Upload
others
View
1
Download
0
Embed Size (px)
Citation preview
Complete Genome Sequence and Pathogenicity of Two
Swine Parainfluenzaviruses Isolated from Pigs in the
United States
Dan Qiao
Thesis submitted to the faculty of the Virginia Polytechnic Institute and State
University in partial fulfillment of the requirements for the degree of
Master of Science
In
Biomedical and Veterinary Sciences
Elankumaran Subbiah, Chair
Xiang-Jin Meng, Member
Chris Roberts, Member
Lijuan Yuan, Member
Kevin Myles, Member
May 21st , 2009
Blacksburg, VA
Keywords: Paramyxovirus, Bovine Parainfluenzavirus 3, Cross-species infection, Pigs
Complete Genome Sequence and Pathogenicity of Two Swine
Parainfluenzaviruses Isolated from Pigs in the United States
Dan Qiao
Abstract
Members of the family Paramyxoviridae are non-segmented, negative-strand RNA
viruses. A large and diverse host species are infected by paramyxoviruses, including avian,
porcine, canine, bovine, equine, ovine, reptiles, aquatic species and humans. In the last few
decades, many novel paramyxoviruses have emerged causing catastrophic illnesses in different
aquatic and terrestrial species of animals and some of them also made the species jump to
humans. Two novel paramyxoviruses 81-19252 (Texas81) and 92-7783 (ISU92) were isolated in
the 1980s and 1990s from the brain of pigs that experienced respiratory and central nervous
system disease from South and North Central United States. To understand their importance as
swine pathogens, molecular characterization and pathogenicity studies were undertaken. The
complete genome of Texas81 virus was 15456 nucleotides (nt) and ISU92 was 15480 nt in
length consisting of six non-overlapping genes coding for the nucloeo- (N), phospho- (P), matrix
(M), fusion (F), hemagglutinin-neuraminidase (HN) and large polymerase (L) proteins in the
order 3'-N-P/C/V-M-F-HN-L-5'. The features related to virus replication and found to be
conserved in most members of Paramyxoviridae were also found in swine viruses. These
include: conserved and complementary 3’ leader and 5’ trailer regions, trinucleotide intergenic
sequences, highly conserved gene start and gene stop signal sequences. The length of each gene
of these two viruses was similar except for the F gene, in which ISU92 had an additional 24 nt
iii
“U” rich 3’ untranslated region (UTR). The P gene of these viruses were predicted to express the
P protein from the primary transcript and edit a portion of its mRNA to encode V and D proteins
and the C protein was expected to be expressed from alternate translation initiation from the P
gene as in Respiroviruses. Sequence specific features related to virus replication and host
specific amino acid signatures in P, F, HN and L proteins indicated that these viruses probably
originated from bovine parainfluenzavirus 3. Pairwise comparisons of deduced amino acid
sequences of swine viral proteins with members of Paramyxoviridae and phylogenetic analysis
based on individual genes as well as predicted amino acid sequences suggested that these viruses
were novel members of the genus Respirovirus of the Paramyxovirinae subfamily and genotype
A of bovine parainfluenzavirus type 3. The mild clinical signs and undetectable gross and
microscopic lesions observed in swine parainfluenzavirus (sPIV3)-infected pigs indicate the
inapparent nature of these viruses in pigs. Limited seroprevalence studies in serum samples
collected from pig farms in Minnesota and Iowa in 2007-2008 by indirect ELISA revealed that
sPIV3 are not circulating in these farms. The mild pathogenicity of sPIV3 can facilitate its
development as a vaccine vector. The screening ELISA developed by us could be used to detect
seroprevalence of sPIV3 in animal and human populations.
iv
This thesis is dedicated to my family and friends. For the
love, support and encouragement from my parents, Yonge
Guo and Wei-min Qiao, and many friends.
v
Acknowledgements
This thesis arose in part out of years of research that has been done since I came to Dr.
Subbiah’s group. During that time, I have worked with a great number of people whose
contribution in assorted ways helped in the research and made me obtain a great and
unforgettable research experience.
In the first place I would like to record my gratitude to Dr. Elankumaran Subbiah for his
supervision, advice, and guidance from the very early stage of my research as well as giving me
an extraordinary experience throughout the work. Above all and the most needed, he provided
me with patience, kindness, unflinching encouragement and support to keep me going through
when I had hard times. His scientific passion and ideas to research always inspired me to be a
good scientist in the future. I would also express my gratefulness to my committee members, Dr.
X.J.Meng, Dr.Lijuan Yuan, Dr. Chris Roberts and Dr. Kevin Myles, who always gave valuable
advice, critical comments on my project and helped me improve my work. I especially want to
acknowledge Dr. Meng and Dr. Yuan who are more like mentors to me, giving me guidance,
believing in me even when I didn’t believe in myself and always gave me their precious time
when I turn to them for extra help in any aspects.
I gratefully thank Dr. Laure Deflube for her help. I learnt not only a lot of techniques but
also an earnest, industrious attitude towards research and her constructive comments on my
research are always useful.
Collective and individual acknowledgments are also owed to my colleagues in
Dr.Subbiah’s lab, Shobana Raghunath, Vrushali Pramod Chavan, Thomas Rogers-Cotrone,
vi
Gopakumar Moorkanat, as well as all in CMMID, whose presence perpetually refreshed and
helped me and made the experience memorable. Many thanks to them for giving me such a
pleasant time when working together.
vii
Table of Contents
Abstract………………………………………………………………………………………...….ii
Dedication…………………………………………………………………………………...….iv
Acknowledgements…………………………………………………………………………...…v
Table of Contents………………………………………………………………………...............vii
List of Abbreviations…………………………………………………………………………….xii
General Introduction…………………………………………………………………………….xvi
Chapter 1. Literature Review………………………………………………….....1
1.1 Introduction …………………………………………………………………………………...1
1.2 Classification of Paramyxoviruses………………………………………………………….....2
1.3 Emerging Paramyxoviruses……………………………………………………………….......3
1.4 Clinical Signs and Lesions……………………………………………………………….........6
1.5 Molecular Biology of Paramyxovirus………………………………………………………..11
1.5.1 Virion Structure and Genome Organization………………………………………...…11
1.5.1.1 Nucleocapsid Protein………………………………………………………......13
1.5.1.2 The P gene and its encoded proteins………………………………………...…13
1.5.1.3 Matrix Protein……………………………………………………………..…...17
1.5.1.4 L Protein………………………………………………………………………..17
viii
1.5.1.5 Viral Glycoproteins………………………………………………………….…18
1.5.2 Strategy of replication………………………………………………………….......…..23
1.6 Parainfluenzaviruses……………………………………………………………………...…24
1.6.1 History of parainfluenzaviruses…………………………………………………….....24
1.6.2 Bovine parainfluenzavirus type 3……………………………………………………...25
1.6.2.1 bPIV3 as a pathogen………………………………………………………......25
1.6.2.2 Cross-species infection of bPIV3 ………………………………………….......26
1.6.2.3 Virion Structure and Genome organization……………………………………27
1.6.2.4 Antigenic relatedness with other parainfluenzaviruses………………………28
1.6.2.5 Diagnostic methods for bPIV3 ………………………………………………...29
1.7 Swine Paramyxoviruses…………………………………………………………………….30
1.7.1 History………………………………………………………………………………….30
1.7.2 Laboratory Examination……………………………………………………………….31
1.7.3 Pathogenicity studies………………………………………………………………...32
1.7.4 Prevalence studies…………………………………………………………………......32
1.7.5 Texas81 history ……………………………………………………………………….33
1.8 Paramyxoviruses as vaccine vector………………………………………………………….33
1.9 Objectives of thesis…………………………………………………………………………..35
1.10 References…………………………………………………………………………………..36
1.11 Tables……………………………………………………………………………………….61
1.12 Figures………………………………………………………………………………………62
ix
Chapter 2. Molecular Characterization of Glycoprotein Genes and
Phylogenetic Analysis of Two Swine Paramyxoviruses Isolated from the
United States………………………………….………………………………..65
