57
Databases in Bioinformatics From a ppt by Mark Pallen Prof. Of Bacterial pathogenesis Univ. Birmingham

Databases in Bioinformatics

  • Upload
    ordell

  • View
    143

  • Download
    6

Embed Size (px)

DESCRIPTION

Databases in Bioinformatics. From a ppt by Mark Pallen Prof. Of Bacterial pathogenesis Univ. Birmingham. Databases in Bioinformatics. Sequence databases Sequence analysis Functional genomics Literature databases Structural databases Metabolic pathway databases - PowerPoint PPT Presentation

Citation preview

Page 1: Databases in Bioinformatics

Databases in Bioinformatics

From a ppt by Mark PallenProf. Of Bacterial pathogenesis

Univ. Birmingham

Page 2: Databases in Bioinformatics

Databases in Bioinformatics

• Sequence databases• Sequence analysis• Functional genomics• Literature databases• Structural databases• Metabolic pathway databases• Specialised databases

Page 3: Databases in Bioinformatics

The definitive source….

http://nar.oxfordjournals.org/content/vol34/suppl_1/index.dtl

QuickTime™ and aTIFF (Uncompressed) decompressor

are needed to see this picture.

QuickTime™ and aTIFF (Uncompressed) decompressor

are needed to see this picture.

Page 4: Databases in Bioinformatics

DNA Sequence databases

• Main repositories:– GenBank (US)

• (http://www.ncbi.nlm.nih.gov/Genbank/index.html)

– EMBL (Europe)• (http://www.ebi.ac.uk/embl/)

– DDBJ (Japan)• (http://www.ddbj.nig.ac.jp/)

• Primary databases– DNA sequences are identical

Page 5: Databases in Bioinformatics
Page 6: Databases in Bioinformatics

www.ncbi.nlm.nih.gov

Page 7: Databases in Bioinformatics

PubMed is… • National Library of Medicine's search service• >14 million citations in MEDLINE• links to participating online journals• PubMed tutorial (via side bar)

Page 8: Databases in Bioinformatics

Entrez integrates…

• the scientific literature; • DNA and protein sequence databases; • 3D protein structure data; • population study data sets; • assemblies of complete genomes

ENTREZ THE LIFE SCIENCES ENGINE

Page 9: Databases in Bioinformatics

Entrez is a search and retrieval system that integrates NCBI databases

QuickTime™ and aTIFF (Uncompressed) decompressor

are needed to see this picture.

Page 10: Databases in Bioinformatics

OMIM is…

•Online Mendelian Inheritance in Man•catalog of human genes and genetic disorders•edited by Dr. Victor McKusick, others at JHU

…John Hopkins University

Page 11: Databases in Bioinformatics

Taxonomy Browser is…

• browser for the major divisions of living organisms (archaea, bacteria, eukaryota, viruses)• taxonomy information such as genetic codes• molecular data on extinct organisms

Page 12: Databases in Bioinformatics

Structure site includes… Molecular Modelling Database (MMDB)• biopolymer structures obtained from the Protein Data Bank (PDB)• Cn3D (a 3D-structure viewer)• vector alignment search tool (VAST)

http://www.ncbi.nlm.nih.gov/Structure/VAST/vast.shtml

Page 13: Databases in Bioinformatics

How can I use PubMed at NCBIto find literatureinformation?

Page 14: Databases in Bioinformatics

PubMed is the NCBI gateway to MEDLINE.

MEDLINE contains bibliographic citations and author abstracts from over 4,000 journals published in the United States and in 70 foreign countries.

It has 12 million records dating back to 1966.

Page 15: Databases in Bioinformatics

MeSH is the acronym for "Medical Subject Headings."

MeSH is the list of the vocabulary terms used for subject analysis of biomedical literature at NLM. MeSH vocabulary is used for indexing journal articles for MEDLINE.

The MeSH controlled vocabulary imposes uniformity and consistency to the indexing of biomedical literature.

