar railings between the laser aperture and the steerable IR mirror
(Fig. 3.2). In an attempt to diverge the laser, a series of eyepiece lenses were tried at
this position (2.5x; 3.2x; 5x; 6x; 10x). The divergence of the beam was measured
55
CCTV
He Ne Laser Ne-Yag Laser 4x Telescope Electronic Shutter
Heat sink
85% IR Mirror
85%
15%
IR steering Mirror - 3D adjustable
Invar rails
Mirror housing
Neutral density filter holder
Manual shutter
IR Mirror
Visual light source
Microscope stage
Condenser lens
Objective lens
Removable Dichroic - Reflects IR, transmits UV and Visual wavelengths
UV Source
Path length correcting lens
UV controls: Iris Shutter collector lens IR
Filter
Dichroic filter block: Replaceable for different UV excitation conditions
Eye piece lens
IR safety filter Beam
splitter
Fig. 3.2. Schematic of the optical trap showing the laser path (red) UV excitation (Blue) and visual light (yellow). Note the top part of the diagram depicting the laser housing and set up is shown in plan view and the microscope is shown is side view (see photographs a and b overleaf). Not to scale.
Custom built input tube and dichroic housing inserted between UV input tube and objective
56
Fig 3.2a Photograph of the optical trapping microscope. Note the attenuation optics are housed in the silver box behind the laser input port (Right) and the laser housed in the cream box behind the UV light box (vented box left). In this photograph the standard microscope stage is shown. For optical trapping a micrometer controlled stage is used.
57
Fig 3.2b Photograph of the attenuation optics from above. This apparatus is covered during operation. The switch in the top right of the box is an interlock preventing the laser being operated if the lid is removed. The laser enters from the left (cream box) and is attenuated by reflection from the 85% reflective mirror to the heat sink (Black wedge). The working beam is reflected 90° by the steering mirror (centre) through the neutral density filters. The beam then leaves the attenuation optics (bottom) through a manual shutter (Black knob, bottom right) and is reflected through 90° into the laser input tube (bottom left).
58
crudely over a known distance by measuring the diameter of the image produced by
the red laser and by estimating the focal point by observation using the laser screen
(data not shown). None of these lenses gave an appropriate divergence. However,
by using a Phase telescope and adjusting its focal point, it was possible to obtain a
weak video image of the IR laser reflected from an IR mirror on the microscope
stage. This image still contained many diffraction rings and reflections and was too
weak to reflect from a glass slide.
Within the epifluorescence tube and dichroic housing there are two lenses. The first
is a collector lens to maximise the UV reaching the objective. The second, below the
dichroic reflecting the laser and UV to the objective, compensates for the additional
length created between the eyepiece and objective lenses by the addition of the
epifluorescence equipment. Removal of the collector lens allowed us to obtain a
focused IR beam with both 60x and 100x high NA objective lenses without having to
diverge the laser. The image was obtainable from reflections from both a glass slide
and IR mirror. Removal of the path-length correcting lens eliminated the
problematic diffraction rings. It was surmised that these were created by the
interaction of curved waveforms reflected from the lens surface interacting with the
linear laser wave fronts.
Removal of these lenses prevented the use of epifluorescence and so a new design
for the trap was considered. A new housing was constructed (Micro instruments)
based on the epifluorescence tube and dichroic mounting but without any lenses or
heat filters. This replaced the old epifluorescence tube and contains a simple
dichroic (D2) that reflects IR (1064nm) and transmits visual wavelengths and some
59
UV (transmission 425 to 975nm). The old epifluorescence tube, dichroic housing
and lamp were then mounted above. This allows standard filter blocks to be used for
fluorescence rather than having to separate the excitation filter and use a complex
and expensive dichroic for both UV and laser reflection. The two lenses and the
shutter and heat filter can also remain in place (Fig. 3.1 and 3.2).
Three minor considerations should be noted with this set up. Due to the increased
path length, there is a reduction in the excitation energy reaching the sample. This
has not created a problem as the UV lamp gives a large excess of power, which is
limited to prevent bleaching of the sample by using neutral density filters. In the
new set up, enough excitation can be achieved by reducing the power of these filters.
The new tube set up does not contain any path length correcting lenses. This results
in the objective lenses being no longer parfocal. This is only a minor inconvenience
as most of our work is carried out at 100x with little reference to other
magnifications.
Finally, the dichroic reflecting the laser does not transmit wavelengths shorter than
425nm. This means that for some excitation wavelengths, such as those for the ELF
stain, this dichroic must be removed during fluorescent observations. Again this is
not a major problem, as once a cell is identified, the excitation wavelength should be
switched off to prevent cell damage.
60
3.2.3 Alignment of the laser
The alignment of the laser was carried out empirically over a number of months. To
achieve efficient trapping the laser must fill the back aperture of the high NA lens.
The beam must also be centred on the lens so that the trap is in the field of view of
the camera. This also has a bearing on the efficiency of the trap and the creation of
equal forces on the cell.
To align the laser with the microscope, an aluminium plug was machined with
central cross hairs engraved on it. This was inserted into the side port of the first
dichroic housing. Initial coarse adjustments to the laser path were made with the fine
adjustment screws on the steering mirror (Fig 3.2) at their midpoint, by aiming the
Ne He laser onto the target cross-hairs. Vertical alignment of the laser was carried
out by raising the laser housing from the frame using a series of metal plates. These
were inserted at the corners of the housing, which was bolted through the plates to
the frame. Horizontal alignment was achieved by moving the mirror along the invar
railing. Adjustment was also carried out by rotation of the mirror on its axis (Fig.
3.3). Fine adjustment was carried out using two screws that allowed very fine
movements of the steering mirror within its mounting. The alignment was then
checked for the Ne YAG laser using the IR viewer. This sequence of alignment with
the visible laser followed by checking the IR laser was continued throughout the
alignment procedures.
61
The alignment plug was removed and the laser path opened to the objective lens. An
epifluorescence target was inserted into one of the objective mounts and the red laser
finely adjusted to the centre cross using the screws on the steering mirror. This
allows accurate alignment of the laser as the target is designed for focusing the UV
excitation beam to the centre of the objective lens. Further adjustments were carried
Fig. 3.3. Schematic diagram showing the adjustment of the laser position to fill the objective back aperture. Insert shows fine adjustment.
Coarse vertical adjustment by raising laser housing on small wedges.
Coarse horizontal adjustment by sliding mirror along invar rails
Vertical adjustment by turning the steering mirror holder.
Coarse adjustment of laser made on target cross hairs etched on plug inserted in first dichroic input port.
Dichroic aims laser into microscope when plug removed.
Fine adjustment of laser achieved by turning screws on steering mirror. These pivot mirror on both the vertical and horizontal planes.
62
out while viewing the laser with an IR viewer in place of one of the microscope
eyepiece lenses. The final positioning of the laser focal point was monitored on the
CCTV.
Whilst viewing the laser on the CCTV, the IR safety filter was remover from its
position between the epifluorescence block and the eye piece prism. This allows the
image of the laser to be observed. During normal operation of the trap, this filter is
left in place, the position of the laser having been marked on the CCTV monitor.
3.2.4 Development of the Trapping Protocol
To allow the manipulation of the single cell once it has been trapped and isolated, a
protocol was developed using microcapillary tubes (Camlab Ltd. UK). These are
optically flat capillary tubes that can be used in place of a microscope slide and
coverslip. The microcapillary tube is filled with sample using capillary action and
placed on a microscope slide with immersion oil of use under the microscope (Fig.
3.4). The microcapillaries are available with path-lengths of 0.05mm, 0.1mm and
0.2mm. To facilitate the isolation of a single cell, the microcapillary is at least three-
quarters filled with sterile broth before the sample is loaded in the remaining quarter.
The trapped cell can then be moved to the sterile broth and the tube end containing
the cell cut off using a scalpel.
Initial attempts to run the trap in the configuration described above (Fig.3.1 and Fig
3.2) resulted in bacteria and yeast cells being trapped and moved. Cells moved to the
focal point of the laser using the microscope stage controls and focus adjustment,
were trapped and subsequent movement of the stage resulted in the cell being held in
63
the centre of the field of view while the un-trapped cells moved past. The trapped
cell was held just out of visual focus due to the differences in wavelength and hence
focal depth, between the laser and the visual wavelengths.
Initial problems with cell streaming within the microcapillary tubes were overcome
by ensuring the ends of the tube were sealed with Vaseline. It was found that it was
not necessary to sterilise the immersion oil or Vaseline used on the microcapillaries
Objective lens
Immersion oil
Vaseline
Microcapillary tube
Glass slide
Sterile media Gradient of cell culture
The trapped cell can be moved up and down by focusing the microscope.
Trapping Laser
Horizontal movement is achieved by moving the microscope stage.
Once isolated from other cells, the trapped cell can be removed by cutting out a section of the microcapillary tube.
Fig 3.4. The arrangement of the microcapillary tube for optical trapping. A trapped cell in a microcapillary tube can be isolated by movement of the microscope stage. The trapped cell is cultured by cutting out the capillary section and placing it in fresh growth media.
64
as no growth occurred on LA or TY plates or in LB or TY broth when inoculated
with these compounds. Microcapillary tubes were initially autoclaved. After this
treatment however many of them stuck together and would not fill with cells. The
0.05mm tubes could not be flame sterilised as they melted however 0.1mm tubes
could be flame sterilised. Several non-sterilised 0.05mm tubes were placed in LB
and as no growth was observed, subsequent trapping was carried out using either
0.05mm tubes direct from the manufacturers packaging, using sterile forceps, or
more commonly flame sterilised 0.1mm tubes.
It was also noted during these initial trials, that cells on the bottom of the tube were
harder to trap. This had several implications to the running of the trap. Firstly if a
sample was left under the microscope for a long period of time it became
increasingly difficult to trap cells as they settled. Once on the bottom of the tube,
they were impossible to trap. Secondly, once a cell was trapped, it became more
stable in the trap if it was moved towards the top of the microcapillary tube by
adjusting the stage using the microscope focus. This allowed cells to be moved more
quickly and also avoided collisions with other cells, which were settling to the
bottom. This effect was described previously (Felgner et al., 1995).
These initial experiments were carried out with a laser output of between 1.0 and
1.4W. At these power levels, several cells could be trapped together and cells near
the trap were observed being pulled towards it.
Growth conditions for the initial attempts to culture a trapped cell are shown in Table
3.1. The section of tube containing the trapped cell was cut out using flame-
65
sterilised scalpel and forceps, placed in growth media and incubated. Non of these
conditions resulted in growth. Sections of tube cut from the microcapillary either
side of the section containing the trapped cell (fig3. 4) also gave no growth.
STRAIN GROWTH MEDIA No CELLS
IN TRAP NUMBER OF ATTEMPTED RECOVERIES
RECOVERY MEDIA
DH5α ∗ LB(Kn or Ap) 1 9 LB DH5α ∗ LB(Kn or Ap) 1 4 LB(Kn or Ap) K12 LB 1 3 LB K12 LB 3 1 LB K12 LB 1 2 BHI 3841/pIJ1687 TY (Tc) 3 3 TY 3841/pIJ1687 AMS 1 2 TY 3841/pIJ1687 AMS 1 1 AMS Table 3.1. Summary of the conditions for the attempted growth of bacterial cells isolated using the optical trap. None of these conditions resulted in the growth of the trapped cells. * These strains had plasmid pGFP, pGOT-K or pGOT-K-LacZ as markers.
The power of the laser was considered to be the most likely cause of this failure. It
was not possible to reduce the power of the laser below 1.0 W by reducing the
current to the flash tube below a critical minimum. The beam was therefore
attenuated after passing through the telescope. At the same time the telescope was
converted from 2x to 4x to give a final beam diameter of 5.2mm to fill the objective
lens back aperture.
3.2.5 Attenuation of the Laser
To attenuate the laser, a partial IR mirror was inserted into the laser path between the
laser aperture after the telescope and the steering mirror (M1). This IR mirror
reflects 85% of the laser to a heat sink, and is mounted on the invar railing using a
66
custom made mount that gives the mirror full adjustability in all directions. After the
steering mirror a custom built holder was positioned into which neutral density filters
could be placed. This holder was fixed perpendicular to the laser path (Fig 3.2 and
Fig. 3.3). This whole apparatus was enclosed in an aluminium box with black
internal surfaces and accessed through a lid interlocked to the laser control system.
Mr. A Dawson carried out the construction of these holders and box in the
department workshops.
This apparatus allowed us to control the power of the laser while maintaining its
profile and integrity (Fig. 3.5). The laser power at the sample was estimated
according to equation (1). P is the estimated power at the sample, O is the output of
the laser in Watts extrapolated from the tube current. I/I0 is the transmission value
for the neutral density filter calculated from its optical density using equation (2).
The factor 0.15 in equation 1 is the correction for the 85% mirror.
(1) P=0.15 O (I/I0)
(2) A=-log10 (I/I0)
The laser power was measured at various points along its path using different neutral
density filter combinations (Fig. 3.5). This was carried out by Jonathan Eaton (Royal
Berkshire Hospital).
Measurements were taken at the neutral density filter holder and the microscope
stage. The output of the laser as measured differed dramatically from the values
67
stated by Spectrum (Fig. 3.5a). At low input currents (13 amps) the output was
measured as only 147mW where as the stated output was 1.75W. As the input
current was increased, the measured output increased more rapidly than the stated
output so that at a current of 18 amps, the measured output was 2.22W and the stated
output was 2.66W.
The power output obtained after the 85% IR mirror had been positioned indicate that
in this set up the mirror reflects about 90% of the energy. This is probably attributed
to the angle the mirror had to be placed at to allow it to reflect to a heat sink on the
attenuation apparatus casing.
A second set of measurements taken at the microscope stage with the 85% mirror in
place gave almost identical results indicating that there is negligible loss of energy
through the dichroics directing the beam to the objective. Measurements were taken
with the objective lens removed as only a collinear beam could be measured.
The measurements taken with the neutral density filters indicate that these attenuate
the beam within the scope of their theoretical values. Fig 3.5 demonstrates that the
attenuation occurs according to the value predicted from the OD value.
Subsequent estimations of the laser output were made using the curve produced from
measuring the output with the 85% mirror in place. If neutral density filters were
used, the attenuation attributed to them was calculated according to their theoretical
absorption.
68
(a)
0
500
1000
1500
2000
2500
3000
12 13 14 15 16 17 18 19Input current I (Amps)
Out
put p
ower
(mW
)
Value quoted inSpectrum manual
Measured current atlaser output port afterthe 4x telescope
Laser Power measuredat stearing mirror afterattenuation by 85%reflective Mirror
(b)
0
50
100
150
200
250
12 13 14 15 16 17 18Input current I (Amps)
Out
put p
ower
(mW
)
Laser Power measuredat stearing mirror afterattenuation by 85%reflective Mirror
Power Laser powermeasured atmicroscope stage withobjective lens removed.
mW Power measured atmicroscope stage withOD 0.1 neutral densityfilter.
mW Power measured atmicroscope stage withOD 0.3 neutral densityfilter.
mW Power measured atmicroscope stage withOD 1.0 neutral densityfilter.
Fig. 3.5. Graphs showing the power levels for the optical trap. (a) The difference between the published power and the measured power through the telescope, along with the attenuation achieved by the 85% IR mirror. (b) The attenuation obtained using neutral density filters.
69
3.3 Isolation and Culturing of Single Cells
Trapping and isolation of single bacteria was carried out using estimated power
outputs in the tens of milli-watts range. Both E. coli and Rhizobium were trapped
and singe cells moved to the sterile broth towards one end of the capillary tube. The
segment containing the single cell was then cut out using a flame sterilised scalpel
and placed in sterile growth media (10 ml) in a universal bottle using flame-sterilised
forceps.
In the trial experiments carried out using DH5α with the plasmids pGFP, pGOT-K
and pGOT-K-LacZ. Power levels of between 6.5 and 16 mW proved too low to give
efficient isolation of the cell, taking over 10 minutes to move a cell about 5mm
necessary to ensure isolation (0.5mm.min-1). 30 mW was shown to give better
trapping speeds with both E. coli and Rhizobium (2 to 4 mm.min-1 for Rhizobium).
In the absence of viable growth after trapping, an attempt was made to establish how
long a cell remained viable in the trap. Motility is easily monitored under the
microscope and so attempts were made to trap motile cells and establish if they
remained motile after a period of time in the trap (Table 3.2). Trapping motile cells
is extremely difficult therefore the sample size is small and the laser power was
increased. It should also be noted that loss of motility does not indicate loss of
viability, just that cell damage or stress is occurring. At higher laser powers (65mW)
the cell did not remain motile. At lower laser powers (30mW) the cells escaped from
the trap due to there own motility.
70
Laser
Power
Time in Trap
(Min:Sec)
Escaped (E) or
Released (R)
Motile? Notes
30mW 0:35 E Yes Cell swam out of trap
30mW 0:22 E Yes Cell swam out of trap
65mW 1:27 R No Power too high
45mW 1:14 R No Cell only slightly motile when
trapped
45mW 0:44 R Yes Still motile when released
45mW 1:27 R Yes Cell motile when released
1:20 R No Re-trapped for further 1:20
Of particular note is the final cell in table 3.2. This cell was still motile when
released after 1min 27 sec. The same cell re-trapped 3 sec later and held for a further
1min 20 sec, was no longer motile. Although the sample size for this experiment
was small due to the difficulty of trapping motile cells, it did indicate that at 45mW
Rhizobium could remain trapped for about 1.5 min with no loss of motility, indicting
they are still viable.
Another problem noticed with these experiments was that motile cells were moving
along the tube, leading to the possibility of contaminating isolation area for the
trapped cell. Various concentrations of Ficoll in the trapping media were tested in an
attempt to increase the viscosity of the broth and thereby reduce cell motility. It was
Table 3.2. The maintenance of motility after trapping as a measurement of viability is shown. The final cell was re-trapped for a further 1:20 (arrow).
71
found that a Ficoll concentration of greater than 5% prevented motile cells from
moving rapidly.
To determine if the media within the microtitre tube and the growth broth in which
the section containing a cell was able to mix, an experiment with dye in the
microtitre tube was devised. It was thought that maybe the immersion oil that coated
the ends of the microcapillary tube when it was cut might prevent cells escaping the
tube. If the dye diffused from the tube it would indicate that any cell in the tube may
also be able to escape. Bromophenol blue (2.5mg.ml-1) was added to the Ficol and a
series of capillary tubes filled. Segments were cut out and placed in TY broth and
the dye remaining in the tube scored at 1 hr and 1 day (Table 3.3)
This indicated that mixing of the tube contents was greater from the 0.1mm
microcapillaries and that the higher percentage Ficoll also gave greater mixing.
Using immersion oil also led to greater mixing rather than preventing the tube
contents from leaking into the broth as was expected.
Using a 7.5% ficol concentration and low power leavel (30mW) obtained through the
attenuation of the laser, we obtained, from a group of 14 trapped Rhizobium, growth
from two microtitre slides. To establish if a culture grown from an isolated cell was
due to that cell or from cells drifting or swimming into the section of tube, mixed
cultures were used. The constitutively fluorescent RU1081 was mixed 1:10 and
1:100 according OD600 with non-fluorescent RU1080 (See chapter 3 for details of
these strains). At 1:100, the chances of a contaminating bacteria also being
fluorescent are low giving us reasonable confidence that if the resulting culture has
72
both the antibiotic marker as well as the fluorescence marker, that it was due to the
single isolated cell. Using this method, we demonstrated that 1 in 5 isolates were
cultured successfully under these conditions.
Ficoll
Concentrat
ion
Immersion
Oil
(Yes/No)
0.05 mm
Tube
Capillary 0.10 mm
Tube
Capillary
1 Hr 1 Day 1 Hr 1 Day
10 % Y - - - -
10 % N ++ - - -
5 % Y +/- - - -
5 % N +++ +++ -/+ -
0 % Y ++ - +++ -
0 % N +++ - +/- -
3.4 Discussion
In this chapter the construction and development of an optical trap has been
described. In the early attempts to develop the trap, the laser was inserted into the
microscope via the epifluorescence port. This was found to be unsatisfactory due to
the lenses found in this port. A custom built port was therefore designed and built.
This overcame the problems of using the epifluorescence port. It did however cause
Table 3.3. The effect on the ability of dye (Bromophenol blue 2.5mgml-1) to be released from a capillary tube containing variable ficoll concentrations. Scoring is for the amount of dye still visible in the microcapillary tube when placed in a universal containing growth media. +++ Dye still in microcapillary to - no dye in microcapillary.
73
a loss of quality of the microscope image as it disrupted the optics of the microscope.
This means the microscope no longer remains in focus when objective lenses are
changed. This has been a minor inconvenience as the microscope is dedicated to
optical trapping rather than high quality observation, and most work is carried out
using a single 100x objective.
To achieve trapping the laser had to be modified. The beam diameter was increased
to fill the back aperture of the objective lens using a 4x telescope in place of the 2x
telescope. The laser power also needed to be attenuated as its minimum setting was
too high for this work. A system of partial mirrors (85% reflection) and neutral
density filters has been used to achieve this
A protocol using microcapillary tubes has been devised to allow a single cell to be
isolated and aseptically transferred to growth broth. This has been tested to ensure
that the bulk population of cells and the isolated cell can be separated. The sterility
of the end of the tube into which the isolated cell is moved can be maintained during
its manipulation, allowing a single cell to be cultured.
Finally it has been shown that Rhizobium and E. coli can be trapped, isolated from
the bulk population and cultured. The recovery rate of trapped cells is about 1 in 5.
This value was established from a small sample size, but was confirmed in later
studies on the promoter libraries where a rate of 1 in 3 was obtained (Chapter 7).
The time taken to identify, trap and isolate a cell is a significant limiting factor in this
technique. Taking into account the set up time and sample preparation, it is possible
to trap around 12 cells in a day. However, the precision of obtaining single target
cells is unparalleled by any other technique. The ability to obtain spatial information
74
about the trapped cell is also of great significance. It would, for example, be possible
to isolate a Rhizobium from a piece of root thereby giving precise details of the
location of gene expression. The time taken to trap and isolate cells expressing
environmentally induced genes is not the rate limiting step, rather it is the analysis of
such fusions.