Abstract……………………………………………………………………………………...…...66
2.1 Introduction…………………………………………………………………………………..67
2.2 Materials and Methods……………………………………………………………………….69
2.3 Results and Discussion…………………………………………………………………...….78
2.3.1 Morphological and Biological Properties……………………………………………...78
2.3.2 Antigenic analysis………………………………………………………………...……78
2.3.3 Transcriptional start and stop sequences……………………………………………….79
2.3.4 F gene…………………………………………………………………………………80
2.3.5 HN gene………………………………………………………………………………..82
2.3.6 Phylogenetic analysis…………………………………………………………………..84
2.4 Acknowledgments……………………………………………………………………………85
2.5 References…………………………………………………………………………...……….86
2.6 Tables………………………………………………………………………………………...92
2.7 Figures………………………………………………………………………………………..96
Chapter 3. Complete Genome Sequence and Pathogenicity of Two Swine
Parainfluenzaviruses Isolated from Pigs in the United States …….…...……103
Abstract………………………………………………………………………………………....104
3.1 Introduction…………………………………………………………………………………106
x
3.2 Materials and Methods……………………………………………………………………...108
3.2.1 Viruses and Cells……………………………………………………………………..108
3.2.2 Reverse Transcription (RT)-Polymerase Chain Reaction (PCR) and Sequencing…...109
3.2.3 Data Analysis ………………………………………………………………………...110
3.2.4 Accession Numbers for Sequence Analysis…………………………………….…....110
3.2.5 Pathogenicity Studies in Pigs…………………………………………………………112
3.2.6 Development of indirect Enzyme-linked immunosorbent assay (ELISA) …………113
3.3 Results………………………………………………………………………………………114
3.3.1 Genome Features……………………………………………………………...……...114
3.3.2 Genome organization………………………………………………………...……….115
3.3.2.1 The Nucleoprotein (N) Gene………………………………………...…….…116
3.3.2.2 The Phosphoprotein (P) Gene and P/C/V Editing…………………...…...…..117
3.3.2.3 The Matrix protein (M) Gene………………………………………...………118
3.3.2.4 The Fusion Protein (F) Gene and Hemagglutinin-Neuraminidase
Protein (HN) Gene……………………….……………………....................119
3.3.2.5 The Large Polymerase Protein (L) Gene…………………………………......119
3.3.3 Phylogenetic analysis…………………………………………………………………120
3.3.4 Pathogenicity………………………………………………………………………….121
3.3.5 Serum antibody responses to sPIV3 in pigs detected by indirect ELISA ….………...121
3.4 Discussion…………………………………………………………………………………..122
3.5 Acknowledgments…………………………………………………………………………..128
3.6 References…………………………………………………………………………………..129
3.7 Tables……………………………………………………………………………………….158
xi
3.8 Figures………………………………………………………………………………………163
General Conclusion…………………………………………………………….171
xii
Abbreviations
aa Amino acid
aMPV Avian metapneumovirus
APHIS Animal and Plant Health Inspection Service
aPMV2/6 Avian paramyxovirus type 2/6
ASPV Atlantic salmon paramyxovirus
BeV Beilong virus
bPIV3 Bovine parainfluenza virus type 3
bRSV Bovine respiratory syncytial virus
CA Croup associated
cDNA Complementary DNA
CDV Canine distemper virus
CNS Central nervous system
CPE Cytopathic effect
DMV Dolphin morbillivirus
DNA Deoxyribonucleic acid
dpi Day(s) post inoculation
dsRNA Double strand RNA
ELISA Enzyme-linked immunosorbent assay
F Fusion protein
FDLV Fer-de-lance virus
GE Gene-end
GS Gene-start
HA Hemagglutination
HeV Hendra virus
hMPV Human metapneumovirus
HN Hemagglutinin-neuraminidase
hpi Hour(s) post inoculation
hPIV1/2/3 Human parainfluenza virus type 1/2/3
HRP Horseradish peroxidase
xiii
hRSV Human respiratory syncytial virus
ICTV International Committee on the Taxonomy of Viruses
IFA Indirect fluorescent antibody
IFN Interferon
IGS Intergenic sequence
J-V J-virus
kDA Kilo dalton
L Large polymerase protein
LPMV La Piedad Michoacán paramyxovirus
M Matrix protein
Mabs Monoclonal antibodies
MenV Menangle virus
MeV Measles virus
MOI Multiplicity of infection
MoV Mossman virus
MPRV Mapuera virus
MuV Mumps virus
N Nucleocapsid protein
NA Neuraminidase
NDV Newcastle disease virus
NiV Nipah virus
nm Nanometer
NNSV Nonsegmented negative-strand RNA viruses
nt Nucleotides
NVSL National Veterinary Services Laboratory
ORF Open reading frame
P Phosphoprotein
PBS Phosphate buffered saline
PCR Polymerase chain reaction
PCV Porcine circovirus
xiv
PEG Polyethylene glycol
pfu Plaque forming unit
PGI Proliferative gill inflammation
PIV Parainfluenza virus
PK15 Porcine kidney cell line
PoRV/LPMV Porcine rubulavirus
PPRV Peste-des-petits ruminants virus
PRCV Porcine respiratory coronavirus
PRRSV Porcine reproductive and respiratory syndrome virus
PRV Pseudorabies
RACE Rapid amplification of cDNA ends
RBCs Red blood cells
RDRP RNA dependent RNA polymerase
RNA Ribonucleic acid
RPV Rinderpest virus
RT Reverse transcription
SDS-PAGE Sodium dodecyl sulfate polyacrylamide gel electrophoresis
SeV Sendai virus
SF Shipping fever
SIV Swine influenza virus
SPF Specific pathogen free
sPIV Swine parainfluenza virus
sPMV Swine paramyxovirus
SV5 Simian parainfluenza virus 5
TCID50 50% Tissue culture infective dose
TioV Tioman virus
TM Transmembrane
TPMV Tupaia paramyxovirus
TtPIV-1 T. truncates parainfluenza virus type 1
µl Microliter
xv
USDA United States Department of Agriculture
UTR Untranslated region
VLP Virus-like particle
VN virus neutralization
VSV Vesicular stomatitis virus
xvi
General Introduction
Members of the family Paramyxoviridae are non-segmented, negative-strand RNA
viruses. Members of Paramyxoviridae have been isolated from many host species and this family
includes viruses that are found associated with central nervous and respiratory system diseases.
There are many important disease-causing viruses in this family, including animal pathogens that
are economically important in poultry and livestock industry and human pathogens. Members in
Paramyxoviridae family are not only important in economic and public health aspects, some of
them are also extensively studied to be developed as a vaccine vector or for use as anticancer
agents.
Paramyxoviruses are classified in the order Mononegavirales. Based on virus particle
morphology, genome organization, and structure and sequence relatedness, family
Paramyxoviridae can be divided into two subfamilies; Paramyxovirinae and Pneumovirinae.
Currently, there are five genera within the subfamily Paramyxovirinae: Rubulavirus, Avulavirus,
Respirovirus, Morbillivirus, and Henipavirus, and two genera within the subfamily
Pneumovirinae: Pneumovirus and Metapneumovirus.
A large and diverse host species are infected by paramyxoviruses including avian,
porcine, canine, bovine, equine, ovine, reptiles, aquatic species and humans. There are also
extensive records of zoonotic paramyxoviruses derived from sick pigs in the recent decades all
over the world.
The family Paramyxoviridae has a typical negative-stranded RNA virus structural
pattern. The enveloped virus particle contains a left-handed, helically symmetrical
xvii
ribonucleoprotein core, called nucleocapsid, which comprises the non-segmented single-
negative-stranded RNA genome surrounded by the nucleocapsid proteins, coated within a bilayer
viral envelope. The genome length of family Paramyxoviridae ranges from 15,000 to 19,000
nucleotides (nt), encoding six to ten tandemly linked genes in the order 3'-N-P/C/V-M-F-HN-L-
5'. Interestingly, the genome length of most members of Paramyxoviridae is divisible by six,
known as “rule of six”.
Two swine paramyxoviruses (sPMV) (81-19252 (Texas81), and 92-7783 (ISU92)) were
isolated from the pigs that experienced respiratory and central nervous system disease in the
1980s and 1990s from South and North Central United States, respectively. Texas81 virus was
isolated from the brain of pigs that exhibited respiratory and neurological disease in Texas State,
in 1981. Further information on the history of this virus is not available. ISU92 virus was
isolated from a swine operation in the1990s in north central United States. Affected pigs showed
high fever and mild cough. Encephalitic signs were observed in several pigs with persistent
squealing, head pressing, whole body tremors, and hind-limb ataxia leading to excessive
mortality. Antigenic analysis by indirect fluorescent antibody assay at the National Veterinary
Services Laboratory (NVSL), Ames, Iowa indicated that these two viruses were closely related
to human parainfluenza virus (hPIV) type 1 and 3 and bovine parainfluenza virus type 3 (bPIV3).