Page 16: Databases in Bioinformatics
Page 17: Databases in Bioinformatics
Page 18: Databases in Bioinformatics

PubMed search strategies

• Try the tutorial on the left sidebar

• Use boolean queries– lipocalin AND disease

• Try using “limits”

• Try “LinkOut” to find external resources

Page 19: Databases in Bioinformatics

lipocalin AND disease(96 results)

lipocalin OR disease(1.9 million results)

lipocalin NOT disease(729 results)

1 AND 2

1 OR 2

1 NOT 2

1

1

1

2

2

2

Page 20: Databases in Bioinformatics

Fulltext Literature Databases

• Highwire• Google Scholar• Google Print• Useful for finding

information about genes buried in tables in papers, invisible to PubMed

QuickTime™ and aTIFF (Uncompressed) decompressor

are needed to see this picture.

Page 21: Databases in Bioinformatics

From Highwire

...Stanford University

Page 22: Databases in Bioinformatics
Page 23: Databases in Bioinformatics

What is an accession number?

An accession number is label that used to identify a sequence. It is a string of letters and/or numbers that corresponds to a molecular sequence. Examples (all for retinol-binding protein, RBP4):

X02775 GenBank genomic DNA sequenceNT_030059 Genomic contigRs7079946 dbSNP (single nucleotide polymorphism)

N91759.1 An expressed sequence tag (1 of 170)NM_006744 RefSeq DNA sequence (from a transcript)

NP_007635 RefSeq proteinAAC02945 GenBank proteinQ28369 SwissProt protein1KT7 Protein Data Bank structure record

protein

DNA

RNA

Page 24: Databases in Bioinformatics

How can I use NCBI(or other sites)to find informationabout a proteinor gene?

Page 25: Databases in Bioinformatics
Page 26: Databases in Bioinformatics
Page 27: Databases in Bioinformatics
Page 28: Databases in Bioinformatics
Page 29: Databases in Bioinformatics
Page 30: Databases in Bioinformatics

FASTA format

Page 31: Databases in Bioinformatics

Graphics format

Page 32: Databases in Bioinformatics

Question #4:How can I find information about a particular disease?

Answer:Try OMIM

Page 33: Databases in Bioinformatics
Page 34: Databases in Bioinformatics
Page 35: Databases in Bioinformatics

Sequence Databases

• Annotated sequence databases– SWISS-PROT, GenBank etc…– Usage: identifying function, retrieving information

• Low-annotation sequence databases– EST databases, high-throughput genome sequences– Usage: discovery of new genes

Page 36: Databases in Bioinformatics

General Protein Databases

• SWISS-PROT– Manually curated– high-quality annotations, less data

• GenPept/TREMBL– Translated coding sequences from GenBank/EMBL– Few annotations, more up to date

• PIR– Phylogenetic-based annotations

• All 3 now combining efforts to form UniProt (http://www.uniprot.org)

Page 37: Databases in Bioinformatics

Low-annotation Databases

• ESTs (Expressed Sequence Tags)– Low quality sequences generated by

high -volume sequencing the 3’ or 5’ end of cDNAs

– http://www-users.med.cornell.edu/~jawagne/cDNA_cloning.html

• High-throughput genome sequences– Produced by mass-sequencing of

genomic DNA

Page 38: Databases in Bioinformatics

Non-redundant Databases

• Sequence data only: cannot be browsed, can only be searched using a sequence

• Combine sequences from more than one database

• Examples:– NR Nucleic (genbank+EMBL+DDBJ+PDB

DNA)– NR Protein (SWISS-

PROT+TrEMBL+GenPept+PDB protein)

Page 39: Databases in Bioinformatics

Sequence & Structure Databases

• PDB (Protein Databank)– Stores 3-dimensional atomic coordinates for biological

molecules including protein and nucleic acids– Data obtained by X-ray crystallography, NMR, or computer

modeling– http://www.rcsb.org/pdb/

• MMDB (Molecular Modeling database)– Over 28,000 3D macromolecular structures, including

proteins and polynucleotides – (http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=Structure

)• SCOP (Structural Classification of Proteins)

– Classification of proteins according to structural and evolutionary relationships

Page 40: Databases in Bioinformatics

File Formats• GenBank/GB, genbank flatfile format • NBRF format • EMBL, EMBL flatfile format • Swissprot• GCG, single sequence format of GCG software • DNAStrider, for common Mac program • Pearson/Fasta, a common format used by Fasta programs and

others • Phylip3.2, sequential format for Phylip programs • Phylip, interleaved format for Phylip programs (v3.3, v3.4) • Plain/Raw, sequence data only (no name, document, numbering) • MSF multi sequence format used by GCG software • PAUP"s multiple sequence (NEXUS) format • ASN.1 format used by NCBI