75
Chapter 4
Construction of promoter probe vectors
4.1 Introduction
A vector chosen for the construction of a Rhizobium promoter library must fulfil
several criteria. These include a broad replication range and suitable resistance
markers. As one objective of this work included inoculating the library into complex
environments with no antibiotic selection, it was considered that plasmid stability
was an important component. As well as the specific requirements of this project it
is also important to look at cloning procedures. The library construction was carried
out in E. coli as this organism grows fast and is easily manipulated for genetic
modification. The working library would be used in Rhizobium but considerations
for its use in other bacteria, for example Pseudomonas were made. The construction
of large representative libraries is facilitated if the plasmid is relatively easy to isolate
and manipulate. This is helped if the plasmid has a detailed restriction map or
preferably is completely sequenced.
A model of the necessary features of the promoter probe vector was devised. It had
to be a well characterised, broad host range plasmid that is stable in a complex
environment without antibiotic pressure. Antibiotic markers suitable for use in E.
coli as wall as Rhizobium needed to be incorporated in such a way as not to interfere
with the reporter genes. The nature of this work was to identify single bacteria under
the microscope. Promoterless reporter genes were needed that would enable
identification of individual bacteria under the microscope as well as colonies on agar
plates. There needs to be convenient cloning sites for genomic fragments upstream
76
of the reporter gene. The reporter section of the promoter probe vector must also be
transcriptional isolated from the rest of the plasmid. This prevents active promoters
on the plasmid inducing the reporter gene as well as the cloned promoters interfering
with the plasmids normal function.
Initially the vector pTR101 was selected. This is a RK2 (RP4) derivative and is very
stable due to the presence of the partition genes, parDE (Roberts, et al., 1990).
However, these genes made the plasmid difficult to isolate by standard laboratory
procedures, and this hindered further characterisation. We therefore tested and
subsequently used the plasmid pBBR1MCS (Kovach, et al., 1995). This plasmid has
a broad host range, moderate copy number and was easy to isolate and manipulate.
To facilitate its use for library construction, a series of new derivatives were
developed with different antibiotic resistance markers suitable for Rhizobium.
Several reporter systems were considered for this work, including gus and lacZ. Two
reporter systems were studied in more detail to determine there suitability for the
detection of gene expression in single cells. The first, phoA is a periplasmicaly
expressed enzyme, whose expression can be detected in whole singe cells under the
microscope using the fluorescent stain ELF (Molecular probes inc.). It can also be
detected on plates using 5bromo-4-chloro-3-inodolyl phosphate (XP). The second
uses a protein derived from the jellyfish Aequorea victoria (Chalfie et al., 1994;
Inouye & Tsuji, 1994). This protein, known as Green Fluorescent Protein (GFP), has
intrinsic fluorescence when exposed to UV light, which can be detected in single
cells.
77
4.2 Methods and Results
4.2.1 Characterisation of reporter genes for use in IVET-OT
A number of reporter genes were considered for the vector system. A reporter gene
for use in IVET-OT should enable the isolation of non-constitutive promoters and the
identification of those promoters when active. The reporter also needs to be
detectable on plates as well as in single cells under the microscope.
To produce an IVET vector in which selection against expression occurred, we
attempted to clone the SacRB gene. In this strategy we were attempting to select
against constitutive promoters. This gene produces an enzyme, which breaks down
sucrose producing a lethal product and can therefore be used as a negative expression
marker (Gay et al., 1985; Gay et al., 1983; Ried & Collmer, 1987). The sacRB gene
was cloned into pGEM-T as a 1.45Kb PCR fragment from pWS233 to give pRU162.
Attempts were made to clone sacRB into the SmaI site of pBluescript SK as a
NotI/NcoI infilled fragment. Thirty-five white colonies were obtained from two
ligations but restriction mapping indicated that in all cases the insert was cloned in
the wrong orientation; reading towards the lacZ promoter so it would not be
expressed. This indicates that expression of sacRB at high levels may be deleterious
even in the absence of sucrose in E. coli. This was confirmed by attempting the
cloning into pBluescript KS. Again clones were only obtained reading towards the
promoter. Intolerance to sacRB under the lacZ promoter could be due to the high
copy number of the bluescript plasmid. Although generally the sacRB genes would
not be expressed as highly in the final constructs, we were concerned that a stray
78
environmental promoter might cause toxicity due to its expression level. For this
reason, further work on sacRB was discontinued.
4.2.2 Construction of pPOT and pGOT vectors
The pPOT and pGOT vectors were designed as standard promoter probe vectors. A
number of important features were incorporated. A modular design was used
allowing different reporters and antibiotic resistance genes to be used. Initially
promoterless phoA was cloned as the reporter.
4.2.2.1 Cloning of Omega Transcriptional Terminators
For the promoter probe to operate correctly the reporter must be silent except when
influenced by the cloned promoter. To prevent promoters in the rest of the plasmid
effecting the reporter a transcriptional terminator (TT) was used. A second
transcriptional terminator was positioned after the reporter to prevent transcription
continuing into the rest of the plasmid and effecting its function.
The transcriptional terminator flanking the omega spectinomycin cartridge on the
plasmid pHP45 was amplified by PCR using the primers P12 and P13. This was
cloned into pGEM-T in both orientations giving pRU160 and pRU161. The
orientation of the cloned fragment was confirmed by restriction mapping and the
BamHI site in pRU161 removed by digestion with BamHI, followed by infilling the
cleaved ends and religating them (Fig. 4.1). This was done as BamHI was to be used
as the cloning sits for inserting promoters and so other BamHI sites needed
removing.
79
4.2.2.2 Cloning of phoA reporter gene
The reporter phoA was considered appropriate for this project as it was easily
monitored on both plates and in single cells. It was also sensitive enough to give an
pHP45
PCR (P12, P13)
Cloned into pGEM-T
pHP45
PCR (P12, P13)
Cloned into pGEM-T
SacII
BamHI SpeI PstI
NotI
PRU161PRU160
ApaI
SacII BamHI
SpeI PstINotI ApaI
Fig. 4.1. Schematic of the construction of pRU160 and pRU161. See section 4.2.2.1 for details. (Not to scale)
Transcriptional terminator
80
indication of the activity of promoters. In keeping with the strategy to make the
promoter probe vector modular, this reporter was cloned as a cassette. GFP was also
inserted into the vector in place of phoA to give a second reporter system.
Using primers P19 and P20, phoA was amplified by PCR from E. coli strain K12.
The forward primer was located close to the 5' end of the gene, including the ATG
but not the promoter. To produce a cassette, the PCR fragment was cloned into the
blunt SmaI site in pJQ254. This site lies between two NotI sites thereby allowing the
reporter to be inserted as an easily replaced cassette. This procedure can be used for
any sequenced reporter gene. To provide the upstream (read out) transcriptional
terminator it was cloned as a NotI cartridge upstream of the transcriptional terminator
in pRU161 with the infilled BamHI site (Fig. 4.2). The orientation of phoA was
confirmed by restriction mapping.
The transcriptional terminator and phoA were cloned into pSK as a SacII/NotI
(partial) fragment creating pND-1.
To facilitate insertion of the upstream transcriptional terminator a marker gene was
used. The plasmid pRU279 was constructed by cloning the kanamycin resistance
(KnR) gene from pRAT1 as a BamHI fragment downstream of the TT in pRU160
(Fig. 4.2). The kanamycin resistance gene could then be used to identify the
transcriptional terminator. The TT-KnR fragment was cloned upstream of phoA in
pND-1 as a PstI ApaI fragment to create pND-2.
81
pRAT1
PhoA PCR fragment from E.coli K12 using primers P12 and P20
pJQ254
SmaI
NotINotI
SacII BamHI SpeI PstINotI
BamHI site removed
PhoA cloned into pRU161 (with infilled BamHI site) as NotI fragment
PhoA
NotI
KpnI
pND-1
SacII/NotI (Partial) Fragment cloned into pSK
BamHI fragment
KnR Cloned upstream of TT in pRU160
KnR
ApaI
pRU160
SacIIBamHI
SpeI PstI
NotI
pRU279
KnR
ApaI PstI
SacII SpeI NotI
PhoA
NotI
SacI BamHI
PstIXbaI
ApaI
ApaI/PstI fragment cloned into pND-1
SacII SpeI NotI
PhoA
NotI
SacI BamHI
PstIXbaIApaI
KpnI
KnR
pND-2
SacII
Fig. 4.2 Schematic of stages in the construction of pPOT and pGOT plasmids. See section 4.2.2.2 for details. (Not to scale)
82
4.2.2.3 Cloning of antibiotic markers.
The chloramphenicol (CmR) resistance of the original pBBR1MCS is not suitable for
use in Rhizobium. This gene was therefore replaced with either spectinomycin (SpR)
resistance or kanamycin resistance genes to enable its use in Rhizobium under
various conditions. These genes were inserted in a cassette to enable them to be
changed, extending the use of the vector.
The spectinomycin cartridge from pHP45 Omega was cloned as an infilled HindIII
cartridge into the DraI sites in the CmR gene of pBBR1MCS (Fig. 4.3), deleting the
CmR gene. The SpR cassette included transcriptional terminators thus preventing it
effecting the plasmid transcriptionaly. The SacII fragment from pND-2, containing
KnR and phoA between the same two transcriptional terminators was cloned into the
SspI sites in the MCS and lacZ gene of pBBR1MCS by removing the 3' overhanging
ends of the SacII sites using T4 DNA polymerase. This deleted most of the MCS
and lacZ gene. Finally the KnR marker, used as a cloning marker, was removed as a
complete BamHI deletion to give plasmid pOTS.
A kanamycin resistant version, pOTK, was simultaneously constructed by cloning
The KnR gene from pHP45 Ωkan as an infilled HindIII fragment into the DraI sites
in CmR gene of pBBR1MCS and proceeding as for the spectinomycin resistant
version above. The upstream transcriptional terminator was inserted without the KnR
marker and successful insertion identified by restriction mapping.
83
pND-2
Spectinomycin resistance cartridge from pHP45 SpR
HindIII HindIII
1) HindIII sites infilled to produce blunt ends.
pBBR1MCS
CmR
DraI
MCS LacZα
SspI
SspI
SacII SpeI NotI
PhoA
NotI
SacI BamHI
PstXbaI ApaI
KnR
KpnISacII
3) SacII sites digested to give blunt ends
2) Cloned into DraI sites
4) Cartridge cloned into SspI sites removing most of the MCS
BamHI BamHI
5) KnR removed by BamHI digest.
Fig. 4.3. Final stages in the construction of pPOT. See section 4.2.2.3 for details. (Not to scale)
84
4.2.2.4 Introduction of Multiple Cloning Sites
The plasmids constructed had few restriction sites due to the deletion of most of the
multiple cloning site (MCS). BamHI was the only site available for cloning in front
of the reporter gene and this site was to be used to clone genomic fragments. To
make the plasmid adaptable and to allow further cloning a new MCS needed to be
introduced into the BamHI site and result in the recreation of only one BamHI site.
The restriction enzyme BglII has compatible ends with BamHI however the
recognition site is different thus it can be ligated to a BamHI site without recreating
the BamHI site. The MCS of pMP220 has both a BamHI and a BglII site but has a
limited number of useful restriction sites. Cloning the BamHI/KpnI fragment from
pSK MCS into the BamHI/KpnI sites of pMP220 MCS and subsequently cloning the
BamHI/BglII fragment created into the BamHI of the promoter probe vectors gave a
useful MCS (Fig 4.4).
85
4.2.2.5 Insertion of GFP reporter gene.
A new fluorescent reporter, Green fluorescent Protein (GFP) became available on the
market (Clontech) (Chalfie, et al., 1994). The gfp gene codes for a protein that is
fluorescent when excited by UV light (Absorption maximum peak 395nM, minor
peak 470nm. Emissions maximum peak 509nm, shoulder at 540nm (See Fig.4.5).
The protein was originally isolated from the bioluminescent jellyfish Aequorea
victoria, where light is produced by the transfer of energy from Ca2+-activated
XbaI
SpeI NotI
PhoA
NotI BamHI
SpeI
Bgl
II *
Ec
oRI
Cla
I Sa
cI
Kpn
I Ap
aI
XhoI
Sa
lI C
laI
Hin
dIII
Ec
oRV
Ec
oRI
PstI
SmaI
Ba
mH
I
KpnI/BamHI fragment from pSK (62bp) cloned into KpnI/BamHI of pMP220.
BglII/BamHI fragment cloned into BamHI to give final MCS
Fig.4.4. Insertion of the multiple coning site to produce the plasmid pPOT. See section 4.2.2.4. (Not to scale). * This BglII site does not occur in the final MCS as it is ligated into a BamHI site.
86
photoprotein aequorin to GFP. The GFP chromophore consists of a cyclic tripeptide
derived from Ser-Tyr-Gly in the protein sequence (Cody et al., 1993).
This is only fluorescent when located in the complete protein. When cloned into
bacterial cells this fluorescence is visible in colonies on an UV transilluminator and
is visible under the microscope in single cells. No cofactors, substrates or other gene
products are needed for fluorescent production.
GFP has the advantage over phoA that it does not require the addition of a substrate
and an enzymatic reaction to occur before it can be visualised. Using phoA also had
the disadvantage that its action was often obscured by native phosphatases in the
plant roots and Rhizobium making microscopic studies particularly difficult. GFP
fluoresces at a wavelength where there is less autofluorescence of other biological
material.
Plasmid pGOT-S and pGOT-K were created by replacing phoA with wildtype gfp as
a BamHI/SpeI cartridge from pGFP (Clontech). Plasmid pGOT-K was conjugated
into 3841 and designated strain RU1080.
Fig. 4.5. The absorption (Dotted line) and emission (solid line) spectra of wt.GFP. The two high peaks are for EGFP, a red shifted GFP optimised for use in Eukaryotes. From Clontech product protocol Living colours™, GFP application notes (PT2040-1)
87
4.2.3 Cloning of test promoters in pPOT and pGOT vectors
To test the characteristics of the promoter probe vector and the reporter genes, a set
of promoters were cloned into the MCS. The lacZ promoter (placZ) from
pBluescript is constitutivley expressed at high levels in R. leguminosarum. The dctA
promoter (pdctA) and nodC prompter (pnodC) are induced by dicarboxylic acids and
hesperatin respectively, enabling the sensitivity of GFP to be determined under a
range of transcriptional activation.
4.2.3.1 Cloning the Lac Z Promoter
The lacZ promoter from pSK was cloned as a 1Kb Sau3A fragment into the BamHI
site of pGOT-K and pGOT-S. Correct orientation was determined by induction with
IPTG. Fluorescent colonies were identified using an UV transilluminator optimised
for GFP fluorescence. Restriction mapping confirmed the correct orientation of the
lacZ promoter. These constructs were named pGOT-K-lacZ and pGOT-S-lacZ
respectively. The plasmid pGOT-K-lacZ was conjugated into 3841 and designated
RU1081.
4.2.3.2 Cloning of the dctA Promoter
The dctA promoter was cloned from pRU61 as a 1KB BamHI/XhoI fragment into
pGOT-S and pGOT-K. This fragment includes the divergent promoters for both
dctA and dctB. In plasmids pGOT-K-dct and pGOT-S-dct the promoter from dctA
acts towards gfp. This orientation was confirmed by restriction mapping. The dctB
promoter is transcribed at a constitutive low level but is induced up to 20 fold by
88
dicarboxylates (Reid and Poole, 1998). Strain RU1087 was created by conjugation
of pGOT-K-dct into 3841.
4.2.3.3 Cloning of the nodC Promoter
The nodC promoter was cloned from pIJ1814 as a 0.35Kb BamHI fragment and
inserted into the BamHI cloning site. The correct orientation was determined by the
ability to induce fluorescence with hesperitin. The plasmid was conjugated into 3841
and designated strain RU1088.
4.2.4 General fluorescence of pGOT vectors
The fluorescent levels for the three vectors with cloned promoters were compared on
plates and in broth when expressed in Rhizobium. Consistent results for fluorescence
were difficult to achieve and in comparison to fluorescence achieved later with
GFPuv, the fluorescence level was very low. High levels of fluorescence on plates
and under the microscope were only achieved with the placZ. Induction of the
pnodC by growth on 1µM Hesperitin gave very low fluorescence levels and
fluorescence was never achieved during induction of pdctA by growth on succinate
For the fluorescent protein to be produced, GFP requires oxygen. Only after
exposure to sufficient oxygen can fluorescence be seen as molecular oxygen is
necessary for the formation of the mature chromophore (Heim et al., 1994). We
tested whether this was causing the low fluorescent levels by growing cultures of
pGOT-K-LacZ in E. coli and Rhizobium in universal bottles (10ml broth) and in 1l
flasks (50ml broth). E. coli cultures incubated in universal bottles occasionally gave
89
low fluorescence levels and often did not fluoresce. These cultures had to be grown
in large flasks with maximum aeration to give fluorescence. On plates, the colonies
had to be grown for long periods and left for up to several days at 4°C to achieve
visible fluorescence. When the plasmid was in Rhizobium better results were
obtained, probably due to the longer growth time allowing the protein to mature into
the fluorescent form. Colonies on plates were generally fluorescent but still needed
an overnight incubation at 4°C to achieve maximum fluorescence.
4.2.5 Stability of pGOT vector
An important aspect of the vector design is the ability to expose the final library to
complex environmental conditions and still maintain the plasmid with no antibiotic
pressure. The strains RU1080 and RU1081 were therefore compared for
fluorescence expression after inoculation on plants. These strains were compared as
RU1081 contains the pGOT-K plasmid with the LacZ promoter and constitutavely
expresses GFP, whilst RU1080 has plasmid pGOT-K with no promoter.
The stability of the plasmid in Rhizobium, when infecting roots was determined. Pea
plants were grown in flasks and inoculated with RU1080 and RU1081 using our
standard plant growth methods (see Section 2.6). Control plants were either left
uninoculated or inoculated with Rhizobium strain 3841 to act as positive and negative
controls for nodulation. Once grown, the nodules from root systems were collected
and surface sterilised. They were then crushed in 10µl sterile distilled water using a
disposable pipette tip. The resulting solution was frozen (2µl in 98µl of TY and 15%
90
glycerol) and patched onto TY (Streptomycin 500µg ml-1) and TY (kanamycin 40µg
ml-1).
A total of 128 nodules from RU1080 gave growth on TY (Streptomycin) of which
only 1 grew on TY (kanamycin). Of the 122 nodules, from RU1081 that grew on TY
(Streptomycin), only 5 grew on TY (kanamycin). The 5 colonies that grew from
RU1081 nodules were tested for fluorescence. Only 3 of the colonies that grew on
TY (kanamycin) were fluorescent.
From this it was apparent that there were stability problems during nodulation of
plants. It appeared that sections of the plasmid, including parts of the KnR gene and
either placZ or gfp were being deleted. To determine the degree of instability a
further test was carried out in vivo. This involved maintaining growth in liquid
culture for 5 days (approximately 30 generations) with no antibiotics, and monitoring
the maintenance of the plasmid.
Two 1l flasks (50 ml AMS, glucose 10mM, ammonia 10mM) were inoculated with
each culture (RU1080 and RU1081). Kanamycin (40µg.ml-1) was added to one flask
for each strain to maintain the plasmid. The inoculum was a 4-day growth of the
strain on a TY slope (Kn. 40µg.ml-1). The slope was washed twice in 5 ml AMS and
500µl used to inoculate the flask. A sample of the inoculum (1ml) was snap frozen
in glycerol.
The cultures were grown overnight (26°C, 250rpm) and a sample (1ml) taken and
frozen in 15% glycerol. The cultures were then sub-cultured into 50ml of fresh
91
broth, and growth continued. The inoculum was calculated to give an OD600 of 0.2
by 6pm when the sampling and sub-culturing was repeated. This was continued for 5
days, sampling at 10am and 6pm.
Once all the samples had been collected, they were spread on TY plates
(Streptomycin 500µg.ml-1) and once grown, patched onto TY (Streptomycin
500µg.ml-1) and TY (Kanamycin 40µg.ml-1). Initial observations of the colonies as
they grew indicated that there were several time periods that occurred. Large
colonies grew in about 3 days, followed about 1.5 days later by slower growing
colonies. A background of pin colonies was also observed on many plates. The fast
and slow growth occurred in both the RU1080 and RU1081, initially grown with and
without kanamycin, indicating that expression of GFP was not necessary but that at
least part of the plasmid was being maintained. For strain RU1081, fluorescence was
observed in the slow growing colonies but was generally absent in the fast growing
colonies. All the colonies from RU1080 were non-fluorescent as expected. The
patch plates indicated that for both RU1080 and RU1081, kanamycin resistance was
maintained whether or not kanamycin was present in the broth cultures and is not
dependent on the speed of growth of the colonies recovered. The original inoculum
also showed these faster and slower growing colonies with similar fluorescent
pattern. It appeared therefore that the plasmid was being maintained whether or not
kanamycin was present, but at the expense of a deletion of part or of the entire
reporter region. Loss of this region was allowing clones to grow at a faster rate.
When the frequency of the occurrence of the fast growing colonies was plotted a
steady increase occurred throughout the experiment (Fig 4.6). The frequency
92
increased at the same rate in the culture with no kanamycin, however after three days
it appears to drop to zero. This may be due to the deletion of the kanamycin gene but
the sample size was very small so this conclusion can not be confirmed. The
inoculum also had a number of fast growing colonies indicating the deletion was
occurring rapidly and under normal growth conditions.
Clearly these complex results are not easy to account for without detailed molecular
analysis of many plasmids. However, this seemed of little real value to the central
aims of this project. Instead a general conclusion was made that while the basic
replicon is stable in vitro, deletions appear to be occurring in vitro that effect the
expression of gfp. These putative deletions were not found in E. coli DH5α that is
recA-. However, the presence of two colony types, indicative of deletion, did not
require a promoter, indicating that the deletions may be due to recombination events
probably between the four copies of the omega transcriptional terminator.