As new viruses emerging that causes severe diseases in pigs and have the potential to
cross species barrier and infect other hosts including humans, it is important that these new
viruses to be studied further. The objectives of my thesis is to perform molecular characterization
and pathogenicity studies to understand the significance of these two strains of sPMV for swine
health and to determine their taxonomic status and to examine the pathogenicity of the two
xviii
viruses in conventionally reared pigs. This will establish a foundation for a reverse genetics
system to study pathogenesis and develop them into vaccine vectors.
1
Chapter 1
Literature Review
1.1 Introduction
In the last few decades, many novel paramyxoviruses have emerged causing catastrophic
illnesses in different aquatic and terrestrial species of animals and some of them also made the
species jump to humans. Members of Paramyxoviridae have been isolated from many host
species and this family includes viruses which are found associated with central nervous and
respiratory system diseases (Lamb and Parks, 2007). There are many important disease-causing
viruses in this family, including animal pathogens that are economically important in poultry and
livestock industry, such as Newcastle disease virus (NDV), Rinderpest virus (RPV) and Peste-
des-Petits ruminants virus (PPRV), and human pathogens such as measles virus (MeV), mumps
virus (MuV), respiratory syncytial virus (RSV) and parainfluenza viruses (PIV) (Lamb and
Parks, 2007). Members in Paramyxoviridae family are not only important in economic and
public health aspects, some of them such as MeV and NDV are also extensively studied to be
developed as a vaccine vector or for use as anticancer agents (Cassel and Garrett, 1965;
Elankumaran et al., 2006; Russell and Peng, 2009; Vigil et al., 2008).
Members of the family Paramyxoviridae are non-segmented, negative-strand RNA
viruses. The paramyxovirus contains a lipid bilayer envelope that is derived from plasma
membrane of the host cell during budding. Viral glycoprotein spikes are inserted into the
envelope and can be visualized by electron microscopy. Inside the viral membrane is the helical
filamentous nucleocapsid core formed by large polymerase, nucleocapsid, and phosphoproteins
2
bound to the genomic RNA. They have a close relationship with two other negative strand RNA
viruses: Rhabdoviruses (for their unique nonsegmented genomes organization and its expression)
and Orthomyxoviruses (for the biological properties of the envelope glycoproteins). The
genomic RNA of Paramyxoviruses functions as a (i) template for synthesis of mRNA as well as
(ii) the template for the antigenome strand for making further copies of the genomic RNA. This
virion structural pattern and replication strategy are common in all negative-stranded RNA
viruses (Lamb and Parks, 2007).
1.2 Classification of Paramyxoviruses
Paramyxoviruses are enveloped RNA viruses possessing non-segmented negative-strand
genomes in the order Mononegavirales (Lamb et al., 2005b). Based on virion morphology,
genome organization, and structure and sequence relatedness, family Paramyxoviridae can be
divided into two subfamilies, Paramyxovirinae and Pneumovirinae. Currently, there are five
genera within the subfamily Paramyxovirinae: Rubulavirus, Avulavirus, Respirovirus,
Morbillivirus, and Henipavirus, and two genera within the subfamily Pneumovirinae:
Pneumovirus and Metapneumovirus (Lamb and Parks, 2007) (Table 1). Respiroviruses and
rubulaviruses demonstrate both hemagglutinating (HA) and neuraminidase (NA) activity.
Morbilliviruses and henipaviruses exhibit only HA but lack NA activity. Pneumoviruses do not
cause detectable HA in mammalian and avian erythrocytes and their narrower nucleocapsids also
morphologically distinguish them from Paramyxovirinae. In addition, the differential coding
potential of the P genes, and the presence of an extra gene (SH) are also considered for the
classification (Lamb and Parks, 2007).
3
Some recently identified paramyxoviruses: Menangle virus (MenV) (Philbey et al.,
1998), Tupaia paramyxovirus (Tidona et al, 1999), Tioman virus (TioV) (Chua et al., 2001),
Mossman virus (Miller et al, 2003), J-virus (J-V) (Jack et al., 2005; Jun et al., 1977), Beilong
virus (BeV) (Li et al., 2006b), Mapuera virus (MPRV) (Karabatsos, 1985), Salem virus (Glaser
et al., 2002) and Fer-de-lance virus (Clark et al., 1979) are also officially classified into
Paramyxoviridae by International Committee on the Taxonomy of Viruses (ICTV); however, the
subfamily and genera are still need to be assigned (Lamb et al., 2005a; Lamb and Parks, 2007).
Two more prospective members are, T. truncates parainfluenza virus type 1 (TtPIV-1) isolated
from bottlenose dolphins (Nollens et al., 2008), and Atlantic salmon paramyxovirus (ASPV)
(Nylund et al., 2008).
1.3 Emerging Paramyxoviruses
A large and diverse host species are infected by paramyxoviruses, including avian,
porcine, canine, bovine, equine, ovine, reptiles, aquatic species and humans (Franke et al., 2001;
Horwood et al., 2008; Lamb and Parks, 2007; Nollens et al., 2008; Nylund et al., 2007; Nylund
et al., 2008). Many bat-associated paramyxoviruses have emerged and some of them caused
diseases in animals and humans (Wang et al., 2001). There are also extensive records of
paramyxoviruses derived from sick pigs. Mapuera virus (MPRV) was isolated in 1979 from an
apparently healthy tropical fruit bat (Sturnira lilium) in Brazil (Karabatsos, 1985). Genomic
studies showed that MPRV was closely related to La Piedad Michoacán paramyxovirus (LPMV)
(Wang et al., 2007), also known as porcine rubulavirus (PoRV), the only well studied
neurotropic paramyxovirus isolated from pigs prior to the 1990s (Moreno-Lopez et al., 1986).
4
The host range and disease-causing potential of MPRV is still unknown. There was also
concurrent infection of porcine reproductive and respiratory syndrome virus (PRRSV) and a
paramyxovirus in Germany in the 1990s that had been subsequently named “SER” virus (Heinen
et al., 1998; Tong et al., 2002).
In 1972, a disease outbreak characterized by respiratory distress, lethargy, and death
occurred on a snake farm in Zurich, Switzerland(Clark et al., 1979). A virus subsequently was
isolated from lung tissue of one of the dead snakes. This virus initially was classified as a
paramyxo-like virus and designated Fer-de-Lance Virus (Clark et al., 1979). Since the original
disease outbreak and identification of a viral etiology in 1972, ophidian paramyxoviruses
(OPMV) have emerged as important pathogens of viperid snakes. The first report of OPMV
infection in the United States occurred in 1980 in a private collection of snakes in Florida
(Jacobson et al., 1980). Similar viruses also have been isolated from non-viperid snakes
including a black mamba, corn snakes, beauty snakes, and Moellendorff’s rat snakes (Jacobson
et al., 1980). Clinical signs of OPMV include a sudden gaping of the mouth, followed by violent
convulsions, regurgitation, and expulsion of a brownish fluid from the glottis. Death usually
follows within hours of the first convulsion. A variety of lesions have been described in snakes
dying with OPMV infections, including proliferative pneumonia, encephalitis, and pancreatic
hyperplasia (Jacobson et al., 1981).
In late 1994 in Australia, Hendra virus (HeV) caused an outbreak of severe respiratory
disease resulting in the death of 13 horses and their trainer (Murray et al., 1995), followed by
sporadic HeV outbreaks in horses and humans (Field et al., 2007a). Subsequent serosurveillance
of wild-caught wildlife showed evidence that flying foxes (genus Pteropus, order Chiroptera)
5
were the natural hosts of HeV (Field et al., 2007b). A closely related virus, Nipah virus (NiV)
from Malaysia caused severe febrile encephalitis and death in pigs and humans (Chua et al.,
2000), which spread to Bangladesh and India (Chadha et al., 2006; Hsu et al., 2004). HeV and
NiV were assigned as a genus, Henipavirus, in Paramyxovirinae (Eaton et al., 2006).