Page 41: Databases in Bioinformatics

ID TRBG361 standard; mRNA; PLN; 1859 BP.XXAC X56734; S46826;XXSV X56734.1XXDT 12-SEP-1991 (Rel. 29, Created)DT 15-MAR-1999 (Rel. 59, Last updated, Version 9)XXDE Trifolium repens mRNA for non-cyanogenic beta-glucosidaseXXKW beta-glucosidase.XXOS Trifolium repens (white clover)OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; rosids;OC eurosids I; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium.XXRN [5]RP 1-1859RX MEDLINE; 91322517.RX PUBMED; 1907511.RA Oxtoby E., Dunn M.A., Pancoro A., Hughes M.A.;RT "Nucleotide and derived amino acid sequence of the cyanogenicRT beta-glucosidase (linamarase) from white clover (Trifolium repens L.).";RL Plant Mol. Biol. 17(2):209-219(1991).XXRN [6]RP 1-1859RA Hughes M.A.;RT ;RL Submitted (19-NOV-1990) to the EMBL/GenBank/DDBJ databases.RL M.A. Hughes, UNIVERSITY OF NEWCASTLE UPON TYNE, MEDICAL SCHOOL, NEW CASTLERL UPON TYNE, NE2 4HH, UKXXDR GOA; P26204.DR MENDEL; 11000; Trirp;1162;11000.DR SWISS-PROT; P26204; BGLS_TRIRP.XX

FH Key Location/QualifiersFHFT source 1..1859FT /db_xref="taxon:3899"FT /mol_type="mRNA"FT /organism="Trifolium repens"FT /tissue_type="leaves"FT /clone_lib="lambda gt10"FT /clone="TRE361"FT CDS 14..1495FT /db_xref="GOA:P26204"FT /db_xref="SWISS-PROT:P26204"FT /note="non-cyanogenic"FT /EC_number="3.2.1.21"FT /product="beta-glucosidase"FT /protein_id="CAA40058.1"FT /translation="MDFIVAIFALFVISSFTITSTNAVEASTLLDIGNLSRSSFPRGFIFT FGAGSSAYQFEGAVNEGGRGPSIWDTFTHKYPEKIRDGSNADITVDQYHRYKEDVGIMKFT DQNMDSYRFSISWPRILPKGKLSGGINHEGIKYYNNLINELLANGIQPFVTLFHWDLPQFT VLEDEYGGFLNSGVINDFRDYTDLCFKEFGDRVRYWSTLNEPWVFSNSGYALGTNAPGRFT CSASNVAKPGDSGTGPYIVTHNQILAHAEAVHVYKTKYQAYQKGKIGITLVSNWLMPLDFT DNSIPDIKAAERSLDFQFGLFMEQLTTGDYSKSMRRIVKNRLPKFSKFESSLVNGSFDFFT IGINYYSSSYISNAPSHGNAKPSYSTNPMTNISFEKHGIPLGPRAASIWIYVYPYMFIQFT EDFEIFCYILKINITILQFSITENGMNEFNDATLPVEEALLNTYRIDYYYRHLYYIRSAFT IRAGSNVKGFYAWSFLDCNEWFAGFTVRFGLNFVD"FT mRNA 1..1859FT /evidence=EXPERIMENTALXXSQ Sequence 1859 BP; 609 A; 314 C; 355 G; 581 T; 0 other;aaacaaacca aatatggatt ttattgtagc catatttgct ctgtttgtta ttagctcatt 60cacaattact tccacaaatg cagttgaagc ttctactctt cttgacatag gtaacctgag 120tcggagcagt tttcctcgtg gcttcatctt tggtgctgga tcttcagcat accaatttga 180aggtgcagta aacgaaggcg gtagaggacc aagtatttgg gataccttca cccataaata 240tccagaaaaa ataagggatg gaagcaatgc agacatcacg gttgaccaat atcaccgcta 300caaggaagat gttgggatta tgaaggatca aaatatggat tcgtatagat tctcaatctc 360ttggccaaga atactcccaa agggaaagtt gagcggaggc ataaatcacg aaggaa