Fig. 4.6. Comparison of the occurrence of fast growing colonies (Non-fluorescent and postulated to have deleted promoter-reporter region) in RU1081 over 4 days when grown in the presence and absence of kanamycin. All the clones maintained there kanamycin resistance.
02468
101214161820
Inoc 1-am 1-pm 2-am 2-pm 3-am 3-pm 4-am 4-pm
Sample (Day - Time)
perc
enta
ge fa
st g
row
ing
colo
nies NO kn
Plus kn
93
4.2.6 Construction of pOT1 vector
Due to the stability problems and the low fluorescence levels in the pGOT vector, a
new plasmid, pOT1 was developed. The promoter probe pOT1 was based on the
vector pBBR1-MCS-5 (Kovach, et al., 1995), the reporter gene gfpuv and uses two
different transcriptional terminators.
The reporter gene gfpuv was developed using in vitro DNA shuffling to introduce
point mutations (Crameri et al., 1995). Three amino acid substitutions were made
(Phe-99 to Ser, Met-153 to Thr, and Val-163 to Ala. Numbering according to
wtGFP) which resulted in an 18 fold increase in fluorescence while retaining the
excitation and emission maxima of wtGFP (Fig 4.7). Significantly, in E. coil, GFPuv
is expressed as soluble, fluorescent, protein under conditions were the majority of
wtGFP is expressed in non-fluorescent inclusion bodies. GFPuv is also partially
optimised for use in prokaryotes by replacing rarely used codons for those preferred
by E. coli.
The plasmid pBBR1-MCS-5 was newly available. It uses gentamycin resistance as a
marker, which is suitable for use in Rhizobium. This removed the need to clone a
new antibiotic resistance marker, removing the need for additional transcriptional
terminators. The reporter gene and cloning sites were transcriptionaly isolated from
the rest of the vector by unique transcriptional terminators, to reduce the risk of them
interacting. This meant the new vector would have two heterogeneous
transcriptional terminators rather than four homologous ones. A bacterial ribosome-
binding site was also incorporated to optimise fluorescence as it was noted that the
94
existing site in pGFPuv was not suitable (see Fig 4.9). As in the pGOT and pPOT
vectors, the plasmid was constructed in modular form to enable adaptations, as new
or more convenient reporters become available.
The gfpuv gene was amplified by PCR from the vector pGFPuv using the primers
P69 and P70 and cloned into pGEM-T. The reverse primer, P70 included the SpeI
cloning site in gfpuv. P69 extends over the start site for GFPuv and incorporates a
ribosome binding site, GGAGGA, and a SpeI restriction site (see Fig. 4.8). In
pGEM-T the SalI site in gfpuv was removed by site directed mutagenesis (Stratagine
Quick change Kit, as per manufacturers instruction) using primers P79 and P80.
This site had been added during the construction of pGFPuv. We mutated the bases
back to the wildtype sequence to allow a new promoter cloning strategy to be used.
This involves cloning genomic fragments into a partially filled SalI site in the MCS
(see chapter 5). The change was confirmed by sequencing on both strands of DNA
using primers P97 and P100.
Fig. 4.7 Comparison of the excitation (dotted lines) and emission (solid lines) spectra for wtGFP (Black, low peaks) and GFPuv (Grey, high peaks). From Clontech product protocol Living colours™, GFP application notes (PT2040-1)
95
To reduce the possibility of recombination a transcriptional terminator with a
different sequence to the omega transcriptional terminator was selected. The
transcriptional terminator from pKK232-8 (Pharmacia) was inserted upstream of
gfpuv as an EcoRI clone. The orientation of the TT was determined by PCR
screening using primers P69 and P86. The gfpuv gene and TT were cloned into
pOTK as a SpeI cassette, replacing the phoA cassette to create pND-4 (Fig 4.9).
To insert the new reporter gene with the omega and Pharmacia transcriptional
terminators into pBBR-1-MCS-5, a complex double partial digest was necessary. A
partial NcoI digest and isolation of the 5.7Kb fragment of pND-4 results in an NcoI
site at the 5' end of the reporter cassette. A partial StuI digest and isolation of the
1.182Kb fragment results in a StuI site (Blunt) at the 3' end of the reporter fragment
(Fig 4.10). This was cloned into the NcoI and SspI (Blunt) sites of pBBR-MCS-5,
deleting 0.7kb to produce the plasmid pBB-Gm-GFPuv.
met GAGAGAGAACTAGTGGAGGAAGAAAAAATGAGTAAAGGAGAAGAAC Fig.4.8. The sequence of primer P69 showing the SpeI site (Italic underlined), Ribosome binding site (Bold) and ATG start codon (over lined) with translation.
96
P70 P69
PCR product from pGFPuv Using P69 and P70 - Creates RBS and speI site at 3' end
Cloned into pGEM-T
SalI site removed
TT from pKK232-8 inserted as EcoRI fragment
Fig. 4.9. Stages in the construction of pOT plasmid. See section 4.2.7 for details. (Not to scale)
XbaI SpeI
NotI NotI BamHI
SpeI
phoA
SpeI phoA cartridge in pOTK replaced by speI gfpuv cartridge.
pOTK NcoI
gfpuv
SpeI SpeI
RBS
EcoRI
SalI NcoI
gfpuv
SpeI SpeI
RBS EcoRI
Stop CodonSalI
Nco1
SpeI
BamHI
SpeI
NcoI
gfpuv
RBS
EcoRI
SalI NcoI
Omega TT
97
SpeI
BamHI
SpeI
gfpuv
RBS
EcoRI
NcoI
NcoI NcoI
NcoI
gfpuv
SpeI
StuINcoI
Final fragment cloned into pBBR-1-MCS-5
StuI
knR
First partial fragment recovered (NcoI) 5.7Kb
Second partial digest (StuI) and isolation of 1.182Kb fragment. This fragment is cloned into pBBR-1-MCS-5
Fig. 4.10. Schematic showing the two partial digest fragments from pND-4 used to clone the reporter cassette into pBBR-1-MCS-5. (Not to scale)
Enlargement of section of plasmid
98
In the pGOT plasmids an MCS was introduced by cloning an existing MCS from
other plasmids. Although this resulted in a workable MCS, it was not ideal. To
facilitate the removal of any DNA inserted into the new plasmid, a set of rare cutting
restriction sites surrounding the SalI site should be included. This allows genomic
DNA to be inserted into the SalI site using the partial in-fill method (See Chapter 5)
whilst allowing it to be removed using the rare cutters which are unlikely to be found
in the inserted fragment. To allow this ideal MCS to be constructed, two
complimentary linkers, P81 and P82 were produced (Constructed by Genesis) and
annealed by heating (Fig 4.11). The ends of this linker had overhanging ends
complimentary to DNA digested with PstI and ClaI. This allowed the linker to be
cloned into the plasmid pBB-Gm-GFPuv to create the final pOT1 plasmid.
Plasmid pOT1 has a modular construction allowing it to be adapted. Table 4.1
indicates the important restriction sites and their function. The location of the sites
can be seen in the maps of the MCS (Fig 4.12) and the whole plasmid (Fig 4.13).
The cloning of genomic DNA into the SalI site is described in chapter5. Its re-
isolation for subsequent characterisation is facilitated by the inclusion of the rare
PacI SalI XbaI PmeI PacI SmaI ------ -------- ------ -------- ------ -------- P81 CGATTAATTAAGTCGACATCTAGAGTTTAAACTTTAATTAAGCCCGGGCTGCA P82 TAATTAATTCAGCTGTAGATCTCAAATTTGAAATTAATTCGGGCCCG ~~~~ ~~~~~ ClaI complimentary end PstI complimentary end Fig. 4.11. The complimentary linkers P81 and P82 were annealed and cloned to produce the MCS for pOT1, introducing the restriction sites shown.
99
cutter, PacI and PmeI. The two XbaI sites can also be used. Another feature of the
MCS is the inclusion of a unique PstI site with SmaI sites on either side. This allows
the inclusion and removal of a second reporter gene.
Restriction
Enzyme
Number
of sites
Proposed use of sites
EcoRI 2 Pharmacia transcriptional terminator cassette
EcoRV 2 Cassette including gentamycin resistance gene and Omega transcriptional
terminator
BamHI 2 Removes most of gfpuv cassette
SacI 1 3' end of gfpuv cassette
SpeI 1 5' end of gfpuv cassette
PstI 1 Site for cloning of second reporter
SmaI 2 Sites either side of PstI. Allow removal of DNA cloned in PstI
SalI 1 Site for cloning of genomic fragments
PacI 2 Sites for removal of fragments cloned in SalI
XbaI 2 Alternative sites for removal of fragments cloned in SalI
PmeI 1 Unique rare cutter - can be used in conjunction with PacI for fragment
retrieval from SalI clones
ClaI 1 Unique cloning site in MCS
All the parts of pOT1, which were not present in pBBR1-MCS-5, were sequenced.
This allowed the entire sequence of pOT1 to be deduced (Fig. 4.13).
Table 4.1 Summary of the important cloning sites in pOT1 and their function. The location of sites can be seen in figs. 4.12 and 4.13.
100
_SalI__ EcoRV_ __PacI__ PmeI __PacI__ 5'CGGATCTAGATATCGATTAATTAAGTCGACATCTAGAGTTTAAACTTTAATTAAG XbaI ClaI XbaI PstI__ SmaI__ SmaI__ SpeI__ CCCGGGCTGCAGCCCGGGGGATCCACTAGTGGAGGAAGAAAAAATGAGTAAAGGA 3' BamHI Fig.4.12 The multiple cloning site in pOT1. Unique sites are shown in bold.
gfpuv
Ω TT
Cloning site for genomic DNA
Rare cutting sites for extraction of genomic fragment
Sites for extraction of genomic fragment
Sites for insertion and removal of second reporter
101
Fig. 4.13 pOT1 plasmid.
pOT15278 bp
gfpuv
rep
mob
GmR
P102
P101
rbs-gfp
Omega TT
Pharmacia TT
Cla I (4046)
Pst I (3999)
Pme I (4020)
Sac I (3260)
Sal I (4032)
Spe I (3977)
EcoR I (3061)
EcoR I (3240)
Pac I (4012)
Pac I (4042)
BamH I (3439)
BamH I (3983)
Eco RV (4050)
Eco RV (4995)
Sma I (3991)
Sma I (4003)
Xba I (4025)
Xba I (4052)
102
4.3 Discussion
In this chapter the development of a promoter probe vector has been discussed. The
design of the plasmid has been in a modular form to facilitate the adaptation of the
vector as well as the incorporation of new reporters as they become available.
Initially the promoter probe was to be based on an adaptation of the IVET procedure,
in which selection against expression in the host occurs using SacB. However,
concerns about the toxicity of strong promoters in the environment led to the
construction of a fluorescent reporter system. To allow the development of a true
IVET vector, the cloning site PstI has been included in pOT1, along with flanking
SmaI sites. This allows either a negative selection marker, or a gene to complement
auxotrophy to be incorporated. The later would be a true IVET plasmid.
In the initial attempts to develop a promoter probe, the plasmid pPOT-K, pPOT-S,
pGOT-K and pGOT-S were constructed. There were several problems encountered
with these plasmids. The sensitivity of wildtype gfp was low. The pPOT vectors
could have been used to overcome this, as the sensitivity of PhoA is suitable for this
work. The disadvantage of this system however is the occurrence of native
phosphatases obscures results, especially in single cells. This could have been
overcome by using a phosphatase minus mutant but fluorescence of root material
would still have caused problems. However, a new version of GFP became
available, that was much brighter.
The stability of the pGOT vectors was tested in vivo and in vitro. In both cases,
stability problems were encountered. It appeared that deletions may be occurring
103
when the plasmid was in Rhizobium. This was probably due to recombination in the
Rec+ Rhizobium that was not occurring in Rec- E. coli. Due to this, a new promoter
probe vector was designed to overcome the problems.
The promoter probe pOT1 is based on the pBBR-1-MCS-5 plasmid. This is a small
broad host range plasmid with proven stability. It uses the Gentamycin resistance
gene making it suitable for use in Rhizobium. In pOT1 the gentamycin resistance
gene is transcribed in the opposite direction to gfpuv giving another safeguard against
unwanted transcription of gfpuv.
The promoter-less reporter gfpuv, incorporating a bacterial ribosome-binding site, is
utilised in pPOT1. The fluorescent protein allows us to monitor gene expression in
colonies and in single cells and its sensitivity is high. To protect gfpuv from
transcription from plasmid promoters and to prevent it from interfering with the
transcription of plasmid genes, two transcriptional terminators flank gfpuv. These
have different sequences to reduce the risk of deletions that prevented the use of the
pGOT vectors.
The plasmid pOT1 only has two transcriptional terminators, which have different
sequences. One Transcriptional terminator (Omega) prevents read into gfpuv and the
second (Pharmacia) prevents reading beyond gfpuv.
The modular construction of pOT1 allows other reporters to be incorporated (see
Table 4.1). As in our construction these could be cloned by PCR amplification using
a 5' primer with an identical 5' end to P69. This would incorporate a SpeI site and
104
ribosome-binding site. The 3' end of this primer would be complimentary to the new
reporter. The 3' primer should incorporate a SacI site.
Other reporter genes that could be considered for this vector include well studied
reporter systems such as lacZ, luxAB and gus. The bioluminescence of bacterial
luciferase encoded by luxAB (Reviewed by (Hill et al., 1993; Stewart & Williams,
1992)) has been used in a wide range of applications (Summary of papers (Stanley &
Stewart, 1990)). Its use in Rhizobium is also well established (Boivin & Chalifour,
1988; Paton et al., 1997). The gus A gene, encoding β-glucuronidase has also been
used in Rhizobium (Wilson et al., 1995) and is widely used as a reporter.
There is also a wide range of GFP derivatives available as reporters. These include
red shifted derivatives in which the excitation wavelength is increased. GFPmut1
has a 35-fold increase in fluorescence and has an excitation maxima at 488nm
(Cormack et al., 1996). The three derivatives (GFPmut1, mut2 and mut3)
constructed by Cormack et al. were optimised for use with FACS sorters. The
excitation and emission peaks are very close making them unsuitable for visual
analysis without using extensive filters.
Plasmid pPOT1 was subsequently used in the construction of a promoter library.
The characterisation of the plasmid and construction of the library is discussed in
chapter5.
105
Chapter 5
Construction of Promoter Libraries
5.1 Introduction
The previous chapter describes the construction of a plasmid designed to enable the
identification of environmentally induced promoters. Genomic DNA from R.
leguminosarum is cloned into the pOT1 vector to produce a promoter library.
Selection of Sub-libraries is also described, resulting in a non-expression library for
minimal media. During the selection of this library, a number of clones were
identified with differential expression on solid and liquid media. These were isolated
in another sub library. The construction and selection of these libraries is described.
5.2 Construction of library LB-1: Methods and Results
To construct a representative genomic library care must be taken at all stages to
minimise the effect of competition between clones. Several of the stages in
construction, for example the collection of transformants, are time consuming due to
the large numbers involved. These stages need to be split into batches that were
incubated at different times. It was essential to build into the protocol procedures to
compensate for the effect this could have on the overrepresentation of clones due to
different growth rates.
106
5.2.1 Cloning of 3841 genomic DNA into pOT1
In the original design of the pPOT and pGOT vectors a BamHI site was incorporated
into which Sau3A fragments containing promoters could be inserted in front of the
promoterless gfpuv. This procedure has the disadvantage that more than one
fragment can ligate in tandem to produce multiple inserts, adversely effecting the
representation of genomic DNA in the libraries and make mapping very difficult. To
prevent self-ligations the plasmid is de-phosphorylated with phosphatase. Complete
removal of the vector's 5' phosphate after digestion was too harsh resulting in the
plasmid ends being exonucleased and making further cloning impossible. For the
pOT1 vector a protocol was developed whereby multiple inserts were not possible
and the plasmid could not self-ligate. In this procedure genomic DNA was digested
with Sau3A and pOT1 with SalI. Both of these are six cutters, leaving four base
overhangs with the feature that the end two bases in these restriction sites are
complimentary (see Fig. 5.1). Partial polymerisation results in a two-base overhang,
which prevents self-ligation of either Sau3A or SalI termini but allows single
insertion events to occur.
The promoter library LB1 was constructed in E.coli genomic DNA from R.
leguminosarum 3841 was isolated (see methods 2.5.1.2) and partially digested with
Sau3A. Fragments above 2Kb were extracted from a 0.8% agarose gel using
Geneclean (Bio 101). In previous experiments, it had been noted that smaller
fragments were often retarded thereby biasing the pool for ligation. By using
fragments over 2Kb on the gel, it was anticipated that the bias would result in the
majority of inserts being between 1 and 2Kb. We hoped to reduce the number of
very small fragments in the library by extracting the DNA with Geneclean as it is
107
unsuitable for binding fragments below 0.5Kb. The single stranded ends of these
DNA fragments were partially in-filled using only dATP and dGTP leaving a 2 base
pair overhang, AG (Fig 5.1). Plasmid pOT1 was digested to completion with SalI
and its single stranded ends in-filled with dTTP and dCTP to leave an overhang of
CT. The genomic DNA partial fragments were ligated into the in-filled SalI site of
pOT-1
The ligated DNA was transformed into Supercompetent E. coli XL2 blue
(Stratagene) and plated on LA plates containing gentamycin (10 µg.ml-1).
Control ligations of the in-filled vector without insert DNA and transformations of
digested but non-ligated vector indicated that approximately 1% of the vector DNA
was undigested and a further 4.6% of the constructs in LB-1 were self-ligations with
no insert due to no polymerisation during in-filling.
Approximately 72,660 separate colonies were recovered from four ligation reactions
resulting in 22 separate transformation reactions. This was done to establish the
greatest genomic representation. Each transformation was plated and maintained as
a batch to control variation in growth. To maintain the growth of clones that may be
detrimentally effected in confluent growth on the plate, cells were spread on LA
plates at a dilution to obtain single colonies. The colonies from each plate were
washed into 5ml of LB+15% glycerol and the suspensions combined within each
batch.
108
SalI GFPuv
pOT-1 3841 Genomic DNA
Partial Sau3A Digest
SalI digest
nnnG TCGACnnn nnnCAGCT Gnnn
nnn GATCnnn nnnCTAG nnn
Polymerise in the presence of dTTP and dCTP
Polymerise in the presence of dATP and dGTP
nnnGTC TCGACnnn nnnCAGCT CTGnnn
nnnGA GATCnnn nnnCTAG AGnnn
Ligation
Fig 5.1: Construction of promoter library LB-1. See text for details.
Isolation of fragments over 2Kb
109
The batches were pooled together according to the ratio given below. To minimise
the effect of over representation of some clones within the final libraries the density
of bacteria after resuspension (measured as optical density (600nm)) of each batch
had to be taken into account:
V= [N / OD] x ________
[N / OD] min
Where V is the volume of the batch to be combined into the final library, x is the
batch number, N is the number of colonies in a batch, OD is the optical density of the
batch suspension at 600nm and min represents the batch with the minimum value for
N / OD.
This final cell suspension was stocked as LB-1
5.2.2 The distribution of genomic inserts in LB-1
To determine the representation of genomic DNA in the promoter library, LB-1, the
randomness of the insert sizes was investigated. A PCR screening procedure was
devised that would identify the insert sizes, thereby indicating the distribution of
fragment sizes and the number of clones with no insert (false off) in the final library.
A group of fifty-five random colonies from LB-1 were chosen and their DNA
amplified with primers P12 and P80 using the colony PCR method. These primers
amplify across the region containing the insert DNA and give a positive internal
control of vector DNA (0.8Kb) if there is no insert (Fig. 5.2).
110
A set of colonies was also checked before PCR for colony fluorescence and twelve
PCR fragments were obtained from fluorescent colonies and twelve from non-
fluorescent colonies. As expected all the fluorescent colonies gave PCR products
with insert DNA. Of the 12 non-fluorescent colonies, 9 had inserts and 3 had no
inserts. However, from the total PCR data, 7% of constructs did not have an insert.
These must all fall within the non-expression section of the library. Most of the
constructs with no insert are probably due to the incomplete digestion and infilling
encountered during cloning (section 5.2.1).
The distribution of insert sizes over fifty-one PCR reactions with inserts is shown in
Fig. 5.3. The mean insert size from this data set is 1.56Kb. The graph (Fig. 5.3)
indicates several interesting features. There appears to be two curves overlaying one
another, one with a peak between 0.01 and 0.5 and the second with a peak between
2.1 to 2.5. There is a predominance of fragments below 2Kb. Although attempts
were made to minimise very small inserts, there is a predominance of small
fragments. The observation that larger inserts, although present, are not prevalent
GFPuv TTTT
3841 genomic DNA
P12 P80
Fig 5.2: Diagram to show the location of primers P12 and P80, used in the PCR screen of LB-1, in relation to the insert DNA. TT indicates a transcriptional terminator.
0.8Kbp
111
indicates the factor of insert size biasing ligation events. The dramatic drop off of in
sizes over 2.6Kb is probably due to the preference for small fragments during
ligation. This high efficiency of small fragments to ligate also accounts for the peak
of inserts less than 0.5Kb. The mean insert size, 1.56Kb, however is acceptable for
this library. On the assumption that the average gene size is 1Kb, this mean insert
size would indicate that active promoters should be isolated on many fragments. It
should be noted that promoters are often active over whole operons and so it should
not be assumed that every gene has a promoter. The mean insert size also confirms
the assumption that extracting fragments over 2Kb would result in a predominance of
fragments below 2Kb.
02468
101214
Number of inserts in range
< 0.5 0.6 to1.0
1.1 to1.5
1.6 to2.0
2.1 to2.5
2.6 to3.0
3.1 to3.5
Insert size Kb
Fig 5.3 Distribution of Insert Sizes in LB-1 Obtained from PCR Amplification
112
5.3 Construction of the Promoter Library LB-2
The library LB-2 was developed by transferring LB-1 from E. coli into R.
leguminosarum strain 3841. Although consisting of the same clones as LB-1, this
library was given a new designation in Rhizobium. This reflects differences in
representation introduced during conjugation. It also allows this library to be
distinguished from subsequent sub libraries. The library consists of individual
clones, representative of the Rhizobium genome, in a Rhizobium host, stored frozen
in microtitre plates. The construction of LB-2 and the subsequent sub libraries is
summarised in Fig 5.4.