In 1997, another paramyxovirus, named Menangle virus (MenV) has been isolated in
Australia from still-born pigs with deformities (Philbey et al., 1998), and associated human
illness (Chant et al., 1998). Neutralizing antibodies against this virus could be detected in several
fruit bat species (Philbey et al., 1998). In 2000, Tioman virus (TioV) was isolated from urine
collected beneath a fruit bat colony on Tioman Island, Malaysia (Chua et al., 2001). Molecular
characterization revealed that MenV and TioV are closely related novel members of the genus
Rubulavirus (Bowden and Boyle, 2005; Chua et al., 2001; Chua et al., 2002). J-virus (JV),
isolated from wild mice in Australia, and Beilong virus (BeV), originally isolated from human
mesangial cells in China and subsequently detected in rat mesangial cells, may represent a new
group of paramyxoviruses (Basler et al., 2005; Jack et al., 2005; Jun et al., 1977; Li et al., 2006b;
Schomacker et al., 2004).
Recently, T. truncates parainfluenza virus type 1 (TtPIV-1) isolated from bottlenose
dolphins with severe respiratory illness (Nollens et al., 2008), and Atlantic salmon
paramyxovirus (ASPV) suffering from proliferative gill inflammation (Kvellestad et al., 2003;
Nylund et al., 2008) are also suggested to be classified in Paramyxovirinae. However, most of
these recently identified paramyxoviruses need to be further classified by the ICTV. For many of
the new and emerging viruses, the host range, pathogenicity and geographic distribution are
unknown.
6
1.4 Clinical Signs and Lesions
The clinical signs associated with paramyxovirus infections are essentially similar across
species. Many members of the family Paramyxoviridae were recognized as important respiratory
tract pathogens in many species of animals and humans, while some can also lead to neurological
symptoms. Parainfluenza virus 1 to 3 are major causes of croup, known as severe acute
laryngotracheobronchitis, and hPIV3 can also cause pneumonia and bronchiolitis, in infants and
children (Chanock, 1956; Chanock et al., 1958). hPIV4 is less severe and can cause mild upper
respiratory tract illness in young adults (Ruth A. Karron, 2007). hPIV1, 2, or 3 can produce
sensitive and permissive infections in hamsters experimentally. In addition, guinea pigs, cotton
rats, and ferrets are also semipermissive, however mice are poorly permissive (Ruth A. Karron,
2007). Chimpanzees and monkeys can also be infected with hPIV1-3 but only hPIV3 causes
symptomatic illness in chimpanzees and African green monkeys. Infection usually remains
subclinical and pulmonary pathology is minimal or undetectable in most experimental animals
due to the limited virus replication (Lamb and Parks, 2007).
Canine parainfluenza virus 2 (known as PIV5) is one of several etiologic agents of
kennel-cough (Appel and Percy, 1970). Infected dogs exhibit clinical signs ranging from dry
cough to pneumonia with fever, malaise, coughing with copious amounts of nasal discharge
(Appel and Percy, 1970; Rosenberg et al., 1971). A canine PIV was isolated from the
cerebrospinal fluid of a dog that experienced incoordination and posterior paresis (Evermann et
al., 1980), and this isolate induced hydrocephalus with central nervous system (CNS) depression
and severe inspiratory-expiratory dyspnea in dogs after experimental inoculation (Baumgartner
et al., 1982a; Baumgartner et al., 1982b).
7
Canine distemper is caused by the canine distemper virus (CDV) which is a contagious,
incurable, often fatal, multisystemic viral disease that affects the respiratory, gastrointestinal and
central nervous systems, and was the leading cause of death in unvaccinated dog of all ages
worldwide (Appel, 1969). CDV occurs among domestic dogs and many other carnivores,
including raccoons, skunks, foxes (Appel, 1969), and large cats such as lions, leopards, cheetahs,
and tigers (Myers et al., 1997a), but does not cause disease in domestic cats (Bart et al., 2000).
The development of a vaccine in the early 1960s led to a dramatic reduction in the number of
infected domestic dogs, and canine distemper occurs now only as sporadic outbreaks (Kapil et
al., 2008; Norris et al., 2006). Young puppies between 3 and 6 months old are most susceptible
to infection and disease, and are more likely to die than infected adults. Nonimmunized older
dogs are also highly susceptible to infection and disease (Appel, 1970).
bPIV3 was first isolated from nasal mucus of calves showing clinical signs of shipping
fever including rapid fever, respiratory symptoms, nasal discharge, cough, lacrimation,
conjunctivitis and inappetence (Andrewes et al., 1959; Reisinger et al., 1959). bPIV3 can also be
isolated from clinically normal cattle (Rosenberg et al., 1971). It is generally accepted that co-
infection of bPIV3 along with other viruses and Mannheimia/Pasturella species could result in a
clinical disease known as shipping fever (Battrell, 1995; Woods, 1968). A variety of factors such
as environmental temperature, transportation, hygiene, stocking density, co-mingling, host
immune status can contribute to increased susceptibility to secondary bacterial infection and
severity of clinical disease (Kahn and Line, 2005).
Mumps was a worldwide common childhood disease, characterized by painful salivary
gland swelling (95% of symptomatic cases), and orchitis in infected teenage and adult males
8
before introduction of the mumps vaccine (Philip et al., 1959). One third of MuV infections are
subclinical (Center for Disease Control (CDC) Mumps- United States, 1984-1986). Multiple
organs can be symptomatically involved during infection including testes, CNS, epididymis,
prostate, ovary, liver, pancreas, spleen, thyroid, kidneys, labyrinth, eyes, thymus, heart,
mammary glands, lungs, bone marrow, and joints (Carbone and Rubin, 2007). Virulent strains of
MuV commonly target CNS and result in seizures or remain asymptomatic (Azimi et al., 1969).
Pancreatitis (Feldstein et al., 1974), arthritis (Gordon and Lauter, 1984), abortion (Philip et al.,
1959), renal dysfunction (Utz et al., 1964), deafness (Kirk, 1987), obstructive hydrocephalus
(Bistrian et al., 1972), and transient electrocardiogram abnormalities (Arita et al., 1981) may also
occur.
?DV is one of the most important avian pathogens known. The clinical signs of NDV
varies depending on the tissue tropism, strain virulence and susceptibility of the avian order
(Cross, 1991). NDV strains display a spectrum of virulence ranging from mild, inapparent
infections to severe disease with high mortality (Brugh and Beard, 1984; Cross, 1991).
Viscerotropic velogenic NDV causes 100% morbidity and mortality and considered to be the
most devastating disease in poultry industry. Infected birds rapidly become anorectic and listless
with cyanotic and edematous combs and wattles, followed by severe respiratory distress and
conjunctivitis (Cross, 1991). Neurotropic velogenic NDV is another acute, generally lethal
infection of chickens of all ages affecting respiratory and neurologic tissues. It can casue 100%
morbidity but mortality is generally far less with extremes of 50 percent in adult birds and 90
percent in young chickens (Cross, 1991). Mesogenic NDV is less virulent and result in
respiratory signs, CNS signs and reduction in egg production (Cross, 1991). Lentogenic NDV is
9
milder than mesogenic NDV infection and CNS signs are rarely present (Brugh and Beard,
1984).
The records of paramyxoviruses isolated from pigs with encephalomyelitis are extensive
from many parts of the world including Japan (Sasahara et al., 1954), Canada (Greig et al.,
1971), and Israel (Lipkind et al., 1986). LPMV, responsible for blue eye disease, is the most
thoroughly studied neurotropic paramyxovirus isolated from pigs. LPMV was first isolated in
central Mexico in the early 1980s (Moreno-Lopez et al., 1986), and it has become endemic in
Mexico (Linne et al., 1992). Clinical signs include reproductive failure, interstitial pneumonia ,
encephalitis and corneal opacity in infected pigs (Stephano, 1990). Nursing piglets are most
susceptible. Morbidity is between 20% and 50% and mortality is between 87% and 90% (Linne
et al., 1992).
Hendra virus was discovered in 1994 in Australia and caused the death of 13 horses and
a trainer (Murray et al., 1995). In horses, infection caused pulmonary oedema and congestion,
while, in humans, hemorrhage and edema of the lungs, and encephalitis were seen. A total of
nine outbreaks of Hendra virus have occurred since 1994, all involving infection of horses. Four
of these outbreaks have spread to humans as a result of direct contact with infected horses.