http://www.ebi.ac.uk/embl/Documentation/User_manual/usrman.html

EMBL Format

Page 42: Databases in Bioinformatics

LOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p (AXL2) and Rev7p (REV7) genes, complete cds.ACCESSION U49845VERSION U49845.1 GI:1293613KEYWORDS .SOURCE Saccharomyces cerevisiae (baker's yeast) ORGANISM Saccharomyces cerevisiae Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.REFERENCE 1 (bases 1 to 5028) AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W. TITLE Cloning and sequence of REV7, a gene whose function is required for DNA damage-induced mutagenesis in Saccharomyces cerevisiae JOURNAL Yeast 10 (11), 1503-1509 (1994) MEDLINE 95176709 PUBMED 7871890REFERENCE 2 (bases 1 to 5028) AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M. TITLE Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein JOURNAL Genes Dev. 10 (7), 777-793 (1996) MEDLINE 96194260 PUBMED 8846915REFERENCE 3 (bases 1 to 5028) AUTHORS Roemer,T. TITLE Direct Submission JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New Haven, CT, USAFEATURES Location/Qualifiers source 1..5028 /organism="Saccharomyces cerevisiae" /db_xref="taxon:4932" /chromosome="IX"

gene 687..3158 /gene="AXL2" CDS 687..3158 /gene="AXL2" /note="plasma membrane glycoprotein" /codon_start=1 /function="required for axial budding pattern of S. cerevisiae" /product="Axl2p" /protein_id="AAA98666.1" /db_xref="GI:1293615" /translation="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESF TFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFN VILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNE VFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPE TSYSFVIIATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYV YLDDDPISSDKLGSINLLDAPDWVALDNATISGSVPDELLGKNSNPANFSVSIYDTYG DVIYFNFEVVSTTDLFAISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQ DHDWVKFQSSNLTLAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSA NATSTRSSHHSTSTSSYTSSTYTAKISSTSAAATSSAPAALPAANKTSSHNKKAVAIA CGVAIPLGVILVALICFLIFWRRRRENPDDENLPHAISGPDLNNPANKPNQENATPLN NPFDDDASSYDDTSIARRLAALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQ SQSKEELLAKPPVQPPESPFFDPQNRSSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDS YGSQKTVDTEKLFDLEAPEKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTK HRNRHLQNIQDSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRL VDFSNKSNVNVGQVKDIHGRIPEMLBASE COUNT 1510 a 1074 c 835 g 1609 tORIGIN 1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg 61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct 121 ctgcatctga agccgctgaa gttctactaa gggtggataa catcatccgt gcaagaccaa 181 gaaccgccaa tagacaacat atgtaacata tttaggatat acctcgaaaa taataaaccg 241

http://www.ncbi.nlm.nih.gov/Sitemap/samplerecord.html

Genbank Format

Page 43: Databases in Bioinformatics

http://us.expasy.org/sprot/userman.html

Swissprot format

Page 44: Databases in Bioinformatics

Specialized Sequence Databases

• Focus on a specific type of sequences

• Sequences are often modified or specially annotated

• Usage depends on the database• Examples:

– Ribosomal RNA databases– Immunology databases

Page 45: Databases in Bioinformatics

• Pfam (http://www.sanger.ac.uk/Software/Pfam/)Collection of multiple sequence alignments and hidden Markov models covering

many common protein domains and families • SMART (a Simple Modular Architecture Research Tool)

Identification and annotation of genetically mobile domains and the analysis of domain architectures

(http://smart.embl-heidelberg.de/help/smart_about.shtml• CDD (http://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi)

Combines SMART and Pfam databasesEasier and quicker search

Protein domain databases

Page 46: Databases in Bioinformatics

Sequence Motif Databases

• Scan Prosite (http://www.expassy.org/prosite) and PRINTS (http://bioinf.man.ac.uk/dbbrowser/PRINTS/)– Store conserved motifs occurring in nucleic acid

or protein sequences– Motifs can be stored as consensus sequences,

alignments, or using statistical representations such as residue frequency tables