5.3.1 Construction of LB-2
Library LB-1 was conjugated into 3841 using the standard filter mating protocol with
the following modifications. To reduce the possibility of clonal propagation, the
donor, LB-1 was inoculated directly from frozen stock into LB and grown for 4.5 hr.
The conjugation was reduced to 9 hr to limit the number of replication cycles after
mating. These times had been previously determined as the minimum time to give
reasonable mating frequencies whilst minimising the number of siblings in the final
library (data not shown). The conjugation mix was stocked in glycerol (15%) at -
80°C and plated in batches on library selection plates (AMA supplemented with
glucose (10mM) ammonia (10mM) gentamycin (20 µg.ml-1) streptomycin (250
µg.ml-1) and nystatin (50 µg.ml-1) trimethoprim (10 µg.ml-1). This chemically
defined minimal medium was used to prevent induction of putative environmentally
induced promoters in the library. The antibiotics were used to maintain Rhizobium
(streptomycin) and the plasmid (gentamycin) and the nystatin was added to eliminate
113
Conjugation spread on AMA plates
Colonies picked into microtitre plates (AMS)
High fluorescent colonies patched on AMA
Borderline fluorescent colonies patched on AMA
Microtitre plates analysed using plate reader.
Microtitre plates frozen as LB-2
Low fluorescent colonies patched onto AMA
Patch plates screened using UV transilluminator
UV High fluorescent colonies patched in microtitre plates and frozen as LB-6
Borderline fluorescent colonies patched in microtitre plates and frozen as LB-5
After patching in microtitre plates borderline expression colonies washed of plates and bulked together as LB-4
High and borderline florescent colonies cut out of agar and the remaining colonies washed from plate and bulked together as LB-3
Fig 5.4 Construction of libraries LB-2 to LB-6
4 days growth at 27°C plus overnight incubation at 4°C
Primary screen
Secondary screen
114
fungal contamination. The trimethoprim was added to remove a minor contaminant
introduced during the stocking of LB-1. This was important as large numbers of
plates were being manipulated, incubated and stored for relatively long periods of
time and any loss due to contamination would have limited the representation of
clones.
To facilitate the future screening of the library, reference strains were selected from
the conjugation plates as representative of the following fluorescence levels seen on
minimal plates. RU1158 was selected as expressing high fluorescence levels on
agar, RU1160 gave no visible fluorescence and RU1159 gave a level of expression
that was just visible. As future analysis would involve identification of fluorescence
in single cells these were also tested under the microscope. The results confirmed
RU1158 and RU1160 as having high and no fluorescence respectively. RU1159 was
visibly fluorescent under the microscope however the excitation could be attenuated
to give a level that was just visible but which still allowed RU1158 to be highly
fluorescent.
Colonies (15,075) were individually picked from the conjugation plates (above) into
96 well microtitre plates containing 200 µl of AMS (supplemented with glucose
(10mM) ammonia (10mM) gentamycin (20 µg ml-1) streptomycin (250 µg ml-1)).
For a comprehensive library it is necessary to have complete representation of the
genomic DNA. For this an estimation of the number of colonies needed was made
using the following equation (Kaiser & Murray, 1985):
115
N= ln(1-p)/ln(1-x/y)
Where N is the number of constructs needed, p is the percentage chance of covering
all the genome, x is the average insert size in Kb and y is the genome size in Mb.
We calculated N using 99% for p and 1.56Kb for x (see section 6.2.2). As there was
no published size for 3841 genome, we estimated y using a value of 6.5Mb . This
was estimated from the genome size of Rhizobium meliloti 1021 (This consisted of
3450kb for the chromosome, 1340kb for pRme1021a and 1700kb pRme1021b
(Honeycutt et al., 1993)) and of R. leguminosarum bv. phaseoli (6435Kb) (Jumas-
Bilak et al., ). This indicated that 18943 inserts (1.6Kb) are needed to cover the
complete genome. However, as promoters operate unidirectionaly, this needs to be
doubled to approximately 38,000 inserts to ensure all promoters are included.
LB-2 contains a total of 15,075 individual colonies at mid log (OD630 over 0.15 (see
section 5.4.1)). This represents about 40% of the colonies needed to cover the
complete genome (see section 5.2.3). Time constraints within the project prevented
the isolation and screening of another 23,000 colonies necessary to give full genomic
representation.
The microtitre plates were incubated in a New Brunswick gyratory shaker in a
custom built holder at 125 rpm and 27°C. The holder consisted of an open topped
box, built of aluminium sheets, with two walls that could be adjusted and fixed to
hold the plates in place. After 3 days incubation the plates were screened in
preparation for the construction of sub-libraries (see section 5.4.1), and frozen in
116
15% glycerol. The screening consisted of measuring the OD630 and fluorescence of
the culture in the each well to obtain a relative fluorescence value, using a
Biolumin960 plate reader (Molecular Dynamics). This library, of individually
stocked Rhizobium clones was designated LB-2.
5.4 Construction of Sub-libraries
LB-2 is representative of both constitutive and inducible promoters. To produce a
promoter library that can be used to investigate environmentally regulated promoter
activity, a sub-library with strictly no constitutive promoters must be made. To do
this a screening protocol using a plate reader to accommodate the large numbers of
clones involved was developed. The range of promoter activities, and therefore
fluorescence meant that a simple on/off criterion for defining sub-libraries was not
possible. A threshold value for fluorescence needed to be determined below which
the promoter was deemed to be off. To quantify fluorescence, the number of cells
present within a well must be taken into consideration. A correction based upon
optical density was developed. As the microtitre plates were grown in batches, a
second correction was needed to account for growth differences. This was based on
an uninoculated well and the control strains RU1158, RU1159, RU1160 (see section
5.3.1) being inoculated on each plate. In this section these protocols and the
construction of the sub-libraries will be discussed
5.4.1 Calibration of plate reader
A Biolumin960 plate reader (Molecular Dynamics) was used to measure the large
number of fluorescence and optical density readings needed. To determine whether
117
it was appropriate to use this, several calibration experiments were necessary.
Within our laboratory, optical density readings to determine the cell density of
Rhizobium are carried out using a spectrophotometer at 600nm. The most suitable
filter set on the plate reader was at 630nm. The relationship between cell density and
optical density at 600nm and 630nm needed to be established.
It was also essential to determine if there was a linear relationship between optical
density and fluorescence, thus allowing us to determine the relative fluorescence
irrespective of the OD630. To allow maturation of GFP, only fluorescent values from
cultures grown to mid logarithmic phase of growth were analysed.
A suspension of LB-2 colonies was made in AMS and a two-fold dilution series
produced from the cell suspension. The OD600 of each dilution was measured using a
spectrophotometer. Aliquots of each dilution (200µl) were placed in a microtitre
plate. Each dilution was measured in triplicate and the results averaged. The OD630
and fluorescence values were measured using the plate reader.
5.4.1.1 The OD630 and OD600 correlate linearly to late logarithmic growth.
The OD600 and OD630 values show a good linear relationship, below OD600 0.7,
between the optical densities measured using these two methods (fig 5.5). The
optical density value for calculating the fluorescence of GFP was defined as an
OD630 of at least 0.15 as this represented a late log culture (approximately OD600
0.4), giving GFP time to mature.
118
5.4.1.2 Fluorescence is directly correlated to OD630
The fluorescence and OD630 values were plotted against the dilution of the culture
(fig 5.6). Fluorescence and OD630 have the same decay curve and are directly
proportional to the dilution. This confirmed that the fluorescence could be measured
over a wide range of OD630 and a correction made for optical density would give
directly comparable values for relative fluorescence.
Fig. 5.5 Relationship between optical densities measured using the spectophotometer and microtitre plate reader
0.000
0.050
0.100
0.150
0.200
0.250
0.300
0.350
0.000 0.200 0.400 0.600 0.800 1.000 1.200 1.400 1.600
OD Spectophotometer (600nm)
OD
Pla
te re
ader
(630
nm)
Dotted line represents the defined threshold value for plate measurements. OD600 path length 1cm. Plate reader 200µl in flat bottom 96 well microtitre plate.
119
5.4.1.3 The threshold value for relative fluorescence.
To determine the threshold for relative fluorescence to be used as a definition of
clones that had promoter activity, a number of colonies isolated from the library LB-
2 were compared. The colonies displayed a range of relative fluorescence, V,
measured on the plate reader (V see section 5.4.2). These were also observed
microscopically for fluorescence and the threshold value for observable fluorescence
established. To aid the study of fluorescence levels, a series of isolates from LB-2
were identified with a range of fluorescence (Table 5.1). These were identified as
having GFPuv expression when grown in minimal broth, measured using the plate
reader. The fluorescence was then checked in colonies on the UV transilluminator
Fig. 5.6 Fluorescence is directly correlated with OD630 when measured using the plate reader
0
0.05
0.1
0.15
0.2
0.25
0.3
0.35
0 5 10 15 20 25 30 35Dilution factor
OD
630
0
5000
10000
15000
20000
25000
30000
35000
40000
45000
50000
OD630 Fluorescence
Fluo
resc
ence
120
and under the microscope and a threshold value determined. This value was slightly
higher than the fluorescence for RU1159 as RU1159 was not always visibly
fluorescent. The value used in comparing relative fluorescence was defined as 1.25
fold the average value for RU1159 within a batch.
Strain Relative fluorescence (V)
RU1160 6,000 units
RU1159 17,000 units
RU1158 200,000 units
RU1311 2000 units
RU1312 10,000 units
RU1313 20,000 units
RU1314 30,000 units
RU1315 40,000 units
RU1316 62,000 units
RU1317 91,000 units
RU1318 199,000 units
RU1319 369,000 units
Table 5.1 The relative fluorescence (V) of the fluorescence standards isolated from LB-2. The first three strains are the original standards and are inoculated on all microtitre plates.
121
5.4.2 Screening of LB-2 using microtitre plate reader
The library, LB-2, was screened in microtitre plates for constitutive fluorescence
after growth in minimal broth, using a Biolumin960 plate reader. From the results of
this screening, sub-libraries were defined and constructed. Measurements of
fluorescence were made with a 405/10nm excitation filter and 505/10nm emission
filter. Optical density was measured at 630nm. Plates were analysed in batches of
28. This was a convenient number to incubate as it filled one layer in the incubator,
and a practical number to manipulate in one day, for example when hand picking
colonies into sub-libraries. The results for each well were analysed using an Excel
spreadsheet based on the following equation:
V=F-X / OD630-Y
Where V, the specific fluorescence is calculated from F the measured fluorescence
and OD630 the optical density for a particular well. The average fluorescence for the
blank uninoculated wells in the batch is given by x and the average OD630 for the
blank wells in the batch by Y. Wells with an OD below 0.15 were excluded from the
calculation.
The average value for strain RU1159 (Low fluorescent control) within a batch was
calculated and the threshold for fluorescence defined as 1.25 times this value (see
section 5.4.1). Schematic diagrams were produced from the spreadsheet indicating
wells with values below this threshold. The diagrams were actual size and could be
placed beneath the microtitre plate, indicating which colonies were to be patched
onto AMA plates.
122
5.4.3 Selection of libraries LB-3, LB-4, LB-5 and LB-6
After screening using the plate reader, it was anticipated that a single sub-library
consisting of promoters deemed off in minimal broth would be constructed. A
second screening for fluorescence was carried out on minimal agar plates to ensure
the clones had not been mis-assigned. During this, it became apparent that a set of
clones had high fluorescence on the minimal agar plates. These were therefore
isolated, as were a set which were marginally fluorescent. In this way the off library
was completely silent in both broth and on plates. For this study, it was important to
produce a strictly silent sub-library however other sub-libraries were also stocked for
future studies.
To construct the sub-libraries, colonies below the fluorescence threshold were
patched from the microtitre plates (section 5.4.2) onto AMA plates (10mM glucose,
10mM ammonia, gentamycin (20 µg.ml-1) and streptomycin (250 µg.ml-1)). These
were incubated for 4 days and then at 4°C overnight to allow fluorescence to reach
its maximum level. The plates were re-screened using the UV transilluminater for
fluorescence. Colonies showing high levels of fluorescence were patched to fresh
plates and colonies with a borderline fluorescence level were patched onto separate
plates. The colonies that had been selected in this way were cut from the original
plates and discarded. Those colonies left (OFF colonies) were washed in to 5 ml
AMS+15% glycerol. This cell suspension (1ml)was stored at -80°C in 15% glycerol.
The cell suspension from each plate was checked for fluorescence using the
microscope and those with fluorescent colonies visible with attenuated excitation
were discarded. 100µl of the cell suspension from each plate was combined to
produce LB-3.
123
The plates containing high fluorescent and borderline fluorescent colonies were
incubated and patched into microtitre plates. The microtitre plates were incubated
and glycerol (to 15%) added to the wells before storing the clones at -20°C as LB-5
(Borderline fluorescence) and LB-6 (High fluorescence on plates). The borderline
and high fluorescent colonies were pooled from the plates in 15% glycerol and stored
in individual tubes at -80°C. The cell suspension for the borderline colonies was
combined as above and designated LB-4 (Fig 5.4). The final composition of the
libraries is given in Fig 5.7.
5.5 Testing of the library LB-3
To establish if constructs in the library LB-3 were inducible under variable
conditions, 20,000 colony-forming units were plated on 200 AMA plates. These
plates were phosphate limited (20µM) and had hesperitin (1µM) added. The carbon
source was succinate (10mM) rather than glucose. Colonies that were fluorescent
Fig 5.7 Composition of Promoter library LB-2(Number is total colonies).
7%
71%
1% (128)4% (558)
17% (2549)
78%(11841)
constitutive expression in AMSExpression below threshold in AMS But high expression on AMA plates (LB-6)Expression below threshold in AMS with borderline expression on AMA plates (LB-5)Constructs estimated not to contain an insert (see section 6.2.2) (LB-3)Expression below threshold in AMS and on AMA plates containing inserts (LB-3)
Note: LB-3 contains a subset of constructs with no inserts. This was estimated as 7% of the total colonies (see section 6.2.2)
124
under these conditions were screened on the three inducing conditions (Phosphate
limitation, hesperitin induction and succinate) individually. Nine phosphate
limitation induced colonies, one succinate induced, two hesperitin induced and one
hesperitin and succinate induced colonies were identified (Table 5.2), indicating that
library clones could be induced by altered growth conditions.
Isolate Details
RU1234 Induced by phosphate limitation
RU1235 Induced by phosphate limitation
RU1236 Induced by succinate and hesperitin
RU1242 Induced by phosphate limitation
RU1243 Induced by phosphate limitation
RU1344 Induced by phosphate limitation
RU1245 Induced by hesperitin
RU1246 Induced by phosphate limitation
RU1247 Induced by phosphate limitation
RU1248 Induced by phosphate limitation
RU1249 Induced by hesperitin
RU1250 Induced by phosphate limitation
RU1251 Induced by succinate
Table 5.2 Summary of the LB-3 library isolates (pOT1) induced by growth in limited phosphate, succinate and hesperitin.
125
5.6 Discussion
In this chapter the construction of a series of promoter libraries was described. The
calibration of the plate reader supports the basis of the protocol as satisfactory for the
selection of a promoter sub-library in which the clones are non-fluorescent when
grown under minimal defined conditions. Within this library (LB-3) there are a
proportion of clones with no inserts. PCR data indicated two values for this. When
the library LB-2, containing all promoter clones, was tested 7 % of the constructs
contained no insert DNA. However, when twelve non-fluorescent clones were
tested, 25% of then contained no insert. This discrepancy is in part accounted for by
the selection of clones. If no selection for fluorescence is made, the number lacking
inserts is lower as the population being tested contains clones that are fluorescent and
therefore must have an insert. Secondly the sample size when the non-fluorescence
colonies were tested is small allowing for the possibility of further discrepancies.
The implications of these clones containing no insert would be to necessitate the
production of a larger library. However, time constraints prevented a complete
library being constructed.
The PCR results also indicated a bias in the distribution of insert sizes. There were
two peaks, one below 0.5Kb and the second between 2.1 and 2.5Kb. These were due
to the different ligation efficiencies biasing smaller fragments and the method used to
isolate the fragments to reduce the number of small fragments.
The sub library LB-3 was defined as those clones that had fluorescence below a
defined threshold in minimal broth and also no observable fluorescence on minimal
plates. This represented 78% of the complete promoter library, LB-2. It should be
126
noted that approximately 50% of the complete library would be expected to be non-
fluorescent as promoters operate unidirectional and the cloning of insert DNA was
random.
A sub library, consisting of clones that had marginal expression during the second
screening on plates, was constructed. This was in effect a safety buffer to allow the
expression of clones in LB-3 to be strictly off on minimal conditions. It can be
screened for environmentally expressed promoters in the same way as LB-3 however
care needs to be made of attenuation of the excitation light. This library was shown
to be inducible by growth on phosphate limited media and by hesperitin and
succinate.
The sub-library LB-6 consisted of clones that were non-fluorescent in broth but were
significantly fluorescent on plates. It was possible that this group contains promoters
that are regulated by the physical state of the media. This could include cell-cell
communication genes and genes specifically needed to grow on solid medium.
Further characterisation of these clones was carried out and is discussed in chapter 6.
The library LB-3 was used to identify environmentally induced promoters of R.
leguminosarum, during the infection of roots. This is discussed in chapter 7.
127
Chapter 6
Putative Media Regulated Promoters
6.1 Introduction
During the construction of the promoter libraries, the sub library LB6 was created
and stored at -20°c in microtitre plates. This library contains pOT1 plasmids that
have low fluorescence when examined in microtitre plates but had visible
fluorescence when checked on agar plates. In this chapter we discuss the further
screening of these isolates. In particular this gave an indication of whether the
library contains inducible promoters that could be detected under different
conditions. This group of isolates was also interesting in its own right as their
selection indicated that they contain promoters that are regulated by the physical
state of the medium they are grown on.
6.2 Screening of library LB-6: Methods and Results
During the construction of library LB-6, only 92 isolates from about 10,000 colonies
were retained. These were stored at -20°C in a microtitre plate (200µl AMS, 15%
glycerol). To examine expression of GFP in these clones, a fresh microtitre plate
(200µl AMS, 10mM glucose, 10mM Ammonia per well) was inoculated from the
stored plate and grown for 3 days. The isolates were then replica plated into a fresh
microtitre plate and onto AMA plates (10mM glucose, 10mM ammonia) and
incubated for a further 3 days.
128
Fluorescence measurements were taken for both the agar plates and the liquid culture
from the microtitre plate as follows. The samples grown in the microtitre plate were
mixed by pipetting and 50µl transferred into 150 µl of AMS in a fresh microtitre
plate. This was done to ensure all samples were 200ml and therefore had the same
path length for the plate reader. The samples grown on agar plates were prepared by
transferring a piece of the colony to 200 µl of AMS in a microtitre plate. Pipetting
repeatedly through a Gilson tip dispersed the colony. The fluorescence value and
OD630 were measured for the plates and for each sample V was calculated (see
section 5.4.1). Isolates were considered to be significant if the ratio of V from agar
growth to V from broth growth was greater than 3. This is designated experiment 1
(Ex1, Table 6.1).
Of the original 92 isolates 24 fulfilled this criteria (see Table 6.1:Ex1). These
isolates were colony purified and given formal strain designations. They were
gridded in a microtitre plate, grown for three days and then replica plated onto fresh
microtitre plates and onto AMA plates. After 3 days growth in liquid and solid
media the fluorescence was measured as before. The results are designated
experiment 2 (Ex2).
When the purified isolates were plated to single colonies and observed using the UV
transilluminator, fluorescence was not always consistent throughout the colonies
(See section 6.2.1). These distributions need to be considered carefully when
interpreting the numeric data from the plate reader, as it is apparent that a widely
different value for the agar grown colonies could be obtained depending on what part
of the colony was resuspended.
129
As some of the fluorescence on plates occurred only in the original streak line, we
wanted to establish if any promoters were being expressed in late stationary phase.
Rhizobium is fully grown in about 2 days in the microtitre plates, therefore 3 day
cultures should be well into stationary phase. However, it was important to test
whether further incubation might alter gene expression further. We also wanted to
know if the effect of the solid surface was due to the agar or the presence of any solid
surface for growth. To investigate this, the isolates were grown in universals (10ml
AMS, 10mM glucose, 10mM ammonia) and streaked on AMA plates (10mM
glucose, 10mM ammonia) solidified with agar, agarose (2%) or gelatine (20%).
Samples were taken after 4,7 and 10 days growth and V calculated as before. This
has been designated experiment 3 (Ex3, Table 6.1).
The results for the plate readings are summarised in Table 6.1. The ratio of
fluorescence in colonies over fluorescence in liquid was determined three times
independently. In the first experiment the original isolate was used and the growth
time was 3 days. In the second experiment a colony-purified isolate of the original
isolate was grown for three days. In the final experiment, the colony-purified isolate
was used, however, the fluorescence ratio was determined after 10 days of growth
with the fluorescence on plates observed on the transilluminator at 4 and 7 days.
This allowed us to determine if any isolates had altered expression in late stationary
phase. After the three experiments, 24 samples showed higher specific fluorescence
on solid media compared to growth in liquid media. It was beyond the scope of this
project to examine all of these exhaustively, however, a sample was sequenced. All
the samples were grown to late stationary phase and most showed no change in
130
expression after 4 days. However, the expression of strains RU1216 and RU1188
increased significantly during late stationary phase, whereas the other strains were
constant during this period. This indicates that these may contain promoters active
during extreme starvation.