?ipah virus was identified in 1999 when it caused an outbreak of neurological and respiratory
disease on pig farms in peninsular Malaysia, resulting in 105 human deaths and the culling of
one million pigs (Chua et al., 1999). Symptoms of infection from the Malaysian outbreak were
primarily encephalitic in humans and respiratory in pigs. Later outbreaks have caused respiratory
illness in humans, increasing the likelihood of human-to-human transmission and indicating the
existence of more dangerous strains of the virus (Chadha et al., 2006; Hsu et al., 2004).
10
Several paramyxoviruses have been isolated from rodents since 1960s. Mossman virus
(MoV) was first isolated from pooled organs of trapped native rats (Miller et al., 2003)and J-
virus (J-V) was isolated from trapped moribund Mus musculus (Jun et al., 1977) both in 1970s in
Queensland, Australia. Beilong virus (BeV) was first isolated from the human mesangial cell
line. However, the presence of BeV in a rat mesangial cell line used in the same laboratory prior
to the isolation from the human mesangial cells suggests it to be of rodent origin (Li et al.,
2006b). Tupaia paramyxovirus (TPMV) was isolated from the kidneys of an apparently healthy
tree shrew captured in Thailand (Tidona et al., 1999). Phylogenetic analysis places these four
viruses between or within the genera Morbillivirus, Respirovirus and Henipavirus, but the
taxonomic status is still unclear and they have not been officially classified into any of the
existing genera (Li et al., 2006b; Tidona et al., 1999).
Atlantic salmon paramyxovirus (ASPV) was first isolated in 1995 from Atlantic
salmon (Salmo salar L.) experiencing respiratory disease, proliferative gill inflammation (PGI)
and the outbreaks increased in past years (Nylund et al., 2008). PGI shows signs of inflammation
and proliferation and cell death of gill tissue in Atlantic salmon. Affected fish had reduced
growth rate and even mortality in severe cases (Nylund et al., 2008). ASPV was one of the
agents isolated from some PGI cases although the primary causative agent has not yet been
identified (Kvellestad et al., 2003; Kvellestad et al., 2005).
T. truncates parainfluenza virus type I (TtPIV-1) was isolated from 19-year old male
Atlantic bottlenose dolphin suffering from respiratory illness including raspy, foul-odored breath
and cream-colored exudates from the blowhole (Nollens et al., 2008). Foamy mononuclear cells
were observed in blood smear and neutrophils and monocytes were detected in blowhole swabs
11
(Nollens et al., 2008). Lung showed partial consolidation by percutaneous ultrasound.
Phylogenetic analysis classified TtPIV-1 in the cluster of Paramyxovirinae, genus Respirovirus,
and significant relationship with bPIV3 (Nollens et al., 2008).
1.5 Molecular Biology of Paramyxovirus
1.5.1 Virion Structure and Genome Organization
The family Paramyxoviridae has a typical negative-stranded RNA virus structural pattern
(Figure 1). The enveloped virus particle contains a left-handed, helically symmetrical
ribonucleoprotein core, called nucleocapsid (NC), which consists of non-segmented single-
negative-stranded viral RNA genome surrounded by nucleocapsid proteins and associated with
phosphoproteins and large polymerase protein (Lamb and Parks, 2007). The NC of
Paramyxovirinae, 18 nm in diameter, 1µm in length, and a pitch of 5.5 nm in diameter, is
enclosed by an outer lipoprotein envelope (Lamb and Parks, 2007). The helical NC of
paramyxoviruses presents “herring bone” morphology when viewed under an electron
microscope. Pneumovirinae subfamily can be differentiated from Paramyxovirinae subfamily
morphologically because they have narrower nucleocapsids (Lamb and Parks, 2007). The virions
of Paramyxoviridae are pleiomorphic in shape being spherical or filamentous (Figure 1). In
general, spherical virions are 150-350 nm in diameter (Lamb and Parks, 2007).
The genome length of family Paramyxoviridae ranges from 15,000 to 19,000 nucleotides
(nt), encoding six to ten tandemly linked genes in the order 3'-N-P/C/V-M-F-HN-L-5'.
Interestingly, the genome length of most members of Paramyxoviridae is divisible by six, known
12
as “rule of six” (Calain and Roux, 1993; Kolakofsky et al., 1998; Kolakofsky et al., 2005), i.e.
their genomes must be of polyhexameric length (6n+0) to replicate efficiently. Each nucleoprotein
subunit associates with six nucleotides and that makes the RNA chain length as an even multiple
of six when completely encapsidated. There is a ~50 nt 3’ extracistronic leader region and a 50 to
171 nt 5’ extracistronic trailer region (or [–] leader) at the two ends of the genome. The leader and
trailer are considered to be cis-acting signals and are essential for transcription and replication.
Between the gene boundaries, there are intergenic regions (IGS), which are strictly conserved
trinucleotides in Respirovirus, Henipavirus and Morbillivirus but quite variable in length for the
Rubulavirus and Pneumovirinae, ranging from 1 to 56 nt. The newly discovered
paramyxoviruses, such as TioV, have an even longer IGS, which may be up to 70 nt in length.
The glycoprotein complexes are stalk-like spikes on the surface of virions. Fusion protein
(F) and an attachment protein, called hemagglutinin-neuraminidase (HN) or hemagglutinin (H) or
glycoprotein (G) depending on the virus genera (Lamb and Parks, 2007), are the major
components of the spikes. The F and HN/H/G proteins may be in the form of trimers (F) and
tetramers (attachment protein), respectively. The envelope glycoproteins are responsible to
mediate virus attachment and penetration during infection. The internal helical nucleocapsid core
contains the RNA genome and nucleocapsid (N), phospho- (P) and large (L) polymerase proteins.
Another structural protein, matrix (M) protein, is located between the envelope and the core, and
is important in virion architecture and in infection process. Accessory proteins are mostly
generated from overlapping open reading frames within P gene transcriptional units by a process
called RNA editing or by alternative translation initiation. These accessory proteins are important
in viral morphogenesis, RNA synthesis, and pathogenesis (Lamb and Parks, 2007).
13
1.5.1.1 %ucleocapsid Protein
The nucleocapsid protein (N) is one of the most abundant proteins in paramyxoviruses
and is present as the first transcribed gene, adjacent to the leader sequence at the 3’ end of viral
genomic RNA for all paramyxoviruses, except the pneumoviruses, in which two more
nonstructural genes, NS1 and NS2 will be transcribed first. The N protein is composed of 489 to
553 amino acids (aa) with the predicted molecular weight of 53-58 kDa. The N-terminal region
of the N protein is involved with encapsidation of viral RNA, coats full-length of viral [-] sense
genomic and [+] sense antigenomic RNAs to form the helical nucleocapsid. This helical
structure serves several functions including protection from nuclease digestion, alignment of
distal RNA segments to create a functional 3’ end promoter and providing interaction with P and
L proteins during transcription and replication, and association with M protein during virus
assembly (Lamb and Parks, 2007).
1.5.1.2 The P gene and its encoded proteins
Paramyxovirinae P gene encoding multiple viral proteins can be considered as a
remarkable example of exploiting the coding capacity of viruses. Sendai virus (SeV) P gene can
direct the expression of at least seven polypeptides, including P, V, W, C’, C, Y1 and Y2. Other
paramyxoviruses may express fewer proteins from the P gene, however this capability is always
seen. Generally, two mechanisms involve production of multiple mRNA species from the P
gene. One is known as alternative initiation, by which the family of C proteins is produced from
an alternative initiation translation codon. The second mechanism involves pseudotemplated
14
insertion of multiple G residues at a specific position, known as mRNA editing site, to produce
mRNAs of P, V proteins and virus-specific proteins variously called W/I/D proteins, depending
on the virus genus. P, V, W/I/D are a set of proteins that are amino co-terminal and the mRNAs
are only different by inserted G nucleotides that shift the translation reading frame after the
insertion site (Lamb and Parks, 2007).
Viral accessory proteins and their interactions with the host
Type I interferon (IFN) is one of the most important antiviral response which has two
general phases: a primary transcriptional phase of induction of IFN synthesis, and a secondary
transcriptional phase through type I IFN signaling pathway (Biron and Sen, 2007).