Page 47: Databases in Bioinformatics

Ribosomal RNA Databases

• RDP (Michigan State University, USA)– http://rdp.cme.msu.edu/html/

• rRNA database (University of Antwerp, Belgium)– http://rrna.uia.ac.be/

• ribosomal RNA sequences are pre-aligned according to their secondary structure

• Usage: creating data sets for molecular phylogeny, especially for microbial taxonomy and identification

Page 48: Databases in Bioinformatics

Immunological Sequence Databases

• The Kabat Database of Sequences of Proteins of Immunological Interest– www.hgmp.mrc

.ac.uk/Bioinformatics/Databases/kabatp-help.html

– Sequences are classified according to antigen specificity, and available in pre-aligned format

• The Immunogenetics database (IMGT)– http://imgt.cnusc.fr:8104/– Focuses on immunoglobulins, T-cell receptors

and MHC genes

Page 49: Databases in Bioinformatics

Genome Databases

• Focus on one organism or group of organisms• Examples:

– Colibase (E. coli and related species)– http://colibase.bham.ac.uk/ – GDB (human)

• http://www.gdb.org/– Flybase (Drosophila)

• http://flybase.bio.indiana.edu/– WormBase (C. elegans)

• http://wormbase.org– AtDB (Arabidopsis)

• http://www.arabidopsis.org– SGD (S. cerevisiae)

• http://genome-www.stanford.edu/Saccharomyces/

Page 50: Databases in Bioinformatics

Expression Databases

• RNA expression– Results of microarray experiments measuring the

change in specific mRNA content under certain conditions

– Array Express (EBI) and Geo (NCBI)– Not user friendly

• Proteome databases– 2D gel electrophoresis images representing the

protein content of a cell or tissue under specific conditions

– SWISS 2D PAGE at http://us.expasy.org/ch2d/

Page 52: Databases in Bioinformatics

Methods for Accessing Data

• local installation• screen scraping• BioPerl• FTP sitesScreen scraping is a technique in which a computer program extracts data from the display output of another program. The

program doing the scraping is called a screen scraper. The key element that distinguishes screen scraping from regular parsing is that the output being scraped was intended for final display to a human user, rather than as input to another program, and is therefore usually neither documented nor structured for convenient parsing. Screen scraping often involves ignoring binary data (usually images or multimedia data) and formatting elements that obscure the essential, desired text data. Optical character recognition software is a kind of visual scraper.There are a number of synonyms for screen scraping, including: Data scraping, data extraction, web scraping, page scraping, web page wrapping and HTML scraping (the last four being specific to scraping web

pages).DAS

Page 53: Databases in Bioinformatics

• Screen scraping is a technique in which a computer program extracts data from the display output of another program. The program doing the scraping is called a screen scraper. The key element that distinguishes screen scraping from regular parsing is that the output being scraped was intended for final display to a human user, rather than as input to another program, and is therefore usually neither documented nor structured for convenient parsing. Screen scraping often involves ignoring binary data (usually images or multimedia data) and formatting elements that obscure the essential, desired text data. Optical character recognition software is a kind of visual scraper.There are a number of synonyms for screen scraping, including: Data scraping, data extraction, web scraping, page scraping, web page wrapping and HTML scraping (the last four being specific to scraping web pages).

Page 54: Databases in Bioinformatics

Local Installations

• SRS– Need to obtain license from Lion

Biosceinces

• Download data from FTP sites• Ensembl

– "framework to organise biology around the sequences of large genomes"

– www.ensembl.org

Page 55: Databases in Bioinformatics

Screen Scraping

• URL spoofing– construction of URLs that replicate the query

• html parsing– extraction of results from html pages

returned by query

• Requirements– html module– knowlege of query mechanism

• Method NOT advocated by most data providers

Page 56: Databases in Bioinformatics

BioPerl

• BioPerl is a collection of modules that facilitates the development of Perl scripts for bioinformatics applications.

• www.bioperl.org

Page 57: Databases in Bioinformatics

• Converts input DNA/AA sequence to specified format

Usage: readseq my1st.seq my2nd.seq -all - format=genbank -output=my.gb

Online Manual:http://www.psc.edu/general/software/packages/readseq/manual.html

ReadSeq