Table 6.1 Genes Expressed at higher levels on plates compared to liquid culture
Strain Plasmid Solid/Liquid Product
(Expression Level and DNA Sequence) Ex1 Ex2 Ex3 RU1197 pRU509 3.4 1.6 1.5 Uniform high RU1198 pRU511 5.3 2.6 5.6 Single colonies bright and streak tips RU1199 pRU512 6 0.8 1.4 Uniform high RU1201 pRU514 3.4 1.3 3.3 Uniform high RU1202 pRU515 3.1 1.5 1.3 Uniform high RU1203 pRU517 4.5 N/d 2.6 Uniform high RU1204 pRU518 3.2 0.5 2 Extreme papilation RU1182 pRU496 36 0.98 1.7 Uniform low. No Database hits RU1207 pRU521 4.2 1.9 1.9 Uniform high. RU1253 pRU523 4.8 2.4 1.9 Inverse fisheye RU1209 pRU524 4.3 0.7 2.5 Inverse fisheye RU1257 pRU525 7.4 4.4 1.6 Uniform low RU1212 pRU526 3.9 1.6 3.5 Not analysed RU1214 pRU527 4.1 0.9 5.1 Low on, mild papilation RU1215 pRU528 3.1 8.8 5.6 uniform low RU1216 pRU529 3.7 2.5 1.9 Uniform medium. Phytochrome 34% over 70
residues, then 34% over 41 slightly further along.
RU1256 pRU530 4.3 3.7 5 Single colonies on and at the tips of streak lines. Absolute expression in liquid 3.8 fold higher on day 10 compared to day 4.
RU1220 pRU531 3.7 2.1 3.3 uniform on RU1183 pRU499 inf 4.3 7.8 fixND ie component of CBB3 cytochrome
oxidase complex, only on in single colonies. RU1256 pRU534 12.5 2.1 1.7 Uniform on. RU1226 pRU536 3.5 2.4 4 Uniform on. RU1188 pRU498 6 5.7 1.4 Very bright but in tight focal points. metX i.e.
homoserine O-acetyltransferase (43% identity over 67 residues), Absolute expression in liquid 5.2 fold higher on day 10 compared to day 4.
RU1184 pRU500 33 3.2 0.8 Mainly on in single colonies and outside streaklines. 16S rRNA dimethyltransferase 40% identity over 49 residues.
RU1230 pRU539 5.4 2.3 2.3 Not analysed. Notes: Plasmids that have been partially sequenced are indicated in bold. N/d ~ not determined Inf ~ Infinity Uniform ~ all colonies on plate have uniform fluorescence.
131
6.2.1 Plate Observations
When observing the isolates grown on plates some interesting distributions of
fluorescence within the colonies were noted. Some of the colonies grew with
fluorescent papilation and others had fish eye distributions where the centre of the
colony was fluorescent. This indicates that some of the promoters are being
triggered by subtle changes within the colony. This observation was also important
in deciding the significance of the results of fluorescence obtained from the plates.
The comparison of expression on plates solidified with agar and agarose showed no
significant difference in expression values. Strains grown on gelatine produced flat,
very small, undefined colonies and were not analysed further.
6.2.2 Sequence data
Strains RU1182, RU1216, RU1183, RU1188 and RU1184 were sequenced from the
pOT reverse primer and the sequence data subjected to a BLAST search. The
computation was performed at the ISREC using the BLAST network service. The
sequence data is shown in Fig. 6.2 along with the BLAST results.
132
RU1182 (pRU496)
1 TTAACTYAMA CGCTTTAACT ATAGMCTGAT ATGAMCCCGA TTYTGAMTGA 51 TGCRGTTGYY MTGATCMCAT GAGATTTGAC ATGAACTAGT GWCATCHCAG 101 TGAMAVTGAA AGTGACACGG AWAGWGWCYC GRCACAAACG AAACTCWTTG 151 WCAGTGAGAa ACTGAGAMAM TAWAAGWGAT CATBTGAATA AHKGRGACCT 201 CTTTGWMAGA TAAATAASTC AGGTCMCaCT ATAAVTVTGA dATCTCkGtG 251 ACCKGYCTCT GAkATRATAT CTCTMTATMT GATAGSTMTC TGATATGTGA 301 TATGCTGATA TGCTGSTCCG GTGRTMMTHK KACCGTTTta cMTRAKGRMM 351 GTTCcYCCTG GTCTCTCTYY GATGATGRTK TTCTCKGAAG AGgTATGYTG 401 wgTTGTCCGG GGAaATTATA T
BLAST search gave no hits for this sequence.
____________________________________________________________________
RU1216 (pRU529)
1 AGGTTTAAAC AGTCGACTCT AGACTTAATT AAAGTTTAAA CTCTAGATGT 51 CGATCAGTGT GACGCGGATG GTTTCGGCGA CACGGTGCTC AGCCTCCGTG 101 AAGGGGAGAG AGCGACCACG CACCAATTCC GACCACGCCT CGAAACTCTT 151 GCGCGGCGTC AGSGGGACCM GTTCGGGCCG TATTCCACCG GCTTGTGCGG
Fig. 6.2 Sequence data and BLAST results for strains RU1182, RU1216, RU1183, RU1188 and RU1184. For the Blast results, the name of the gene and organism from which it was isolated are shown in bold. The database reference number is shown in bold and underlined. Ambiguity codes for DNA sequence: Code Unresolved bases M AC R AG W AT S CG Y CT K GT V ACG H ACT D AGT B CGT N ACGT
133
201 GTCGCCGCCC CAGCGGACGG TGCGCACCAA TTCCTGACGG AAAAGCACGA 251 CATAATCGCG CGGCGAACGT GAGATCGGGA TGGCGAGCAT GCCTGCCACA 301 GCATCGTCGA CCTCAAGATC CGGATAGGCT TCCGCGAGCC TATCCACGGC 351 ATAGATGCGG CCGGCGGCGT TGCGGTTGAG ATGGCGGACG AGAGCTGCGA 401 ACCTCTCTCA TTCGGCCCGA TGCCGGMAAG AGCCAGCCGG CCGTTGATCc 451 AGACGCCGAT CCcSGTGGGA GGAATGGCGT CGGCGAVCGC TTCGATCAGC 501 CAGGCCGGWT CGTCGAGMMG GGTCSMHTTG TCBmAMGGAG GTAAARCSGT 551 CGCGTRCGxG SGYYMAXCCM mAMMAGTGMS GRCRCCSGAC GSCGCGRGGT 601 GTGHTGGGCG CRCVCGMRCG CATYACACGY GCGCGCRTGT GKCVACVTGY 651 GCGACTDYXX RTACASASDV TATCRCGAVR CATACACGMW CGTGCACWSm 701 GHAYACASAC RCAYGTSMTV KATMACAYMc ATCTCDGAVY GCRTMGMGCG 751 CKCTACWGBG SACGCKHHDC ACWTGMHAGT GTGTVTGTBB XGVGCGBGCA 801 GCAKMGMCGC MSCRCATG
sp|Q55168|Y473_SYNY3 HYPOTHETICAL 84.2 KD PROTEIN SLR0473 gi|1001165|gnl|PID|d1010958 (D64001) phytochrome [Synechocystis sp.] Length = 748 Score = 48.8 bits (114), Expect = 1e-09 Identities = 24/70 (34%), Positives = 42/70 (59%), Gaps = 1/70 (1%) Query: 392 LVRHLNRNAAGRIYAVDRLAEAYPD-LEVDDAVAGMLAIPISRSPRDYVVLFRQELVRTV 216 L++ L ++ L++ YPD + +G+LAIPI+R ++++ FR E+++TV Sbjct: 391 LLQWLENREVQDVFFTSSLSQIYPDAVNFKSVASGLLAIPIAR--HNFLLWFRPEVLQTV 448 Query: 215 RWGGDPHKPVE 183 WGGDP+ E Sbjct: 449 NWGGDPNHAYE 459 Score = 35.2 bits (79), Expect = 1e-09 Identities = 14/41 (34%), Positives = 27/41 (65%) Query: 168 VPLTPRKSFEAWSELVRGRSLPFTEAEHRVAETIRVTLIDI 46 + L PR+SF+ W E+VR +SLP+ E + A ++ ++++ Sbjct: 467 IELHPRQSFDLWKEIVRLQSLPWQSVEIQSALALKKAIVNL 507 gi|1800219 (U56731) phytochrome C [Sorghum bicolor] Length = 1135 Score = 40.6 bits (93), Expect = 2e-05 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
134
Query: 350 AVDRLAEA-YPDLE-VDDAVAGMLAIPISRSPRDYVVLFRQELVRTVRWGGDPHKPVEYG 177 + D L EA YP + + V GM AI IS +D++ FR + ++WGG H+PV+ Sbjct: 483 STDSLVEAGYPGAAALREVVCGMAAIKISS--KDFIFWFRSHTTKEIKWGGAKHEPVDAD 540 Query: 176 PN 171 N Sbjct: 541 DN 542 Score = 29.0 bits (63), Expect = 2e-05 Identities = 12/34 (35%), Positives = 23/34 (67%) Query: 156 PRKSFEAWSELVRGRSLPFTEAEHRVAETIRVTL 55 PR SF+A+ E+V+ RS+P+ + E ++++ L Sbjct: 548 PRSSFKAFLEVVKWRSVPWEDVEMDAIHSLQLIL 581 sp|Q39557|PHY2_CERPU PHYTOCHROME 2 gi|1314837 (U56698) phytochrome photoreceptor CERPU;PHY0;2 [Ceratodon purpureus] Length = 1121 Score = 39.5 bits (90), Expect = 2e-05 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Query: 350 AVDRLAEA-YPDLEV-DDAVAGMLAIPISRSPRDYVVLFRQELVRTVRWGGDPHKPVE 183 + D LA+A YP + DAV GM A I+ +D++ FR + V+WGG H P E Sbjct: 477 STDSLADANYPGAHLLGDAVCGMAAAKITA--KDFLFWFRSHTAKEVKWGGAKHDPAE 532 Score = 30.1 bits (66), Expect = 2e-05 Identities = 13/34 (38%), Positives = 23/34 (67%) Query: 156 PRKSFEAWSELVRGRSLPFTEAEHRVAETIRVTL 55 PR SF+A+ E+V+ RSLP+ + E ++++ L Sbjct: 541 PRSSFKAFLEVVKRRSLPWEDVEMDAIHSLQLIL 574 pir||S58130 phytochrome - moss (Ceratodon purpureus) (fragment) Length = 577 Score = 39.5 bits (90), Expect = 2e-05 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Query: 350 AVDRLAEA-YPDLEV-DDAVAGMLAIPISRSPRDYVVLFRQELVRTVRWGGDPHKPVE 183 + D LA+A YP + DAV GM A I+ +D++ FR + V+WGG H P E Sbjct: 477 STDSLADANYPGAHLLGDAVCGMAAAKITA--KDFLFWFRSHTAKEVKWGGAKHDPAE 532 Score = 30.1 bits (66), Expect = 2e-05 Identities = 13/34 (38%), Positives = 23/34 (67%) Query: 156 PRKSFEAWSELVRGRSLPFTEAEHRVAETIRVTL 55 PR SF+A+ E+V+ RSLP+ + E ++++ L
135
Sbjct: 541 PRSSFKAFLEVVKRRSLPWEDVEMDAIHSLQLIL 574
____________________________________________________________________
RU1183 (pRU499)
1 TCGTCGAAAT AGCCTGAHAT ATCGACTTTC CGCCGTTAGC CTGCCGGCGA 51 AAAATCAACG TTCCTGACGA GCAGGGCAGC CCCCACCGCG AGGCAGAAGC 101 AAAGTATTCC CATATGGACC GCAAAGAGAT GATCATGTGC GAATGCVGCT 151 CCTAGCAMCG CTAGAAACGC CGCGACCGCG ATCACCATCG TTTCCGTTGT 201 ATAATTCATG ATGTCGTCCC CAGTGCGCCG ACGACCGCGT CGCGGCCAGC 251 TTTCTCGCCA GGACTGTCAC GAAGCCGCGA ATTGCTCCTT GATCTACATC 301 AACAAGAGGC CAGCAAGACG GGGCGAACCG CCGCGGTTAC AAACTGTTAC 351 AAACTTTCAC CGGTTAGCAC TGTCCGATCA TTCCCGCTGT GACGCAGAGG 401 CGTTCCAATT GTGCCGACCG ACAATGAGGA ACACGACGAT GCTGATGCAG 451 AAMACCcAGG KGTTCRAACA TGCCGAAAAT KRACGACCRg BCRTWYGMAC 501 CGGKYCMAAT CCGKCARAGH TTTCCAMAAH TGGGGGgRGs MWXTTCbCSG 551 SSRAAxCCAA CGGGGGAGGG CMARGG
trembl|P72288 (FIXND) FIXND (EC 1.9.3.1). [RHIZOBIUM LEGUMINOSARUM] Length = 540 Minus Strand HSPs: Score = 310 (109.1 bits), Expect = 1.3e-26, P = 1.3e-26 Identities = 61/69 (88%), Positives = 63/69 (91%), Frame = -2 Query: 209 MNYTTETMVIAVAAFLAXLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSPAG*RR 30 MNYTTETMVIAVAAFLA L AAFAHDHLFAVHMGILCFCLA GAA+L+R VDFSPAG RR Sbjct: 1 MNYTTETMVIAVAAFLALLLAAFAHDHLFAVHMGILCFCLAAGAAVLIRRVDFSPAGQRR 60 Query: 29 KVDXSGYFD 3 KVD SGYFD Sbjct: 61 KVDISGYFD 69 trembl|O06656 CBB3-TYPE CYTOCHROME OXIDASE COMPONENT FIXN (EC 1.9.3.1). [RHIZOBIUM LEGUMINOSARUM] Length = 540 Minus Strand HSPs: Score = 291 (102.4 bits), Expect = 1.7e-24, P = 1.7e-24 Identities = 57/69 (82%), Positives = 60/69 (86%), Frame = -2
136
Query: 209 MNYTTETMVIAVAAFLAXLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSPAG*RR 30 MNYTTETMVIAVAAFLA L AAFAHDHLFAVHMGILC CL +GA L+VR VDFSPAG +R Sbjct: 1 MNYTTETMVIAVAAFLALLVAAFAHDHLFAVHMGILCLCLVMGAVLMVRKVDFSPAGQQR 60 Query: 29 KVDXSGYFD 3 VD SGYFD Sbjct: 61 NVDRSGYFD 69 trembl|Q52826 (FIXN) FIXN (FRAGMENT). [RHIZOBIUM LEGUMINOSARUM] Length = 187 Minus Strand HSPs: Score = 275 (96.8 bits), Expect = 1.9e-23, P = 1.9e-23 Identities = 54/55 (98%), Positives = 54/55 (98%), Frame = -2 Query: 209 MNYTTETMVIAVAAFLAXLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSP 45 MNYTTETMVIAVAAFLA LGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSP Sbjct: 1 MNYTTETMVIAVAAFLALLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSP 55 trembl|P72284 (FIXNC) FIXNC (EC 1.9.3.1). [RHIZOBIUM LEGUMINOSARUM] Length = 539 Minus Strand HSPs: Score = 275 (96.8 bits), Expect = 9.5e-23, P = 9.5e-23 Identities = 54/55 (98%), Positives = 54/55 (98%), Frame = -2 Query: 209 MNYTTETMVIAVAAFLAXLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSP 45 MNYTTETMVIAVAAFLA LGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSP Sbjct: 1 MNYTTETMVIAVAAFLALLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSP 55 trembl|P95600 (FIXN) FIXN (EC 1.9.3.1). [RHIZOBIUM ETLI] Length = 540 Minus Strand HSPs: Score = 270 (95.0 bits), Expect = 3.4e-22, P = 3.4e-22 Identities = 52/69 (75%), Positives = 56/69 (81%), Frame = -2 Query: 209 MNYTTETMVIAVAAFLAXLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSPAG*RR 30 MNYTTETMVIAVAAFLA L AAFAHDHLFAVHMGILC CL G LLVRN +FSP G +R Sbjct: 1 MNYTTETMVIAVAAFLALLAAAFAHDHLFAVHMGILCLCLVAGTLLLVRNAEFSPTGQQR 60 Query: 29 KVDXSGYFD 3 K + +GY D Sbjct: 61 KTELTGYCD 69 sp|P98055|FIXN_AGRTU (FIXN) CYTOCHROME C OXIDASE POLYPEPTIDE I HOMOLOG (EC1.9.3.1). Length = 539 Minus Strand HSPs: Score = 153 (53.9 bits), Expect = 1.6e-09, P = 1.6e-09 Identities = 36/69 (52%), Positives = 40/69 (57%), Frame = -2
137
Query: 209 MNYTTETMVIAVAAFLAXLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSPAG*RR 30 MNYT ET A+ AF A LGAAFAHD LFA HM +L F L V LL+R V F P Sbjct: 1 MNYTLETADRALGAFPALLGAAFAHDSLFAAHMWVLFFTLVVSTLLLLRRVSFLPPVAGP 60 Query: 29 KVDXSGYFD 3 + YFD Sbjct: 61 PCRRTEYFD 69 sp|Q05572|FIXN_RHIME (FIXN) CYTOCHROME C OXIDASE POLYPEPTIDE I HOMOLOG, BACTEROID (EC 1.9.3.1) (CYTOCHROME CBB3 SUBUNIT 1) (HEME B/COPPER CYTOCHROME C OXIDASE SUBUNIT). Length = 539 Minus Strand HSPs: Score = 143 (50.3 bits), Expect = 1.9e-08, P = 1.9e-08 Identities = 28/56 (50%), Positives = 36/56 (64%), Frame = -2 Query: 209 MNYTTETMVIAVAAFLAXLGAAFAHDHLFAVHMGILCFCLAVGAALLVRNVDFSPA 42 M +T E +V++V AFLA +GA A D LF HM +L F L G +L+R VDF PA Sbjct: 1 MKHTVEMVVLSVGAFLALVGAGLAQDRLFGAHMWVLFFALLAGTLVLMRRVDFRPA 56
____________________________________________________________________
RU1188 (pRU498)
1 TCCCAATAGC CAGCRCTTAC ATCCGCCTCC TTATATTTTC CCGCCGCGTG 51 ACTGTWTCCG CTGAAATAAT GCGGAATCAG GATGGCATTA TCCTTGGCGT 101 CGTTCAGCGT GCCATAAGTT TCATACCCCA GCCGCATTTC GGGAACCGTC 151 CTGCCTCCAC GTGTTACGAA GTTTTTCAGG GTAAATTCCC GCTTTTCAAC 201 CAATGGCTCG TACGCCAATG CAGGGCCGGC CATCATGGCA ATAGTGATGA 251 GTATTTTCAG ACGCATTTAC TTCTCCTTGG TCGGATTACC AACGAAACAA 301 AGCGGTGGCC TCAGCCTTCC AAAGCCGTAT CCTAGTCACT GGATTTCACA 351 TTGATCCAGG TCAAAACTTC TCAGCTTCTA AGGGGCTTAT TCGCCCCTGT 401 GGGATCATKT CAGCCGCCAG ACCGCGGCGA CTTCTCAAGA GTAATACTCT 451 GGKGCCTTCT TGRRGGGYGA MCACGSACTG GGTCBGTTAC SGGGTTHCBC 501 GTTTTYCCMC GTCCTTtCCG CGTTTKTTCG CmXCTTYTKT WCAGGCGAaM 551 GTTYMMCvBY GRGVRGRKAA MCVCTCGAA
trembl|P94891 (METX) HOMOSERINE O-ACETYLTRANSFERASE. [LEPTOSPIRA MEYERI]
138
Length = 379 Minus Strand HSPs: Score = 157 (55.3 bits), Expect = 3.1e-10, P = 3.1e-10 Identities = 29/67 (43%), Positives = 41/67 (61%), Frame = -2 Query: 203 LVEKREFTLKNFVTRGGRTVPEMRLGYETYGTLNDAKDNAILIPHYFSGXSHAAGKYKEA 24 +V + ++ GG T+ + + YETYGTLN+ KDNAIL+ H SG +HAAG + E Sbjct: 16 VVYTQSIRFESLTLEGGETITPLEIAYETYGTLNEKKDNAILVCHALSGDAHAAG-FHEG 74 Query: 23 DVSAGYW 3 D G+W Sbjct: 75 DKRPGWW 81 sp|Q10341|YD9D_SCHPO (SPAC19G10.13) HYPOTHETICAL 56.4 KD PROTEIN C19G10.13 IN CHROMOSOME I. Length = 504 Minus Strand HSPs: Score = 107 (37.7 bits), Expect = 0.0029, P = 0.0029 Identities = 27/79 (34%), Positives = 43/79 (54%), Frame = -2 Query: 239 AMMAGPALAYEPLVE--KREFTLKNFVTRGGRTVPEMRLGYETYGTLNDAKDNAILIPHY 66 ++ +GP Y +V K+ + K F+ G +P+ + YET+GTLN NAIL+ Sbjct: 65 SLSSGPEPVYGKIVSGFKKFYHNKPFLCDHGGILPKFEIAYETWGTLNKDHSNAILLHTG 124 Query: 65 FSGXSHAAGKYKEADVSAGYW 3 S SHA + E + + G+W Sbjct: 125 LSASSHAHS-HPE-NTAPGWW 143 trembl|O13389 (CYSC) PUTATIVE HOMOSERINE O-ACETYLTRANSFERASE. [EMERICELLA NIDULANS] Length = 525 Minus Strand HSPs: Score = 107 (37.7 bits), Expect = 0.0031, P = 0.0031 Identities = 27/84 (32%), Positives = 43/84 (51%), Frame = -2 Query: 254 ILITIAMMAGPALAYEPLVEKREFTLKNFVTRGGRTVPEMRLGYETYGTLNDAKDNAILI 75 +L ++ +GP +Y +R + + + G +PE + YET+G LN+ KDN IL+ Sbjct: 79 LLSARSLGSGPEPSYTAGHHERFHSDEPLLLDWGGLLPEFDIAYETWGQLNEKKDNVILL 138 Query: 74 PHYFSGXSHAAGKYKEADVSAGYW 3 S SHA EA+ G+W Sbjct: 139 HTGLSASSHAHST--EANPKPGWW 160 sp|P15223|SCX1_CENNO TOXIN 1 (TOXIN II.14). Length = 65 Plus Strand HSPs: Score = 67 (23.6 bits), Expect = 0.52, P = 0.40 Identities = 18/57 (31%), Positives = 26/57 (45%), Frame = +3 Query: 162 CYEVFQGKFPLFNQWLVRQCRAGHHGNSDEYFQTHLLLLGRITNETKRWPQPSKAVS 332 CY++ GK N + R+CR H G S Y +++ T WP P+K S Sbjct: 15 CYKL--GK----NDYCNRECRMKHRGGSYGYCYGFGCYCEGLSDSTPTWPLPNKTCS 65
139
____________________________________________________________________
RU1184 (pRU500)
1 CTTGCCGCAG GAXAGCTCTT GGACGACCTC GGCAAGTTGC GGGAXACCAT 51 ACCCCGGCTT GAAAAACATG CCTTGATAAA TATCAAAGGA AATAGCTTGC 101 CGAATGAATG GGGAAGGTAC GGHAGGGGAG CTACAAGAGC CGCAGCAGCC 151 TCGGATCAGG GCACGGATTA TCGAACGTGA CGGCCCAGGW ACAGATAGGC 201 GGTGGGATAC AGCGGCATGC AAATCACTTG CTTGGTGAAT AGCGGATCGA 251 CGGTTCGCAT CCGTTCAAGA GCACTAAACG GGCGGGGCCC CGGCTGAKTC 301 GTGCCGATTT GCAACGATTG CTTCGAGTCT TTCTCGCAAC ACCTGAGCGG 351 GAACTGTAAT CTGGGACGGK WTTKGGGCTG GGATTAGAAC GTTTCCATTT 401 ASGKTATCGG GGGGACTGSG XAGGSTTTTG SGCGDGBGGG DCTGTTTGgW 451 GAtGTSYGCK CYVYGTTTTC CWKARGCCGG GTTTWGTTGT CGSGGTTTTG 501 TtSCCGSyYG GGCGKGGRAA AaGGKWCCcA SCGTAGGWCC GGDWWTTGCC 551 GWAGGGTTGG GKKGAGgRCS
trembl|O25972 (HP1431) 16S RRNA (ADENOSINE-N6,N6-)-DIMETHYLTRANSFERASE (KSGA). [HELICOBACTER PYLORI] Length = 271 Minus Strand HSPs: Score = 75 (26.4 bits), Expect = 9.0, P = 1.0 Identities = 20/49 (40%), Positives = 28/49 (57%), Frame = -2 Query: 161 P*SEAAAALVAPLPYLPHSFGKLFPLI--FIKACFSS-RGMVSRNLPRS 24 P E A A +A P+ + K F ++ F+KACFSS R +S NL +S Sbjct: 182 PLKEKALASLAQAPFFEEALQKGFEMLEDFLKACFSSPRKTLSNNLKKS 230
____________________________________________________________________
(End of Fig. 6.2)
140
Of the five plasmids sequenced, four gave significant correlation to sequences on the
database. Plasmid pRU496 gave no correlation however the quality of the sequence
data was low.