Paramyxovirus accessory proteins can counteract the host cell IFN pathways at both levels
(Biron and Sen, 2007). The paramyxovirus V protein cysteine-rich domain can limit dsRNA-
induced activation of the IFN-beta promoter by direct interaction with melanoma differentiation-
associated gene 5 (MDA5) (Komatsu et al., 2004). The expression of C proteins in SeV and W
proteins in NiV can also reduce IFN-beta promoter activation in response to dsRNA (Komatsu et
al., 2004). IFN signaling is initiated by binding of secreted IFN and its cognate receptor on the
cell surface leading to phosphorylation of latent transcription factors, STAT1 and STAT2, which
are signal transducers and activators of transcription (Karron and Collins, 2007; Lamb and Parks,
2007). The V protein of some paramyxoviruses such as PIV5, MuV, SV41, hPIV2, NDV can
target one of the STATs for degradation to block the IFN signaling (Biron and Sen, 2007) while
some like henipaviruses and measles virus can form a V and STAT protein binding complex and
prevent its translocation to the nucleus (Palosaari et al., 2003; Rodriguez et al., 2003; Shaw et al.,
15
2004). The C protein of respiro- and morbilliviruses are involved in blocking IFN signaling by a
different mechanism (Garcin et al., 2001; Garcin et al., 2002; Gotoh et al., 2003; Takeuchi et al.,
2001). SeV and hPIV3 can alter STAT phosphorylation patterns (Gotoh et al., 2003), interact
with STAT1 (Garcin et al., 2001; Takeuchi et al., 2001), and induce ubiquitination and
degradation of STAT1 in some mouse cells (Garcin et al., 2002).
Phosphoprotein
The paramyxovirus P protein is generally 400 to 600 aa long. It is heavily phosphorylated
at serine and threonine residues predominantly within the N-terminal region (Lamb and Parks,
2007). The C-terminal module and N-terminal domain of P protein play important roles as
polymerase cofactor and in nascent chain assembly, respectively. The C-terminal polymerase
cofactor module is conserved in the predicted secondary structure for all Paramyxovirinae
members. It contains domains for P-P multimerization, for L protein interactions and for N-RNA
template binding (Horikami et al., 1992). The N-terminal region is believed to act as a chaperone
to facilitate interactions with unassembled N in order to prevent N aggregation and to prevent
uncontrolled encapsidation of non-viral RNA (Curran et al., 1995).
V protein
The V protein is a 25 to 30 kDa polypeptide that is amino co-terminal with P protein but
with a variable C-terminal domain. The C-terminal V-specific domain is highly conserved
among paramyxoviruses with invariantly spaced histidine and cysteine residues forming a
16
domain (cys-rich domain) that binds two zinc molecules per V protein (Fukuhara et al., 2002; Li
et al., 2006a; Liston and Briedis, 1994; Paterson et al., 1995). The V protein plays important
roles in virus replication (Baron and Barrett, 2000; Curran et al., 1991), functions as a negative
regulator to inhibit RNA synthesis (Baron and Barrett, 2000; Delenda et al., 1997; Durbin et al.,
1999), and inhibits host cell antiviral response by interacting with cellular proteins (Andrejeva et
al., 2002; Lin et al., 1998).
W/D/I protein
The W and D proteins are expressed by inserting 2 G residues at the P gene mRNA editing
site in respiro-, morbilli-, and henipaviruses. The W protein in SeV is found to interact with
unassembled N0, suggesting an inhibitory role in viral RNA synthesis (Horikami et al., 1996). In
PIV3, insertion of 2 G residues at the editing site produces a protein called D protein (Galinski et
al., 1992). In rubulaviruses, insertion of one or four G residues during RNA editing produces I
protein (Paterson and Lamb, 1990; Thomas et al., 1988). The role of W/D/I in viral growth cycle
has not been understood (Lamb and Parks, 2007).
C protein
The C proteins are generated using alternative translation initiation codons in Respiro-
,Henipa-, Morbillivirus (Lamb and Parks, 2007). In SeV, C’, C, Y1 and Y2 comprise a nested set
with a shared C-terminal. The C proteins are small basic polypeptides that may involve in the
17
viral growth cycle, control of viral RNA synthesis (Lamb and Parks, 2007), counteracting host
cell antiviral pathways (Komatsu et al., 2004) and facilitating the release of virus from infected
cells (Garcin et al., 1997; Kato et al., 2001).
1.5.1.3 Matrix Protein
The M protein is the most abundant protein in the virion, comprising of 341 to 375
residues with a molecular weight of 38.5-41.5 kDa. The net charge at neutral pH is +14 to 17
making it a basic protein. Although there is no transmembrane domain that has sufficient length
to span a lipid bilayer, M protein is somewhat hydrophobic and peripherally associated with
membranes (Lamb and Parks, 2007). The M protein is considered to be the central organizer of
viral morphogenesis interacting with the cytoplasmic tails of integral membrane protein, F and
HN, the lipid bilayer and the nucleocapsids (Blumberg et al., 1984; Cathomen et al., 1998;
Sanderson et al., 1993; Schmitt et al., 1999; Stricker et al., 1994).
1.5.1.4 L Protein
The L protein, located at the most promoter distal part in the genome, is the least abundant
protein in virus particles. A paramyxovirus particle contains only ~50 copies of L (Lamb et al.,
1976). Overexpression of L protein may inhibit virus growth (Banerjee and Barik, 1992). It is an
essential subunit of paramyxovirus RNA-dependent RNA polymerase (RdRP). The L gene
consists of ~2200 aa with a molecular weight of 220-250 kDa. The L protein possesses all the
18
enzymatic activities needed for polymerization, 5’ end capping, methylation and 3’ end
polyadenylation of mRNA (Grdzelishvili et al., 2005; Ogino et al., 2005). The L protein
associates with P protein to form the active viral polymerase and the polymerase complex can
recognize the helical N-RNA template (Hamaguchi et al., 1983; Poch et al., 1990).
1.5.1.5 Viral Glycoproteins
Fusion Protein
The F glycoprotein is a type I integral membrane protein mediating viral penetration by
fusion between the virion envelope and the host cell plasma membrane at neutral pH. The F
protein is composed of 540 to 580 aa residues. It is synthesized as an inactive precursor, F0,
which must be proteolytically cleaved to produce the active fusion protein, which consists of
disulfide-linked F1 and F2 polypeptides to be biologically functional (Scheid and Choppin, 1974).
This cleavage event is required for progeny virions to become infectious (Garten et al., 1980;
Nagai et al., 1976). The cleavage of F0 is a candidate to be a key determinant for infectivity and
pathogenicity for certain viruses. The Paramyxoviridae has a cleavage signal sequence located
at the N-terminal of F with multibasic or single basic residue at the cleavage site. The cleavage
of F containing multibasic residues at the cleavage site occurs intracellularly by furin, a
subtilisin-like endoprotease (Klenk and Garten, 1994), while F with a single basic residue at the
cleavage site must be expressed at the cell surface and incorporated into released virions and
then can be cleavage activated by the addition of exogenous protease (Scheid and Choppin,
1974). For NDV, the nature of the cleavage site correlates with the virulence of the virus strains.
19
The ones with multibasic residues at the cleavage site show virulence and readily disseminate
through the host whereas strains with single basic residue at the cleavage site are avirulent and
tend to be restricted to the respiratory and alimentary tracts where the necessary secreted
protease is present (Nagai and Klenk, 1977). The C-terminal of F has a hydrophobic
transmembrane (TM) domain that anchors the protein into the membrane leaving a short
cytoplasmic tail (~20-40 residues). A 4-3 (heptad) pattern of hydrophobic repeats, designated
heptad repeats HRA and HRB can be found between the fusion peptide and the TM domain, with
approximately 250 aa apart from each other (Lamb and Parks, 2007). Biophysical data and
crystallographic studies have shown that HRA and HRB can form a helical hairpin or six-helix
bundle (6HB) structure (core trimer) in F protein homotrimers and this 6HB formation is tightly
linked to the merger of lipid bilayers and is believed to couple the free energy released on protein
refolding to membrane fusion (Melikyan et al., 2000; Russell et al., 2003) .
Attachment Protein
Attachment protein is another glycoprotein in Paramyxoviridae involved in cell
attachment process, which is also an integral membrane protein (Lamb and Parks, 2007). The
attachment protein of Respirovirus, Avulavirus and Rubulavirus binds to cellular sialic acid-
containing receptors and are capable of agglutinating erythrocytes. Besides, these attachment
proteins also have neuraminidase activity that cleaves sialic acid from the progeny virus particles
to prevent viral self-aggregation (Scheid and Choppin, 1974) and enable release of virions from
the cell membrane. Thus, the protein has been designated hemagglutinin-neuraminidase (HN).