Plasmid pRU529 had homology to a phytochrome from Synechocystis sp, having
34% homology over 70 residues followed further along by 34% over 41 residues.
Plasmid pRU499 showed significant homology to fixND from R. leguminosarum,
with 88% identity over 69 residues. Further study of the BLAST results indicated
that the homology is to fixN.
Plasmid pRU498 showed homology to metX (homoserine O-acetyltransferase) with
43% homology over 67 residues. This was one of two isolates that showed
significant increase in expression at day 10 compared with day 4. The other plasmid,
pRU530 was not sequenced. These constructs appear to be important in extreme
starvation.
Plasmid pRU500 has homology to a 16S rRNA dimethyltransferase with 40%
identity over 49 residues from Helicobacter pylori.
6.3 Discussion
Analysis of the library LB-6 was carried out to determine the effectiveness of the
libraries in general as well as the interesting constructs it potentially contains. As
such, the clones have only been partially characterised.
141
The library was initially selected for expression on agar plates with no expression
when grown in broth. In this chapter, further screening was carried out to identify
those strains with significant increase in fluorescence when grown on plates as
opposed to broth. Two constructs, pRU530 and pRU498, were identified with
increased expression late in stationary phase. It is proposed that these are important
to survival during extreme starvation. Plasmid pRU498 was sequenced and showed
homology to homoserine O-acetyltransferase (metX).
Plasmid pRU499 was homologous to fixN from R. Leguminosarum. This is a
component of CBB3 cytochrome oxidase complex and is expressed by bacteroids in
response to low oxygen. FnrN, a redox sensitive transcriptional activator,
homologous to E. coli Fnr, induces expression of fixN (Gutierrez et al., 1997). The
fixN gene is part of the fixNOQP operon found on pSym. Expression of FixN has
been shown to occur both in the symbiotic zone of the root nodule and under free
living microaerobic conditions (Schluter et al., 1997). When strain RU1183
(pRU499) was observed on plates, it was noticeable that expression only occurred in
single colonies and not on the main streak line where the colonies are amalgamated.
It could therefore be postulated that the microaerobic conditions necessary for
induction were not present in the streak line. Such expression is consistent with the
low oxygen tension found in mature single colonies (Lorian, 1989).
The homologies found for pRU529 and pRU498 were a 16SrRNA transferase and a
phytochrome respectively. The expression of these genes during growth on agar
rather than in broth is a mater for speculation. As the main function of screening this
library was to confirm the library construction, further study of these isolates has not
142
been carried out. They do pose some interesting questions and would be worthy of
future investigation.
One of the aims of the analysis of LB-6 was to confirm the successful construction of
the sub-libraries. Although this library has a small number of individual clones,
there is a wide range of expression conditions for the isolates. The sequence data
confirms that the inserts contain different DNA sequences with significant
homologies to known DNA. Some of the sequence homologies are also in keeping
with genes known to be expressed under these conditions. On the basis of this,
experiments were set up to identify environmentally induced promoters using IVET-
OT. This is described in Chapter 7.
143
Chapter 7
Isolation of Environmentally Induced Promoters using IVET-OT
7.1 Introduction
Previously the construction and testing of the optical trap has been described (see
chapter 4). A promoter library based on pOT1 and a sub library LB-3, containing
only the promoters that are below a low threshold on minimal laboratory media, has
been constructed (see chapter 5). In this chapter we carry out IVET-OT on the
library to identify promoters of Rhizobium that are induced by growth in the plant
rhizosphere. The complexity of the rhizosphere has prevented it being reproduced in
laboratory medium. Many factors, both biotic and abiotic, influence organisms in the
rhizosphere. In these trials, the environment has been simplified by growing pea
plants in vermiculite inoculated with a single strain. As the genetics of nodulation
are well characterised and these genes give an internal control in these experiments.
It would be expected that nod gene promoters could be recovered using this
technique. There are aspects of the Rhizobium-legume association that are poorly
understood. After rhizobia enter the root hair they are contained by the plant in an
infection thread, laid down between cortical cells. The genes expressed by rhizobia
during this period of nodule development are very poorly understood. IVET-OT
may enable genes specifically expressed in the infection thread to be examined,
however, the primary aim was to isolate genes expressed during colonisation of the
rhizosphere.
144
7.2 Isolation of LB-3 Clones from the Rhizosphere
Pea seeds, grown in universal bottles in N-free rooting solution (approximately
12ml), were inoculated with library LB-3. The inoculum for each plant was
calculated to theoretically contain 5 copies (approximately 60,000 cells) of the
complete library using the value 1.7x109cfu ml-1 (calculated from a dilution series
plating of LB-3) and was used directly from diluted thawed stock with no prior
growth. The plants were grown for 7 days before harvesting. Individual roots and
vermiculite were ground in N-free rooting solution (20ml) using a sterile pestle and
mortar. The cell suspension was filtered through a Whattman filter paper to remove
large particles, and 8ml centrifuged (8,500rpm, 30 sec). The supernatant was
centrifuged (13,000, 5 min) and resuspended (50µl N-free rooting solution, 7.5%
ficol).
The filtrate from the ground roots and vermiculite was observed under UV excitation
with the optical trapping microscope and 12 fluorescent cells were trapped, from four
separate plants, and isolated. The trapping media used was N-free rooting solution
with 7.5% Ficoll. The isolated cells were grown in TY broth (10ml supplemented
with gentamycin (20µg.ml-1) and streptomycin (500µg.ml-1). The conditions and
notes for the trapped cells are given in Table 7.1.
145
Cel
l re
fere
nce
Plan
t
Lase
r cu
rren
t
Atte
nuat
ion
filte
r
App
rox.
tra
ppin
g po
wer
N
o. C
ells
in
trap
Not
es
RI 1 1 13.5A None 30mW 2 Long time in trap
RI 2 1 13.5A None 30mW 1 High level fluorescence
RI 3 1 13.5A None 30mW 1 High level fluorescence
RI 4 2 13.5A None 30mW 2 Long cell - Dividing?
RI 5 2 13.5A None 30mW 1 High level fluorescence visible after trapping
RI 6 3* 13.5A None 30mW 1 Low level fluorescence
RI 7 3* 13.5A None 30mW 1 Low level fluorescence
RI 8 3* 13.5A None 30mW 1 Low level fluorescence - Only moved 2mm
RI 9 3* 13.5A None 30mW 2 Low level fluorescence
RI 10 4 13.5A None 30mW 1 Still fluorescent after trapping
RI 11 4 13.5A None 30mW 1 High level fluorescence
RI 12 4 13.5A None 30mW 2 Large dividing cell
It was noted that plant 3 had no high level fluorescent cells in its extract. The cells
trapped were fluorescent but the levels were not as high as the cells isolated from the
other plants. This could be due to variation in the plant growth however even simple
contact with the root system would be expected to induce some genetic response.
Table 7.1 Summary of the cells trapped after exposure to plant roots. If more than one cell was trapped this is noted. * The cells within the extract from plant 3 were not highly fluorescent.
146
7.3 Characterisation of the Rhizosphere Isolates.
Twelve cells were trapped, of which four grew in TY broth (Gentamycin 20µg.ml-1,
streptomycin 500µg.ml-1), RI 3, RI 5, RI 8, and RI 10 (Table 7.2). To establish if
these cultures had grown from a single trapped cell or were contaminated with other
cells, a PCR screen was devised. The cultures were plated out and 6 individual
colonies from each were PCR amplified using the colony boiling method with
primers P80 and P12 (See Fig. 5.2). If the cultures grew from several cells, more
than one PCR profile would be expected. A set of 6 identical PCR fragments
indicates that contamination of the culture is less than 1:6 colonies. Due to the
isolation procedure, a culture contaminated by other library constructs would be
expected to contain few cells originating from the isolated cell and the majority of
clones would be from other library constructs. It can therefore be assumed that if all
6 PCR profiles are identical, they probably originate from the trapped and isolated
cell. Of the four cultures that grew, three had 6 identical PCR profiles (Table 7.2).
Isolate RI 5 gave 6 different PCR fragments from 6 colonies. This culture also grew
in less than 3 days, whilst the others took approximately 5 days, which also indicated
that the culture, RI 5, originated from more than one cell.
Construct No. of days for initial growth of culture
Potentially clonal Insert size
RI 3 7 days Yes 3.2 Kb
RI 5 < 3 days No N/A
RI 8 7 days Yes ~0.4 Kb
RI 10 5 days Yes ~0.4 Kb
Table 7.2. Summary of the constructs that grew after trapping. The Culture was considered to have originated from a single isolated cell if all 6 PCR reactions gave identical size bands. RI 5 gave 6 different sized PCR products.
147
The three strains derived from single cells were reinoculated onto pea plants and on
AMA (10mM glucose, 10mM ammonia). After 7 days extracts were made and
observed using fluorescence microscopy. RI 10 gave no fluorescence from either
plates or from the root extract. Almost all the cells from the root extract of RI 8 were
moderately fluorescent, however, when a colony from the plate was observed
microscopically, a similar level of fluorescence was observed. RI 3 gave high level
fluorescence from the root extract with only low level from the plates.
The strain RI-3 was originally isolated as being fluorescent in the presence of plant
roots from a population that was non-florescent on minimal laboratory media. From
this it appears that RI-3 has been successfully isolated with a promoter region that is
induced in the presence of a plant root. Once purified RI-3 was reinoculated onto
plants and became fluorescent at a high level in most of the observed cells when
exposed to plant roots but was non-fluorescent on minimal laboratory media. It thus
fulfils Koch's postulates. This isolate was designated as strain RU1302 and plasmid
pRU504 isolated from it using FlexiPrep kit (Pharmacia).
DNA sequencing was carried out from pRU504 using cy5 labelled pOT-reverse
primer. This primer is designed to sequence from the 5' end of gfpuv into the MCS
of pOT1, thus sequencing the inserted genomic DNA. BLAST searches (performed
at the GSC using the BLAST network service) on the sequence showed homologies
to thiamine phosphate pyrophosphorylate (thiE) from Archaeglobus fulgidus: 39%
identity over 92 residues (Bases 290 to 15) (Fig 7.1). The next sequence homology
148
was to Hydroxyethylthiazole (thiM) from E. coli: 33% homology over 99 residues
(bases 714 to 338). The only homology for this data with a Rhizobium strain was the
27th listed result. This was to R. meliloti (32% homology over 118 residues (Bases
110 to 451) and was not homologous to any known sequences.
To assist with further analysis the PacI fragment (3.2Kb) from pRU504 was cloned
into pNEB193 to give pRU569. DNA sequencing was carried out on this plasmid
and again showed homology to thiE when sequenced from the reverse primer. There
were no significant homologies when sequenced from universal primer indicating
that the 3.2Kb insert in pRU504 (pRU569) extends beyond the thi genes at the end
distal to gfp. From the Reverse primer there was a homology with thiE from R. etli.
However, the homology was low: 42% over only 40 residues. This was the 14th
listed result of 15 results (Fig. 7.1).
The restriction analysis and open reading frames for pRU504 are shown in Fig 7.2.
Open reading frame analysis of the sequence revealed three open reading frames.
One coincides with the thiM sequence however the program did not find an open
reading frame for thiE. The two genes however are not in the same reading frame
and due to the number of ambiguous bases, the program appears to have missed the
true end of thiM. Observing the sequence data an ATG at base pair 305 identified
the open reading frame for thiE in the -3 reading frame.
149
1 GATGTCGHXA TCGCCcGCGC TCTCATCGCA TCCATGTCTT CCTGGCCGAT 51 ATGCAGGCCG TCGACGCCGA TGGCGATTGC CGCCTCGACG TCATCGTTGA 101 CGATGAGCAG GGCGCCGGTC CCATCCAGCG CCTGTTTCAA GGCGCGGCCG 151 GTCTCGATCA TCCTGATGGT GCCGGCATGT TTGTCACGCA ACTGCACCAT 201 GGTCGCGCCG CCGGCAACGG CAAGGCGCGC GGTTTCGACC ATGCCGATCC 251 CGGCGCAGAG ATCGGGGTCG AGGACGAGAT AGAGCGAAAG GTCGAAAGCC 301 TTCATGCAGC TGATATCCTT GCCCTGGCGT CAAGCGTTTC GGCGTCGAGC 351 GCGGCCAGCG CATCGAGAAA ACGCCAGGAG AAGGAGCCGG GCCCGGCCGC 401 CCCAAGGGCT GCCTCCTCGC CGGCGATGGC GAAGGYTGMW MMGTGCAGCG 451 ACCcGTCGCG CCGAMGATAT CCTCTGGCGC CGTCGCGGCA AARGCGCCGA 501 CGAGGCAGGT GAGCGAGCAG CCGAGCGCGG TGACCTGAGG CATCAAGGCC 551 GATCCGCCTT CGATGCGCAC CGCCCGCTCG CCGTCGGTGA CGAAATCCAC 601 GGCACCGGTG ACGGCAACCA CCGCCCGCTG CCGCTTCAGC CAGACCATHG 651 CGCCGvAACC TTCCSCCTST TyCGAACCGG ATCGCSGGCT GTTSGACGCC 701 CTGGCCACGG GbTTTYTCCC SCCGGCAAGC GCGCDcATYT CcSGACGCGY 751 TBCCCXcGCD AWYSYt
Translation of Open reading frame -3 from the start site at base pair 305. This is
homologous to thiE (Bold above):
MLAFDLSLYL VLDPDLCAGI GMVETARLAV AGGATMVQLR DKHAGTIRMI ETGRALKQAL DGTGALLIVN DDVEAAIAIG VDGLHIGQED MDAMRAR
Fig 7.1 The sequence and BLAST results of the cloned promoter fragment in pRU504. The second BLAST results are for the same region cloned into pNEB193 (pRU569). For ambiguity codes see Fig. 6.2
150
BLAST results 1 and 2 for pRU504:
trembl|O28205 (AF2074) THIAMINE PHOSPHATE PYROPHOSPHORYLASE (THIE). [ARCHAEOGLOBUS FULGIDUS] Length = 210 Minus Strand HSPs: Score = 165 (58.1 bits), Expect = 9.4e-12, P = 9.4e-12 Identities = 36/92 (39%), Positives = 51/92 (55%), Frame = -3 Query: 290 LSLYLVLDPDLCAGIGMVETARLAVAGGATMVQLRDKHAGTIRMIETGRALKQALDGTGA 111 LS+Y + D + G E A +A+ G +Q R+K T RM E G+ L+ A Sbjct: 8 LSVYFITDSEF--GRTHEELAEMALRAGVRAIQFREKKLSTKRMYEIGKRLRALTRDYDA 65 Query: 110 LLIVNDDVEAAIAIGVDGLHIGQEDMDAMRAR 15 L VND ++ A+A+ DG+HIGQ+DM A AR Sbjct: 66 LFFVNDRIDVALAVDADGVHIGQDDMPAFAAR 97
sp|P76423|THIM_ECOLI (THIM) HYDROXYETHYLTHIAZOLE KINASE (EC 2.7.1.50) (4-METHYL-5-BETA- HYDROXYETHYLTHIAZOLE KINASE) (THZ KINASE) [ESCHERICHIA COLI] Length = 262 Minus Strand HSPs: Score = 133 (46.8 bits), Expect = 8.5e-10, Sum P(2) = 8.5e-10 Identities = 33/99 (33%), Positives = 47/99 (47%), Frame = -2 Query: 741 EMXALAGGXXPVARASNSXRSGSXXXEGXGAMVWLKRQR-AVVAVTGAVDFVTDGERAVR 565 E+ ALAG +A + A L R+ A+V VTG +D+VTDG R + Sbjct: 130 EIMALAG----IANGGRGVDTTDAAANAIPAAQTLARETGAIVVVTGEMDYVTDGHRIIG 185 Query: 564 IEGGSALMPQVTALGCSLTCLVGAFAATAPEDIXGATGRC 445 I GG LM +V GC+L+ +V A A + + C Sbjct: 186 IHGGDPLMTKVVGTGCALSAVVAACCALPGDTLENVASAC 225 Score = 66 (23.2 bits), Expect = 8.5e-10, Sum P(2) = 8.5e-10 Identities = 16/29 (55%), Positives = 17/29 (58%), Frame = -1 Query: 424 AGEEAALGAAGPGSFSWRFLDALAALDAE 338 AGE A + GPGSF FLDAL L E Sbjct: 231 AGERAVARSEGPGSFVPHFLDALWQLTQE 259
------------------------------------------------------------------------------------------------------ 27th result for pRU504:
trembl|Q52921 NOT HOMOLOGOUS TO KNOWN SEQUENCES AS OF 2/92. [RHIZOBIUM MELILOTI] Length = 208 Plus Strand HSPs: Score = 98 (34.5 bits), Expect = 0.028, P = 0.027 Identities = 38/118 (32%), Positives = 49/118 (41%), Frame = +2
151
Query: 110 GRRSHPAPVSRRGRSRSS*WCRHVCHATAPWSRRRQRQGARFRPCRSRRRDRGRGRDRAK 289 GR + P P+ R RS ++ W SRR +GAR R RRDRGRG + + Sbjct: 23 GRCAAPRPLVRSARSHAAAWRPRDRGDGGRNSRRADAEGARHH--RRLRRDRGRGDPQGR 80 Query: 290 ---GRKPSCS*YPC-PGVKRFGVERGQRIEKTPGEGAGPGRPKGCLLAG---DGEGCXVQ 448 G +P PC + +R R + PG R GC G GC Q Sbjct: 81 QPGGARPLPD-RPCFKRARSHAGDRETRQDTAPGSRHAAWRRHGCGSCSRHRQGGGCLPQ 139 Query: 449 R 451 R Sbjct: 140 R 140
____________________________________________________________________
BLAST result 1 for pRU569:
tr|O28205 (AF2074) THIAMINE PHOSPHATE PYROPHOSPHORYLASE (THIE). [ARCHAEOGLOBUS FULGIDUS] Length = 210 Score = 47.6 bits (111), Expect = 4e-05 Identities = 22/49 (44%), Positives = 30/49 (60%) Query: 202 MIETGRALKQALDGTGALLIVNDDVEAAIAIGVDGLHIGQEDMDAMRAR 56 M E G+ L+ AL VND ++ A+A+ DG+HIGQ+DM A AR Sbjct: 49 MYEIGKRLRALTRDYDALFFVNDRIDVALAVDADGVHIGQDDMPAFAAR 97
------------------------------------------------------------------------------------------------------
14th result for pRU596:
tr|O34294 (THIE) THIAMIN PHOSPHATE PYROPHOSPHORYLASE (EC 2.5.1.3) (THIAMIN-PHOSPHATE PYROPHOSPHORYLASE) (TMP PYROPHOSPHORYLASE). [RHIZOBIUM ETLI] Length = 204 Score = 31.7 bits (70), Expect = 2.7 Identities = 17/40 (42%), Positives = 21/40 (52%) Query: 187 RALKQALDGTGALLIVNDDVEAAIAIGVDGLHIGQEDMDA 68 R K A LI+ND AI G D +H+GQED+ A Sbjct: 44 RRAKAACAAAACQLIINDYWRLAIDEGCDFIHLGQEDLMA 83
____________________________________________________________________
(End of Fig 7.1)
152
A) Computer generated restriction map of pRU504 insert (thiE thiM genes) 766bp
Aat II (92) Acc I (62)
Age I (605)
Alu I (310)
Alw NI (132)
Aos I (567)
Apa I (394)
Asp 700 (299)
Ava II (118) Avi II (567)
Ban II (394)
Bbs I (30)
Bcg I (184)
Bmy I (394)
Bpu AI (30)
Bsa I (157)
Bsm AI (157)
Bsm FI (104)
Bsp 120I (390)
Bsp 1286I (394)
Bsp MI (497)
Bsr BI (577)
Bst EII (530) Bsu 36I (536) Dde I (536)
Eco 57I (620)
Fsp I (567)
Mae II (89)
Mbo II (30) Mlu NI (705)
Msc I (705)
Msl I (164)
Nco I (198)
Nsp I (180)
Pin AI (605)
Pvu II (310)
Sal I (61)
Xmn I (299)
B) Open reading frame analysis of pRU504 insert (thiE thiM genes) 766 bp. Thin lines show computer analysed open reading frames. Bold line shows thiE open reading frame from sequence data analysis.
Nco I (198)
thiM
thiE 305
Fig. 7.2 Restriction map (A) and open reading frames (B) in the insert in pRU504
153
The gene thiE is implicated in the final stages of thiamine biosynthesis (Fig 7.3).
This implies that this gene was switched on due to thiamine deficiency in the media
surrounding the root. To confirm this, RU1302 should be plated on media deficient
in thiamine. This however proved problematic, as Rhizobium grows very poorly
without this vitamin. Due to time constraints this has therefore not yet been
confirmed.
PRPP PRA AIR AICAR
thiO? thiG thiCc
THZ-P thiE HMP-P
IMP
THIAMIN GMP AMP
7.4 Discussion
The library LB-3 was selected to contain pOT1 clones with R. leguminosarum
random genomic DNA fragments whose expression was off during growth in
minimal broth. IVET-OT was carried out on this library by exposing it to the
rhizosphere of pea plants. Twelve cells, expressing GFP, were trapped and four of
these were cultured. One strain, RU1302 (pRU504) was identified as expressing
GFP only when exposed to the rhizosphere. The cloned DNA was sequenced and is
homologous to thiE from a number of bacterial strains with homology to E. coli thiM
further along the sequence.
Fig. 7.3 The purine and thiamine biosynthetic pathways in R. etli [Miranda-Rios, 1997 #122] AICAR: 5-aminoimidazole-4-carboxamide ribonucleotide THZ-P: phosphated thiazole HMP-P: phosphated hydroxymethylpyrimidine AIR: 5-aminoimidazole-ribonucleotide
154
The gene thiE is implicated in thiamine biosynthesis, specifically in the condensation
of phosphated hydroxymethylpyrimidine and thiazole to synthesise thiamine
phosphate (Backstorm et al., 1995). Thiamine is one of three vitamins added to
minimal growth media for Rhizobium (AMS and AMA). Pantothenate can be
removed from the growth media and R. leguminosarum still grows, however, if
biotin or thiamine is removed, R. leguminosarum grows poorly. Four genes, thiC,
thiO, thiG and thiE, have been sequenced and analysed from R. etli (Miranda-Rios et
al., 1997). These are found on the plasmid pb and sequences submitted to GenBank
(accession no. AF00448). It is notable that the sequence from pRU504 shows low
homology to that of thiE from R. etli strain CFN037 (Miranda-Rios, et al., 1997).
This mutant strain has a Tn5mob insertion in the thi box preceding thiCOGE. The
thi box is a 39bp conserved region found upstream of a number of thi genes. It has a
proposed function in regulation of these genes as the mutation in CFN037 has
constitutive expression of at least thiC, whilst the wild type does not. This thiCOGE
gene locus is located on plasmid pb. A strain with the pb plasmid cured, CFNX183,
is unable to grow on minimal media without thiamine, however thiamine
biosynthesis is complemented by the thiCOGE locus. This demonstrates that for R.
etli no other genes necessary for thiamine biosynthesis are found on the pb plasmid.
Strain 3841, from which the insert in pRU504 was derived, is unable to grow on
minimal media without addition of thiamine. It is notable that the sequence from
pRU504 only has a low homology to the CFNX183 thiE. This suggests that the thiE
in our study may be a chromosomal thiE gene. The R. etli strain may grow better on
thiamine deficient media if it has a chromosomal as well as the plasmid copies of the
thiamine biosynthetic genes. Rhizobium 3841 may not contain the plasmid copy,
155
resulting in poor growth. It may be that some rhizobia have two copies of the thiE
gene to increase thiamine biosynthesis, however this is speculative and requires the
identification of two thiE genes from one organism.
Thiamine biosynthesis may have an additional role in the symbiosis of Rhizobium.
From the analysis of R. etli mutations of the purine biosynthetic pathway, it has been
suggested that 5-aminoimidazole-4-carboxamide ribonucleotide (AICAR) is a
negative effector of symbiotic terminal oxidase (Soberon et al., 1997). It has also
been shown that AICAR or a related metabolite promotes the development of the
infection thread (Newman et al., 1995). In turn this pathway is metabolically linked
to thiamine biosynthesis (Fig. 7.2). The mutant CFN037 was originally isolated by
its increased capacity to produce cytochrome c terminal oxidases. The genes
encoding terminal oxidase in several Rhizobium species are fixNOQP, which are
expressed in response to low oxygen. As ThiC is involved in the synthesis of 4-
amino-5-hydroxymethyl-2-methylpyrimidine phosphate (HMP-P) from the purine
intermediate 5-aminoimidazole-ribonucleotide (AIR), and this is also a precursor of
AICAR, increased expression of thiC in turn effects AICAR (Fig. 7.3). In turn,
AICAR or a related metabolite is acting as a negative effector of fixNOQP
expression. Mutant CFN037 is able to fix more nitrogen than the wild type during
symbiosis.
This suggests an important role for vitamins in symbiosis and raises several
questions. Rhizobium leguminosarum normally lives in the soil, a vitamin deficient
environment, however it is unable to grow on laboratory media without additional
thiamine and biotin. It could be postulated that Rhizobium is in some way tied into
156
the rhizosphere by the need for vitamins. The plant could be providing these
vitamins or some other factor that affects their biosynthesis. Biotin uptake and
synthesis has been shown to contribute to successful colonisation of R. meliloti
(Streit, et al., 1996). Plant derived biotin promotes the root colonisation, however
biotin synthesis is the more important source. Biotin supplied by the plant could be
promoting the biosynthesis or uptake of biotin within the cell, transforming
Rhizobium from a slow growing to a fast growing state. A biotin regulated locus,
bioS, has been identified and could be implicated in this system (Streit and Phillips,
1997). Thiamine is also an essential vitamin, limiting Rhizobium growth and
released by plants, and a similar regulatory system could be envisaged.
Further work is needed to establish the relevance of thiE and thiM in pRU504. The
genes need to be mutated in R. leguminosarum 3841 to determine their effect on the
cell. The expression of these genes should be determined in the absence of thiamine.
As this is not possible during growth, RU1302 could be grown on minimal media
containing thiamine and resuspended in thiamine deficient media. The expression of
the gfpuv fusion could then be monitored. It would also be important to establish the
available thiamine in the soil and rhizosphere and the effect this has on expression in
RU1302.
In this chapter we have demonstrated the IVET-OT system and shown that
environmentally induced promoters can be identified. This strategy is powerful in its
ability to identify environmentally induced promoter. However, it shares a limitation
with other IVET protocols, in identifying what promoter level is necessary to get
expression. In the original IVET strategy, a certain level of expression is needed to
157
rescue growth. In IVET-OT, the ability to observe fluorescence is restricted to a
certain expression level. In this case GFPuv is superior to wtGFP as it is 35x more
fluorescent. This could be further studied using the control strains in isolated during
library construction (Chapter 5). Another problem in IVET-OT is identifying
transiently expressed genes. IVET is unable to identify these genes. IVET_OT picks
up these genes as GFPuv is stable, thus once expressed the fluorescent remains even
after the gene promoter activity has ceased. The problem is in rescreening
transiently expressed promoters. By definition the promoter is only on under specific
conditions and so inoculating pea plants with a purified clone will result in only a
few fluorescent cells. This may be the case for isolate RI 10, where bacteria from
root extract inoculated with purified RI 10, were not fluorescent. The ability to
obtain spatial information about expression and to trap bacteria directly from the
environment may be crucial in obtaining transiently expressing isolates. Peas could
be inoculated with purified isolates and the root system observed under the
microscope. If expression is limited to a particular location such as the infection
thread, the cell could be re-trapped, confirming the promoter involved.
158
Chapter8
Discussion
An understanding of the genetic processes is essential in the study of the interaction
between a symbiant and its host. The environmental factors effecting Rhizobium as
it develops from a free-living soil organism, to residing in the rhizosphere and its
eventual nodulation of legume roots is complex. Many of the processes are not well
understood at a genetic level. In an attempt to identify these environmentally
induced genes an adapted IVET strategy was proposed utilising optical trapping
(IVET-OT). An important aspect of this strategy is to be able to identify promoter
activity in the environment and isolate individual cells exhibiting that activity
without the need to grow the cell on laboratory media prior to isolation. In this way
promoters induced by complex environmental stimuli can be isolated. To this end an
optical trap was designed, built and developed along with a plasmid promoter probe
vector in which genomic libraries can be expressed.
The optical trap was based on an Optiphot epifluorescence microscope (Nikon) and a
Nd Yag laser (1064nm). The microscope was modified to incorporate the laser.
This had a detrimental effect on the optics, reducing image quality slightly and
removing the ability to change objective lenses without refocusing. This however
was not a significant problem as the microscope was dedicated to optical trapping.
The laser output power had to be attenuated to power levels survivable by the
bacteria (Approximately 30mW). This was achieved by reflecting the majority of the
laser to a heat-sink using an 85% reflective mirror. Since the construction of this
trap, low power lasers, operating at 1064nm, have become available on the market
159
that could be used for this work. These have the advantage that they are small
making them easier install and work at milliwatt output levels removing the need for
attenuation. They also work from the standard 13Amp power rather than expensive
3 phase power source and use air cooling rather than water-cooling. This makes
them cheaper to run and more portable.
The optical trap is a powerful tool allowing the isolation and study of single cells.
When used in IVET-OT the spatial information given by using the microscope, in
combination with the ability to isolate a specific cell, makes this a unique tool in
identifying gene expression. Once gene libraries are constructed, the simplicity of
using the optical trap makes the identification of large numbers of specific gene
fusions relatively simple. The limiting step in this technique is the characterisation
of the isolates. The power and adaptability of optical trapping as a tool is likely to
make it a common piece of equipment in many laboratories.
Using this trap we demonstrated that about one in three cells trapped could be
cultured. The cells that were not cultured could represent dead cells. Alternatively
they may be damaged during trapping or some other factor or signal may be
preventing growth. Further study is needed on the effects of optical trapping on
individual cells. It is known that trapping effects lipid membrane causing vesicles to
burst (Bar-Ziv, et al., 1995). The trap may also be effecting ion exchange or
transport across the membrane.
A series of promoter probe vectors were designed and constructed culminating in the
construction of pOT1. This has a broad host range replicon (pBBR1-MCS-5
160
(Kovach, et al., 1995)) and a gentamycin resistance marker. The reporter fusion is
transcriptionaly isolated from the replicon by two transcriptional terminators with
different sequences. The reporter, gfpuv, has a bacterial ribosome binding site and a
multiple cloning site (MCS) for the insertion of genomic DNA. The vector has been
designed in a modular fashion making it possible to adapt the plasmid. It would be
possible to use this vector in FACS sorting of genomic libraries using a red shifted
GFP (Cormack, et al., 1996; Crameri, et al., 1995). However the use of the optical
trap allows specific individual cells to be isolated from a complex environment.
A library (LB-2) was constructed by cloning R. leguminosarum genomic DNA into
pOT1. Due to time constraints we achieved approximately 40% coverage of the
genome. It would be valuable to construct a complete genome library in this vector.
Two important sub-libraries were defiled from LB-2. The first, LB-3, consists of
clones that are off when grown in minimal broth and agar. The second, LB-6,
consists of clones that are off in minimal broth but have increased fluorescence on
minimal plates. Further sub-libraries, LB-4 and LB-5, were also isolated. These
consisted of clones on the borderline of being members of LB-2 and were separated
to ensure that all members of LB-2 were off under minimal growth conditions. LB-4
and LB-5 can be used in a similar way to LB-3.
Comparison of the fluorescence of LB-6 constructs on minimal plates and growth
lead to the isolation of 24 clones whose expression was at least three times higher on
plates than in broth. This included two strains, RU1256 and RU1188 whose
expression increased during late stationary phase (10 day old culture). A number of
the isolates were analysed. RU1216 (pRU529) has homology to phytochrome;
161
RU1188 (pRU498) has homology to homoserine O-acetyltransferase (metX);
RU1184 (pRU500) has homology to 16S rRNA dimethyltransferase; RU1183
(pRU499) has homology to a component of a terminal cytochrome oxidase (fixND).
After exposure to pea roots, LB-3 was recovered and fluorescent cells isolated by
optical trapping. In this first demonstration of IVET-OT four cells were successfully
cultured from 12 trapped cells. One of these, RU1302, was induced only in the
presence of roots. When the purified strain was reinoculated onto pea roots, almost
all recovered cells were highly fluorescent. One of the problems associated with
IVET-OT is the characterisation of transiently expressed genes. Unlike the original
IVET system, transiently expressed genes are recovered in the population obtained
from the roots. Once GFPuv matures, fluorescence is stable and maintained for long
periods of time. Transient expression at any time during exposure to the
environment can be identified within the sensitivity of GFPuv. However, once
purified, a transiently expressing strain is harder to characterise. The sensitivity of
GFPuv, although high, still needs to be quantified with respect to promoter activity
for this system. Characterisation of the fluorescent standards identified in chapter 5
(Table5.1) could be used to evaluate this. By definition a transiently expressing gene
may only be expressed at a certain point in the lifecycle and for only a specific time.
Reinoculating a plant with the strain will not result in large numbers of fluorescent
cells. To overcome this it may be necessary to observe the root system over an
extended period of time during growth and development. This could be achieved by
growing roots between microscope slides, allowing periodic observations.
Alternatively roots and nodules could be sectioned to identify bacteria expressing
GFPuv specifically within these tissues. Another method for identifying transiently
162
expressed promoters would be to use FAC scanning. If a purified isolate from IVET-
OT appeared non-fluorescent when reinoculated onto pea roots, the retrieved cells
could be compared to a control using FAC screening of a large number of cells
(10,000 plus) in a very high fluorescence window. An increase of cells falling in that
window from, for example 0.01% to 0.1% would indicate a significant increase in
fluorescent cells. This change would not be observable using a microscope but
would indicate transient expression of the promoter in that isolate. These techniques
warrant further investigation.
The genomic insert in plasmid pRU504 (isolated from RU1302) was homologous to
thiE and thiM. These genes are important in biotin biosynthesis and, by a metabolic
link through AICAR, to symbiosis (Chapter 7). As R. leguminosarum is unable to
grow on minimal media without thiamine, it would appear that sufficient induction of
thiamine biosynthesis is not triggered by the simple lack of thiamine. This implies
that another factor is missing or that this strain is a thiE auxotroph. The induction of
thiE in the rhizosphere may be important in stimulating growth in the rhizosphere
prior to infection of the root. A mechanism could be proposed where Rhizobium is
maintained in the soil with little or no growth by the lack of vitamins. Once in the
rhizosphere a factor, possibly plant derived, induces the thiamine biosynthetic
pathway allowing growth and eventual root infection. Alternatively the plant may
supply thiamine in sufficient quantity for growth. To investigate the function of thiE
in R. leguminosarum, the genomic locus needs to be identified and mutated. The
mutant could be tested for its ability to grow on thiamine deficient media, and its
ability to nodulate and fix nitrogen during symbiosis. Similarly constitutive
expression of the gene could be investigated.
163
In this project, the IVET-OT technique has been developed and environmentally
induced genes have been isolated. The system is powerful in it ability to identify
these genes and it is anticipated that other important genes will be identified using
this method.
164
References
Afzal, R. S. & Treacy, E. B. (1992). Optical tweezers using a diode laser. Rev. Sci.
Instrum. 63, 2157-2163.
Appleby, C. A. (1984). Leghemoglobin and Rhizobium respiration. Annual Review
of Plant Physiology 35, 443-478.
Araujo, R. S., Robleto, E. A. & Handelsman, J. (1994). A hydrophobic mutant of
rhizobium etli altered in nodulation competitiveness and growth in the rhizosphere.
Applied and Environmental Microbiology 60, 1430-1436.
Arnold, W. & Pühler, A. (1988). A family of high-copy-number plasmid vectors
with single end-label sites for rapid nucleotide sequencing. Gene 70, 171-179.
Ashkin, A. (1980). Applications of laser radiation pressure. Science 210, 1081-1088.
Ashkin, A. & Dziedzic, J. M. (1987). Optical trapping and manipulation of viruses
and bacteria. Science 235, 1517-1520.
Ashkin, A. & Dziedzic, J. M. (1989). Internal cell manipulation using infrared laser
traps. Proc. Natl. Acad. Sci. USA 86, 7914-7918.
Ashkin, A., Dziedzic, J. M. & Yamane, T. (1987). Optical trapping and
manipulation of single cells using infrared laser beams. Nature 330, 769-771.
165
Ashkin, A., Schütze, K., Dziedzic, J. M., Eutenueuer, U. & Schliwa, M. (1990).
Force generation of organelle transport measured in vivo by an infra-red laser trap.
Nature 348, 346-348.
Backstorm, A. D., McMordie, R. A. S. & Begley, T. P. (1995). Biosynthesis of
thiamin I: the function of the thiE gene product. J. Am. Chem. Soc. 117, 2351-2352.
Bakker Schut, T. C., Hesselink, G., de Grooth, B. G. & Greve, J. (1991).
Experimental and theoretical investigations on the validity of the geometrical optics
model for calculating the stability of optical traps. Cytometry 12, 479-485.
Bar-Ziv, R., Frisch, T. & Moses, E. (1995). Entropic expulsion in vesicles.
Physical Review Letters 75, 3481-3484.
Bar-Ziv, R., Menes, R., Moses, E. & Safran, S. A. (1995). Local unbinding of
pinched membranes. Physical Review Letters 75, 3356-3359.
Beringer, J. E. (1974). R factor transfer in Rhizobium leguminosarum. Journal of
General Microbiology 84, 188-198.
Berns, M. W., Aist, J. R., Wright, W. H. & Liang, H. (1992). Optical trapping in
animal and fungal cells with a tunable near-infrared titanium-sapphire laser.
Experimental Cell Research 198, 375-378.
166
Bittinger, M. A., Milner, J. L., Saville, B. J. & Handelsman, J. (1997). Rosr, a
determinant of nodulation competitiveness in rhizobium etli. Molecular Plant-
Microbe Interactions 10, 180-186.
Block, S. M. (1992). Making light work with optical tweezers. Nature 360, 493-495.
Block, S. M., Blair, D. F. & Berg, H. C. (1989). Compliance of Bacterial Flagella
Measured with Optical tweezers. Nature 338, 514-517.
Block, S. M., Blair, D. F. & Berg, H. C. (1991). Compliance of bacterial polyhooks
measured with optical tweezers. Cytometry 12, 492-496.
Block, S. M., Goldstein, L. S. B. & Schnapp, B. J. (1990). Bead movement by
single kinesin molecules studied with optical tweezers. Nature 348, 348-352.
Boivin, R. & Chalifour, F.-P. (1988). Construction of a Tn5 derivative encoding
bioluminescence and its introduction in Pseudomonas, Agrobacterium and
Rhizobium. Mol. Gen. Genet. 213, 50-55.
Brown, C. M. & Dilworth, M. J. (1975). Ammonia assimilation by Rhizobium
cultures and bacteroids. Journal of General Microbiology 86, 39-48.
Callaham, D. A. & Torrey, J. G. (1981). The structural basis for infection of root
hairs of Trifolium repens by Rhizobium. Canadian Journal of Botany 59, 1647-1664.
167
Camilli, A. & Mekalanos, J. J. (1995). Use of recombinase gene fusions to identify
vibrio-cholerae genes induced during infection. Molecular Microbiology 18, 671-
683.
Chalfie, M., Tu, Y., Euskirchen, G., Ward, W. W. & Prasher, D. C. (1994).
Green fluorescent protein as a marker for gene expression. Science 263, 802-805.
Chu, S. (1991). Laser manipulation of atoms and particles. Science 253, 861-866.
Chuang, S.-E., Daniels, D. L. & Blattner, F. R. (1993). Global regulation of gene
expression in Escherichia coli. Journal of Bacteriology 175, 2026-2036.
Cody, C. W., Prasher, D. C., Westler, W. M., Prendergast, F. G. & Ward, W.
W. (1993). Chemical Structure of the Hexapeptide Chromophore of Aequorea
Green-Fluorescent Protein. Biochemistry 32, 1212-1218.
Cormack, B. P., Valdivia, R. H. & Falkow, S. (1996). FACS-optimized mutants of
the green fluorescent protein (GFP). Gene 173, 33-38.
Crameri, A., Whitehorn, E. A., Tate, E. & Stemmer, W. P. C. (1995). Improved
green fluorescent protein by molecular evolution using DNA shuffling. Nature
Biotechnology 14, 315-319.
168
Cunningham, S. D. & Munns, D. N. (1984). The correlation between extracellular
polysaccharide production and acid tolerance in rhizobium. Soil Science Society of
America Journal 48, 1273-1276.
Davis, E. O., Evans, I. J. & Johnston, A. W. B. (1988). Identification of nodX, a
gene that allows Rhizobium leguminosarum biovar viciae strain TOM to nodulate
Afghanistan peas. Molecular and General Genetics 212, 531-535.