HN is a type II membrane protein composed 565 to 582 residues that span the membrane once. It
20
contains an N-terminal cytoplasmic tail, a single N-terminal transmembrane domain (TM
domain), a membrane-proximal stalk domain that supports a C-terminal globular head domain.
The globular head domain contains both receptor binding and enzymatic activity (Hiebert et al.,
1985a). HN presents on the surface of virions and infects cells as a tetramer consisting of pairs of
homodimers (Thompson et al., 1988).
In Morbillivirus, attachment protein, H, can cause agglutination of primate erythrocytes
but lacks neuraminidase activity. This restricted host range, representative in measles virus for
primate cells, makes the sialic acid unlikely to be the primary receptor. It is now believed that
CD150, also known as signaling lymphocyte activation molecule (SLAM), is the principal
receptor for unadapted isolates of lymphotropic measles virus (Oldstone et al., 2002; Yanagi et
al., 2002). The attachment protein, G, in Henipavirus has neither hemagglutinating nor
neuraminidase activity. Ephrin B2 is considered as the cellular receptor for both HeV and NiV.
The widespread occurrence of ephrin B2 in vertebrates, particularly in arterial endothelial cells
and in neurons, provides an explanation for the wide host range of henipaviruses and their ability
to cause systemic infections (Eaton et al., 2006).
The Pneumovirus, RSV, does not cause detectable HA. The cellular receptor for RSV is
not completely understood yet, but it is believed that it involves interactions with heparan sulfate,
a glucosaminoglycan that is part of the extracellular matrix. The structure of G protein in
Pneumovirus is quite different from the attachment protein of Paramyxovirinae. Both membrane
bound and proteolytically cleaved soluble forms can be found in infected cells. Extensive
carbohydrate modification is one distinguishing feature of the G protein of RSV, which makes
the protein migration on SDS-PAGE with a dramatic increase in molecular weight than that of
21
the predicted polypeptide. These studies also show that G protein is not essential for virus
assembly or growth in tissue culture or animals, although, it does confer a growth advantage
(Lamb and Parks, 2007). Interestingly, the observation that G protein deletion mutant of RSV
and HN deleted virus-like particle (VLP) of SeV can infect cells via the asialoglycoprotein
receptor suggests that some paramyxovirus F proteins may also show binding activity (Leyrer et
al., 1998).
For most paramyxoviruses, the receptor binding protein (HN, N, or G) is required to
mediate the fusion reaction (Lamb et al., 2006; Morrison, 2003). The precise role of HN/N/G in
stimulating the F conformational change remains to be understood. However, HN may execute
its function by stabilizing the F prefusion stalk in a receptor-dependent manner (Lamb and Parks,
2007). Several models were studied to rationalize the involvement of HN in fusion promotion
(Lamb, 1993; Lamb and Parks, 2007). A model in NDV proposed a second sialic acid binding
site in addition to the active site (Crennell et al., 2000). The location of this new site at the HN
dimer interface, together with observation that changes in the HN structure that appear to be
generated by catalysis alters the association of the HN dimer or tetramer and may also propagate
a change in the stalk region that triggers the fusion protein, suggests a model for how sialic acid
binding by HN might trigger conformational changes in F (Zaitsev et al., 2004).
Other Envelope Proteins
The rubulaviruses PIV5 and mumps virus contain a small gene located between F and
HN genes, designated “small hydrophobic” (SH) gene (Hiebert et al., 1985b; Hiebert et al.,
22
1988). Mutants lacking SH of PIV5 is attenuated in vivo, and can induce apoptosis in L929 and
MDCK cells through a tumor necrosis factor alpha-mediated extrinsic apoptotic pathway (He et
al., 2001; Lin et al., 2003). Mumps SH may have a similar role as in PIV5 (Wilson et al., 2006).
Avian paramyxovirus type 6 (APMV6), a member in Avulavirus also contains the SH gene in its
genome. However, NDV and other members in the genus Avulavirus do not encode SH. NDV
was used to be classified in Rubulavirus. The presence of the SH gene in APMV6 to some extent
justifies the close relationship between this two genera and also suggests that APMV-6 might
play an intermediate role between the evolution of Avulavirus and members of the genus
Rubulavirus (Chang et al., 2001). Members of the Pneumovirinae also encode a SH protein,
however, it does not necessarily mean a commonality in function with Rubulavirus SH and the
role of SH in the RSV life cycle is not completely understood (Lamb and Parks, 2007). M2 gene,
encoding two partially overlapping ORFs, M2-1 and M2-2, can be found in members of the
Pneumovirinae and two more nonstructural proteins, NS1 and NS2, can be exclusively found in
RSVs. M2-1 and M2-2 play an important role in transcription and RNA replication
(Bermingham and Collins, 1999; Fearns and Collins, 1999) and NS1, NS2 show importance in
suppression of type I interferon induction and RNA synthesis (Atreya et al., 1998; Bossert et al.,
2003; Spann et al., 2004; Teng and Collins, 1999; Whitehead et al., 1999).
J-V possesses two unique proteins that are not observed in other paramyxoviruses.
Putative transmembrane protein (TM) is 258 aa long protein located between SH and G protein
genes in J-V genome (Jack et al., 2005). J-V “G” gene has an extraordinarily long putative 3’
UTR in which a second open reading frame (ORF), termed ORF-X, has been identified
commencing immediately after the stop codon for the putative G protein (Jack et al., 2005).
ORF-X encodes a putative protein of 704 aa within which the first methionine is the 30th aa
23
residue (Jack et al., 2005). No significant amino acid sequence homology was identified between
TM or X and other known proteins in sequence data banks by BLASTp search and this
sequencing based prediction need to be experimentally verified (Jack et al., 2005).
1.5.2 Strategy of replication
Paramyxoviruses encode and package their own RNA dependent RNA polymerase
(RdRP). The synthesis process is activated only after the virus being uncoated in the infected cell
and the replication occurs in the cytoplasm. In cell cultures, a single cycle of growth takes ~14-
30 hours for most paramyxoviruses, but with virulent NDV strains, this can be as short as 10
hours. Viral intracellular replication begins with viral RdRP packaged in the virion transcribing
the N encapsidated genome RNA into 5’ capped and 3’ polyadenylated mRNA. This virion RNA
being encapsidated with the N and associated with P and L proteins forms the transcriptase
complex which is the minimum transcriptional unit of paramyxovirus (Lamb and Parks, 2007).
The transcription signals are located at gene-start (GS) and gene-end (GE), which border
individual genes. Starting from the 3’ end of the genome, viral RdRP begins the transcription
process in a sequential manner to produce capped and polyadenylated viral mRNAs by
terminating and reinitiating at each gene junction, also known as a start-stop-restart mechanism.
A controlled attenuation of transcription occurs in each intergenic region, where a fraction of
elongating polymerases are released from the genomic templates, producing mRNA levels that
progressively decrease from N to L (Lamb and Parks, 2007), resulting in a transcriptional
gradient, commonly referred to as “polarity of transcription”. After primary transcription and
translation, as unassembled N protein accumulates, genomic RNA synthesis will be activated.
24
The RdRP will then ignore all the gene junctions to produce an exact complementary antigenome
chain in a fully assembled nucleocapsid.
1.6 Parainfluenza viruses
1.6.1 History of parainfluenzaviruses
Human parainfluenza virus contains 4 serotypes, hPIV1 to hPIV4. They were first
recovered from infants and children with lower or upper respiratory tract diseases, referred as
“croup associated” (CA) viruses at that time (Chanock, 1956; Chanock et al., 1958; Johnson et
al., 1960). The hPIV1, 2, and 3 viruses are second to human respiratory syncytial virus (hRSV)
as a common cause of lower respiratory tract disease in young children, which are major causes
of croup (hPIV1 to 3) and pneumonia bronchiolitis (hPIV3). However, hPIV4 causes less severe
disease at less frequency. Bovine parainfluenza virus type 3 is one of the major pathogens in
bovine shipping fever complex and it is a close relative of hPIV3.
Sendai virus (SeV) was first isolated from mice inoculated with an autopsy specimen
from an infant with respiratory disease and it appeared to be a murine relative of hPIV1 rather a
natural human pathogen. Simian virus 5 (SV5) and Simian virus 41 (SV41) were all originally
isolated from primary monkey kidney tissue culture (Hull et al., 1956; Nishio et al., 1990). Both
could be detected in a proportion of human population indicating capability for human infection.