Dazzo, F. B. & Gardiol, A. (1984). Host specificity in Rhizobium-legume
interactions. In Genes Involved in Microbe-Plant Interactions, pp. 3-31. New York:
Springer Publishers.
Debruijn, F. J. & Downie, J. A. (1991). Biochemical and molecular studies of
symbiotic nitrogen-fixation. Current Opinion In Biotechnology 2, 184-192.
Ditta, G., VIRTS, E., PALOMARES, A. & Kim, C. H. (1987). The nifA gene of
Rhizobium meliloti is oxygen regulated. Journal of Bacteriology 169, 3217-3223.
Djordjevic, M. A., SCHOFIELD, P. R., Ridge, R. W., Morrison, N. A., Bassam,
B. J., Plazinski, J., Watson, J. M. & Rolfe, B. G. (1985). Rhizobium nodulation
genes involved in root hair curling (hac) are functionally conserved. Plant Molecular
Biology 4, 147-160.
Dowling, D. N. & Broughton, W. J. (1986). Competition for nodulation of legumes.
Annual Review of Microbiology 40, 131-157.
169
Driscoll, B. T. & Finan, T. M. (1993). NAD+-dependent malic enzyme of
Rhizobium meliloti is required for symbiotic nitrogen fixation. Molecular
Microbiology 7, 865-873.
Dunn, M. F., Encarnacion, S., Araiza, G., Vargas, M. C., Davalos, A., Peralta,
H., Mora, Y. & Mora, J. (1996). Pyruvate-carboxylase from Rhizobium-etli -
mutant characterization, nucleotide-sequence, and physiological-role. Journal of
Bacteriology 178, 5960-5970.
Felgner, H., Müller, O. & Schliwa, M. (1995). Calibration of light forces in optical
tweezers. Applied Optics 34, 977-982.
Figurski, D. H. & Helinski, D. R. (1979). Replication of an origin-containing
derivative of plasmid RK2 dependent on a plasmid function provided in trans.
Proceedings of the National Academy of Sciences of the United States of America 76,
1648-1652.
Finan, T. M., Wood, J. M. & Jordan, D. C. (1983). Symbiotic properties of C4-
dicarboxylic acid transport mutants of Rhizobium leguminosarum. Journal of
Bacteriology 154, 1403-1413.
Finer, J. T., Simmons, R. M. & Spudich, J. A. (1994). Single myosin molecule
mechanics: piconewton forces and nanometre steps. Nature 368, 113-119.
170
Fischer, H. M. (1994). Genetic regulation of nitrogen fixation in rhizobia.
Microbiological Reviews 58, 352-386.
Fisher, R. F. & Long, S. R. (1992). Rhizobium - plant signal exchange. Nature 357,
655-660.
Fisher, R. F., TU, J. K. & Long, S. R. (1985). Conserved nodulation genes in
Rhizobium-meliloti and Rhizobium- trifolii. Applied and Environmental
Microbiology 49, 1432-1435.
Frey, S. D. & Blum, L. K. (1994). Effect of ph on competition for nodule
occupancy by type-i and type-ii strains of Rhizobium-leguminosarum bv phaseoli.
Plant And Soil 163, 157-164.
Gage, D. J., Bobo, T. & Long, S. R. (1996). Use of green fluorescent protein to
visualize the early events of symbiosis between Rhizobium-meliloti and alfalfa
(medicago- sativa). Journal of Bacteriology 178, 7159-7166.
Gay, P., Le Coq, D., Steinmetz, M., Berkelman, T. & Kado, C. I. (1985). Positive
selection procedure for entrapment of insertion sequence elements in gram-negative
bacteria. Journal of Bacteriology 164, 918-921.
Gay, P., Le Coq, D., Steinmetz, M., Ferrari, E. & Hoch, J. A. (1983). Cloning
structural gene sacB, which codes for exoenzyme levansucrase of Bacillus subtilis:
expression of the gene in Escherichia coli. Journal of Bacteriology 153, 1424-1431.
171
Glenn, A. R. & Dilworth, M. J. (1994). The life of root-nodule bacteria in the
acidic underground. FEMS Microbiology Letters 123, 1-9.
Gordon, D. M., Ryder, M. H., Heinrich, K. & Murphy, P. J. (1996). An
experimental test of the rhizopine concept Rhizobium-meliloti. Applied and
Environmental Microbiology 62, 3991-3996.
Greulich, K. O. & Weber, G. (1992). The light microscope on its way from an
analytical to a preparative tool. Journal of Mircoscopy 167, 127-151.
Grimbergen, J. A., Visscher, K., Gomes De Mesquita, D. S. & Brakenhoff, G. J.
(1993). Isolation of single yeast cells by optical trapping. Yeast 9, 723-732.
Gutierrez, D., Hernando, Y., Palacios, J. M., Imperial, J. & RuizArgueso, T.
(1997). FnrN controls symbiotic nitrogen fixation and hydrogenase activities in
Rhizobium leguminosarum biovar viciae UPM791. Journal of Bacteriology 179,
5264-5270.
Gyorgypal, Z., Kondorosi, E. & Kondorosi, A. (1991). Diverse Signal Sensitivity
of NodD Protein Homologs from Narrow and Broad Host Range Rhizobia.
Molecular Plant-Microbe Interactions 4, 356-364.
Hagen, M., Puhler, A. & Selbitschka, W. (1997). The persistence of
bioluminescent Rhizobium meliloti strains L1 (RecA(-)) and L33 (RecA(+)) in non-
172
sterile microcosms depends on the soil type, on the co-cultivation of the host legume
alfalfa and on the presence of an indigenous R-meliloti population. Plant and Soil
188, 257-266.
Hanahan, D. (1983). Studies on transformation of Escherichia coli with plasmids.
Journal of Molecular Biology 166, 557-580.
Hecht, J. (1992). The Laser Guidebook. , pp. 23-42: McGraw-Hill inc. Publishers.
Heim, R., Prasher, D. C. & Tsien, R. Y. (1994). Wavelength mutations and
posttranslational autoxidation of green fluorescent protein. Proc. Natl. Acad. Sci.
USA 91, 12501-12504.
Hensel, M. & Holden, W. (1996). Molecular genetic approaches for the study of
virulence in both pathogenic bacteria and fungi. Microbiology 142, 1049-1058.
Hensel, M., Shea, J. E., Gleeson, C., Jones, M. D., Dalton, E. & Holden, D. W.
(1995). Simultaneous identification of bacterial virulence genes by negative
selection. Science 269, 400-403.
Higurashi, E., Ohguchi, O. & Ukita, H. (1995). Optical trapping of low-refractive-
index microfabricated objects using radiation pressure exerted on their inner walls.
Optics Letters 20, 1931-1933.
173
Hill, P. J., Rees, C. E. D., Winson, M. K. & Stewart, G. S. A. B. (1993). The
application of lux genes. Biotechnol. Appl. Biochem. 17, 3-14.
Honeycutt, R. J., Mcclelland, M. & Sobral, B. W. S. (1993). Physical map of the
genome of Rhizobium-meliloti 1021. Journal of Bacteriology 175, 6945-6952.
Honma, M. A. & Ausubel, F. M. (1987). Rhizobium meliloti has 3 functional copies
of the nodD symbiotic regulatory gene. Proceedings of the National Academy of
Sciences of the United States of America 84, 8558-8562.
Hossain, A. K. M. & Alexander, M. (1984). Enhancing soybean rhizosphere
colonization by Rhizobium-japonicum. Applied and Environmental Microbiology 48,
468-472.
Huber, R., Burggraf, S., Mayer, T., Barns, S. M., Rossnagel, P. & Stetter, K. O.
(1995). Isolation of hyperthermophilic archaeum predicted by in situ RNA analysis.
Nature 376, 57-58.
Inouye, S. & Tsuji, F. I. (1994). Aequorea green fluorescent protein - expression of
the gene and fluorescence characteristics of the recombinant protein. FEBS Letters
341, 277-280.
Johnston, A. W. B. & Beringer, J. E. (1975). Identification of the Rhizobium
strains in pea root nodules using genetic markers. Journal of General Microbiology
87, 343-350.
174
Jumas-Bilak, E., Michaux-Charachon, S., Bourg, G., Ramuz, M. & Allardet-
Servent, A. (1998). Unconventional Genomic Organization in the Alpha Subgroup
of the Proteobacteria. Journal of Bacteriology 180, 2749-2755.
Kaiser, K. & Murray, N. (1985). Construction of Representative Genomic
Libraries. In DNA Cloning Volume 1: A Practical Approach, pp. 13. Edited by D. M.
Glover: IRL Press limited.
Kondorosi, E., Banfalvi, Z. & Kondorosi, A. (1984). Physical and genetic-analysis
of a symbiotic region of Rhizobium- meliloti - identification of nodulation genes.
Molecular & General Genetics 193, 445-452.
Kovach, M. E., Elzer, P. H., Hill, D. S., Robertson, G. T., Farris, M. A., Roop, J.
M., II & Peterson, K. M. (1995). Four new derivatives of the broad-host-range
cloning vectors pBBR1MCS, carrying different antibiotic-resistance cassettes. Gene
166, 175-176.
Kovach, M. E., Phillips, R. W., Elzer, P. H., Roop II, R. M. & Peterson, K. M.
(1994). pBBR1MCS: A broad-host-range cloning vector. Biotechniques 16, 800-802.
Kuo, S. C. & Sheetz, M. P. (1993). Force of single kinesin molecules measured with
optical tweezers. Science 260, 232-234.
175
Leitz, G., Schnepf, E. & Greulich, K. O. (1995). Micromanipulation of statoliths in
gravity-sensing Chara rhizoids by optical tweezers. Planta 197, 278-288.
Liang, H., Wright, W. H., Cheng, S., He, W. & Berns, M. W. (1993).
Micromanipulation of chromosomes in PTK2 cells using laser microsurgery (optical
scalpel) in combination with laser-induced optical force (optical tweezers).
Experimental Cell Research 204, 110-120.
Long, S. R. (1989). Rhizobium-Legume Nodulation: Life Together in the
Underground. Cell 56, 203-214.
Lorian, V. (1989). In Vitro Simulation of In Vivo Conditions: Physical State of the
Culture Medium. Journal of clinical microbiology 27, 2403-2406.
Lowe, A. M., Beattie, D. T. & Deresiewicz, R. L. (1998). Identification of novel
staphylococcal virulence genes by in vivo expression technology. Molecular
Microbiology 27, 967-976.
Mahan, M. J., Slauch, J. M. & Mekalanos, J. J. (1993). Selection of Bacterial
Virulence Genes That Are Specifically Induced in Host Tissues. Science 259, 686-
688.
Mahan, M. J., Tobias, J. W., Slauch, J. M., Hanna, P. C., Collier, R. J. &
Mekalanos, J. J. (1995). Antibiotic-based selection for bacterial genes theat are
specifically induced during infection of a host. Natl Acad Sci USA 92, 669-673.
176
McClelland, M., Mathieu-Daude, F. & Welsh, J. (1995). RNA Fingerprinting and
Differential Display using arbitrarily primed PCR. TIG 11, 242-246.
Miranda-Rios, J., Morera, C., Taboada, H., Davalos, A., Encarnacion, S., Mora,
J. & Soberon, M. (1997). Expression of Thiamine biosynthetic genes (thiCOGE)
and production of symbiotic terminal oxidase cbb3 in Rhizobium etli. Journal of
bacteriology 179, 6887-6893.
Mitchell, J. G., Weller, R., Beconi, M., Sell, J. & Holland, J. (1993). A practical
optical trap for manipulating and isolating bacteria from complex microbial
communities. Microbial Ecology 25, 113-119.
Murphy, P. J., Heycke, N., Banfalvi, Z., Tate, M. E., Debruijn, F., Kondorosi,
A., TEMPE, J. & Schell, J. (1987). Genes for the catabolism and synthesis of an
opine-like compound in Rhizobium meliloti are closely linked and on the Sym
plasmid. Proceedings of the National Academy of Sciences of the United States of
America 84, 493-497.
Murphy, P. J., Heycke, N., Trenz, S. P., Ratet, P., De-Bruijn, F. & Schell, J.
(1988). Synthesis of an opine-like compound, a rhizopine, in alfalfa nodules is
symbiotically regulated. Proceedings of the National Academy of Sciences of the
United States of America 85, 9133-9137.
177
Newman, J. D., Rosovitz, M. J. & Noel, K. D. (1995). Requirement for rhizobial
production of 5-aminoimidazole-4- carboxamide ribonucleotide (aicar) for infection
of bean. Molecular Plant-Microbe Interactions 8, 407-414.
Nishizaka, T., Miyata, H., Yoshikawa, H., Ishiwata, S. i. & Kinosita, K., Jr
(1995). Unbinding force of a single motor molecule of muscle measured using
optical tweezers. Nature 377, 251-254.
Ohara, G. W. & Glenn, A. R. (1994). The adaptive acid tolerance response in root
nodule bacteria and Escherichia coli. Archives of Microbiology 161, 286-292.
Paton, G. I., Palmer, G., Burton, M., Rattray, E. A. S., McGrath, S. P., Glover,
L. A. & Killham, K. (1997). Development of an acute and chronic ecotoxicity assay
using lux- marked Rhizobium leguminosarum biovar trifolii. Letters in Applied
Microbiology 24, 296-300.
Peters, N. K., Frost, J. W. & Long, S. R. (1986). A plant flavone, luteolin, induces
expression of Rhizobium- meliloti nodulation genes. Science 233, 977-980.
Prentki, P. & Krisch, H. M. (1984). In vitro insertional mutagenesis with a
selectable DNA fragment. Gene 29, 303-313.
Quandt, J. & Hynes, M. F. (1993). Versatile suicide vectors which allow direct
selection for gene replacement in Gram-negative bacteria. Gene 127, 15-21.
178
Redmond, J. W., Batley, M., Djordjevic, M. A., Innes, R. W., Kuempel, P. L. &
Rolfe, B. G. (1986). Flavones induce expression of nodulation genes in Rhizobium.
Nature 323, 632-635.
Reid, C. J. (1995). The regulation of the DCT system in Rhizobium leguminosarum
biovar viciae. : University of Reading.
Reid, C. J. & Poole, P. S. (1998). Roles of DctA and DctB in signal detection by the
dicarboxylic acid transport system of Rhizobium leguminosarum. Journal of
Bacteriology 180, 2660-2669.
Ried, J. L. & Collmer, A. (1987). An nptI-sacB-sac-R cartridge for constructing
directed, unmarked mutations in gram-negative bacteria by marker exchange-
eviction mutagenesis. Gene 57, 239-246.
Roberts, R. C., Burioni, R. & Helinski, D. R. (1990). Genetic characterization of
the stabilizing functions of a region of broad-host-range plasmid RK2. Journal of
Bacteriology 172, 6204-6216.
Robleto, E. A., Scupham, A. J. & Triplett, E. W. (1997). Trifolitoxin production in
Rhizobium etli strain ce3 increases competitiveness for rhizosphere colonization and
root nodulation of phaseolus vulgaris in soil. Molecular Plant-Microbe Interactions
10, 228-233.
179
Ronson, C. W., Astwood, P. M. & Downie, J. A. (1984). Molecular cloning and
genetic organization of C4-dicarboxylate transport genes from Rhizobium
leguminosarum. Journal of Bacteriology 160, 903-909.
Rossen, L., SHEARMAN, C. A., Johnston, A. W. B. & Downie, J. A. (1985). The
nodD gene of Rhizobium leguminosarum is autoregulatory and in the presence of
plant exudate induces the nodA,B,C genes. EMBO Journal 4, 3369-3373.
Rostas, K., Kondorosi, E., Horvath, B., Simoncsits, A. & Kondorosi, A. (1986).
Conservation of extended promoter regions of nodulation genes in rhizobium.
Proceedings of the National Academy of Sciences of the United States of America 83,
1757-1761.
Sambrook, J., Fritsch, E. F. & Maniatis, T. (1989). Molecular Cloning: A
Laboratory Manual, 2 edn. New York: Cold Spring Harbor Laboratory Press.
Sasaki, K., Koshioka, M., Misawa, H., Kitamura, N. & Masuhara, H. (1992).
Optical trapping of a metal particle and a water droplet by a scanning laser beam.
Appl. Phys. Lett. 60, 807-809.
Sato, S., Ishigure, M. & Inaba, H. (1991). Optical trapping and rotational
manipulation of microscopic particles and biological cells using higher order mode
Nd:YAG laser beams. Electronics Letters 27, 1831-1832.
180
Sato, S., Ohyumi, M., Shibata, H. & Inaba, H. (1991). Optical trapping of small
particles using a 1.3-µm compact InGaAsP diode laser. Optics Letters 16, 282-284.
Schluter, A., Patschkowski, T., Quandt, J., Selinger, L. B., Weidner, S., Kramer,
M., Zhou, L. M., Hynes, M. F. & Priefer, U. B. (1997). Functional and regulatory
analysis of the two copies of the fixNOQP operon of Rhizobium leguminosarum
strain VF39. Molecular Plant-Microbe Interactions 10, 605-616.
Schultze, M., Quicletsire, B., Kondorosi, E., Virelizier, H., Glushka, J. N.,
Endre, G., Gero, S. D. & Kondorosi, A. (1992). Rhizobium-Meliloti Produces a
Family of Sulfated Lipooligosaccharides Exhibiting Different Degrees of Plant Host
Specificity. Proceedings of the National Academy of Sciences of the United States of
America 89, 192-196.
Schütze, K. & Clement-Sengewald, A. (1994). Catch and move - cut or fuse.
Nature 368, 667-669.
Seeger, S., Monajembashi, S., Hutter, K.-J., Futterman, G., Wolfrum, J. &
Greulich, K. O. (1991). Application of laser optical tweezers in immunology and
molecular genetics. Cytometry 12, 497-504.
Shea, J. E., Hensel, M., Gleeson, C. & Holden, D. W. (1996). Identification of a
virulence locus encoding a second type III secretion system in Salmonella
typhimurium. Proct Natl Acad Sci USA 93, 2593-2597.
181
Shearman, C. A., Rossen, L., Johnston, A. W. B. & Downie, J. A. (1986). The
Rhizobium-leguminosarum nodulation gene nodf encodes a polypeptide similar to
acyl-carrier protein and is regulated by nodd plus a factor in pea root exudate. EMBO
Journal 5, 647-652.
Soberon, M., Lopez, O., Miranda, J., Tabche, M. L. & Morera, C. (1997).
Genetic evidence for 5-aminoimidazole-4-carboxamide ribonucleotide (AICAR) as a
negative effector of cytochrome terminal oxidase cbb(3) production in Rhizobium
etli. Molecular & General Genetics 254, 665-673.
Spaink, H. P., Okker, R. J. H., Wijffelman, C. A., Pees, E. & Lugtenberg, B. J.
J. (1987). Promoters in the nodulation region of the Rhizobium leguminosarum SYM
plasmid PRL1JI. Plant Molecular Biology 9, 27-39.
Spaink, H. P., Sheeley, D. M., Vanbrussel, A. A. N., Glushka, J., York, W. S.,
Tak, T., Geiger, O., Kennedy, E. P., Reinhold, V. N. & Lugtenberg, B. J. J.
(1991). A novel highly unsaturated fatty acid moiety of lipo-oligosaccharide signals
determines host specificity of Rhizobium. Nature 354, 125-130.
Spudich, J. A. (1994). How molecular motors work. Nature 372, 515-518.
Stanley, P. E. & Stewart, G. S. A. B. (1990). Bioluminescence and
Chemiluminescence Literature-lux,luc and phot genes. Journal of Bioluminescence
and Chemiluminescence 5, 141-152.
182
Steubing, R. W., Cheng, S., Wright, W. H., Numajiri, Y. & Berns, M. W. (1991).
Laser induced cell fusion in combination with optical tweezers: the laser cell fusion
trap. Cytometry 12, 505-510.
Stewart, G. S. A. B. & Williams, P. (1992). Lux genes and the applications of
bacterial bioluminescence. Journal of General Microbiology 138, 1289-1300.
Streit, W. R., Joseph, C. M. & Phillips, D. A. (1996). Biotin and other water-
soluble vitamins are key growth-factors for alfalfa root colonization by Rhizobium-
meliloti-1021. Molecular Plant-Microbe Interactions 9, 330-338.
Streit, W. R. & Phillips, D. A. (1997). A biotin-regulated locus, bioS, in a possible
survival operon of Rhizobium meliloti. Molecular Plant-Microbe Interactions 10,
933-937.
Triplett, E. W., Breil, B. T. & Splitter, G. A. (1994). Expression of tfx and
sensitivity to the rhizobial peptide antibiotic trifolitoxin in a taxonomically distinct
group of alpha-proteobacteria including the animal pathogen brucella- abortus.
Applied and Environmental Microbiology 60, 4163-4166.
Triplett, E. W. & Sadowsky, M. J. (1992). Genetics of Competition for Nodulation
of Legumes. Annual Review of Microbiology 46399-428, -428.
Visscher, K. & Brakenhoff, G. J. (1991). Single beam optical trapping integrated in
a confocal microscope for biological applications. Cytometry 12, 486-491.
183
Wang, Y. P., Birkenhead, K., Boesten, B., Manian, S. & Ogara, F. (1989).
Genetic-analysis and regulation of the Rhizobium meliloti genes-controlling C4-
dicarboxylic acid transport. Gene 85, 135-144.
Watson, R. J. (1990). Analysis of the C4-dicarboxylate transport genes of
Rhizobium meliloti: nucleotide sequence and deduced products of dctA, dctB and
dctD. Molecular Plant-Microbe Interactions 3, 174-181.
Wilson, J. & Hawkes, J., F,B (1987). Lasers, Principles and Applications. , pp. 29 -
32: Prentice Hall International (UK) Ltd.
Wilson, K. J., Sessitsch, A., Corbo, J. C., Giller, K. E., Akkermans, A. D. L. &
Jefferson, R. A. (1995). ß-Glucuronidase (GUS) transposons for ecological and
genetic studies of rhizobia and other gram-negative bacteria. Microbiology 141,
1691-1705.