SV5 can also cause croup in dogs and is a canine relative of hPIV2. However, SV41 shows more
close relationship to hPIV2 than SV5 in antigenic and structural properties (Tsurudome et al.,
1990).
25
Newcastle Disease was recognized as an emerging poultry disease in Indonesia and
England in 1926 (Doyle, 1927) and is now known as serotype 1 of nine distinct serotypes
(Alexander, 1982; Alexander et al., 1983) of avian PIV (now redesignated avian
paramyxoviruses (APMV)). Besides, mumps virus was also historically considered as a member
of PIV group due to the morphologic and antigenic relativities. These viruses were classified in
a single genus historically and then identified into distinguished genera after the addition of
related viruses and molecular confirmation. Nowadays, it is widely acknowledged that within
PIV group there are two divisions of mammalian PIV genera: Respirovirus and Rubulavirus, and
one avian viruses genus Avulavirus (Ruth A. Karron, 2007).
1.6.2 Bovine parainfluenzavirus type 3
1.6.2.1 bPIV3 as a pathogen
bPIV3 is a respiratory pathogen associated with bronchopneumonia in cattle and it is one
of the important pathogens of the bovine respiratory disease syndrome called “shipping fever”,
which causes severe economic losses to the cattle industry in North America and other parts of
the world. Clinical signs of shipping fever include rapid fever, respiratory symptoms, nasal
discharge, cough, lacrimation, conjunctivitis and inappetence (Andrewes et al., 1959; Reisinger
et al., 1959). bPIV3 can be isolated from clinically normal cattle, (Reisinger et al., 1959). Gross
lesions in cattle experimentally infected with bPIV3 include consolidation of the anteroventral
portions of the lungs (Bryson et al., 1979; Marshall and Frank, 1975), congestion of respiratory
mucosa, and enlargement of the bronchial and retropharyngeal lymph nodes (Marshall and
26
Frank, 1975). Mononuclear and polymorphonuclear cells and multinucleated giant cell can be
observed in affected lung lobes by histopathologic study (Tsai and Thomson, 1975). It is
generally accepted that co-infection of bPIV3 along with other viruses and
Mannheimia/Pasturella species in addition to a variety of other factors as environmental
temperature, transportation, hygiene, stocking density, co-mingling and host immune status
could cause shipping fever and can contribute to increased susceptibility to secondary bacterial
infection and severity of clinical disease (Battrell, 1995; Woods, 1968).
1.6.2.2 Cross-species infection of bPIV3
PIV3 infections have been serologically demonstrated in a wide variety of mammals
including cattle, human, sheep (Lyon et al., 1997), goats (Yener et al., 2005), bison (Zarnke and
Erickson, 1990), guinea pigs (Ohsawa et al., 1998), black and white rhinoceros (Fischer-
Tenhagen et al., 2000), moose (Thorsen and Henderson, 1971), bighorn sheep (Parks et al.,
1972) and camels (Eisa et al., 1979). A novel parainfluenza virus isolated from bottlenose
dolphin (Nollens et al., 2008) was phylogenetically closely related to PIV3.
Besides, cross-species infection has also been reported in numerous instances, including
hPIV3-GPv isolated from lung homogenates of sentinel guinea pigs placed together with
seropositive asymptomatic individuals (Ohsawa et al., 1998), and bPIV3 in a child experiencing
pneumonia (Ben-Ishai et al., 1980). bPIV3 in lambs can cause rapid, shallow respiration,
dyspnea and sporadic coughing (Stevenson and Hore, 1970). No respiratory signs were observed
in calves experimentally infected with ovine PIV3 (Stevenson and Hore, 1970). Macroscopic
27
lesions of pneumonia were present in bPIV3 inoculated lambs and ovine PIV3 inoculated calves
(Stevenson and Hore, 1970).
1.6.2.3 Virion Structure and Genome organization
PIV3 has spherical to pleiomorphic virions of approximately 150-200 nm in diameter and
morphologically indistinguishable from paramyxoviruses (Karron and Collins, 2007). The
genetic organization of bPIV3 is very similar to hPIV3, composed of 6 genes in the order of 3’-
N-P-M-F-HN-L-5’, and the overall length and nt and amino acid sequences are also broadly
conserved among PIV3 viruses. There is a high degree of identity between bPIV3 and hPIV3,
ranging from 58.6% for P protein to 89.7% for M protein (Bailly et al., 2000). They also share
extensive sequence identity in their cis-acting noncoding regulatory elements, 3’ leader (86.3%),
5’ trailer (93.2%) and trinucleotide intergenic sequence (100%). All bPIV3 and hPIV3 have a
semi-conserved gene-start sequence and semi-conserved U-rich gene-end sequence.
Interestingly, majority of variable amino acid residues found in bPIV3 and hPIV3 showed
polymorphisms, either showing host specific or variable within the species at the given position
(Bailly et al., 2000; Coelingh and Winter, 1990; Swierkosz et al., 1995). These residues might be
products of distinct selective pressures during PIV3 evolution in their respective host. The host-
specific sequences are likely responsible for the host range differences and growth efficiency in
different hosts. Using reverse genetics to import these sequences from bPIV3 into hPIV3 was
shown to be very useful in the development of vaccines (Bailly et al., 2000).
28
The complete nucleotide sequence for four isolates of bPIV3 has previously been
determined (Bailly et al., 2000; Horwood et al., 2008; Sakai et al., 1987; Suzu et al., 1987). With
the increasing availability of the sequence information, two distinct bPIV3 genotypes were
proposed, designated as bPIV3-a and bPIV3-b (Horwood et al., 2008). However, the genotype b
is an isolated variant lineage that has only been identified in Australia and could hypothetically
be a lineage from a strain that recently crossed from another host species into cattle (Horwood et
al., 2008). The newly identified genotypes have implications for the development of bPIV3
molecular detection methods and may also impact on bPIV3 vaccine formulations.
1.6.2.4 Antigenic relatedness with other parainfluenzaviruses
bPIV3 and hPIV3 shared approximately 25% antigenic relatedness. The Kansas/1562/84
(Ka) and Shipping Fever (SF) strains of bPIV3 replicated 100 to 1000 times less efficiently than
hPIV3 in the upper and lower respiratory tract of rhesus monkeys and chimpanzees compared
with hPIV3 (van Wyke Coelingh et al., 1988). Thus, bPIV3 was evaluated as a live vaccine
against hPIV3. The bPIV3-Ka strain was highly attenuated in humans and was used in clinical
trials as a candidate vaccine against hPIV3 (Karron et al., 1996). Although intranasally
administered bPIV3 vaccine gave seroconversion rate to bPIV3 (57–65%), it did not give a
robust response to the heterotypic human strain. However, bPIV3 vaccine being used as an
attenuated backbone for insertion of human PIV3 HN and F proteins and F protein of RSV is
promising and the effectiveness of this vaccine against both PIV3 and RSV challenge has been
demonstrated in African green monkeys (Sato and Wright, 2008).
29
Monoclonal antibodies (Mabs) were used to identify the antigenic properties of hPIV3
and bPIV3 (Coelingh et al., 1986; van Wyke Coelingh et al., 1985). HI-Mabs, which are Mabs
that have HI and neutralizing activities, can define 11 operationally unique HN epitopes which
are organized into two topologically nonoverlapping antigenic sites (A and B) and a third
bridging site (C) (van Wyke Coelingh et al., 1985). Using HN-Mabs, which has no known
biological activity, three more sites (D to F) were identified (Coelingh et al., 1986). Two
epitopes in site A and all epitopes in sites D and F are highly conserved among human clinical
isolates examined as well as bovine strains (Coelingh et al., 1986). Nucleotide substitutions in
the HN genes of antigenic variants selected with NI-Mabs were identified representing epitopes
in site A, which are shared by human and bovine PIV3. The deduced amino acid substitutions in
the variants were located in separate hydrophilic stretches of HN residues which are conserved in
the primary structures of the HN proteins of both human and bovine PIV3 strains (Coelingh et
al., 1986).
1.6.2.5 Diagnostic methods for bPIV3
A diagnosis of bPIV3 requires laboratory confirmation. Virus may be isolated when
animals that are in the incubation or acute phases of infection are sampled. In live animals, virus
can be isolated from nasopharyngeal swabs or broncho-alveolar washings, and in dead animals,
from the lungs and trachea and their associated lymph nodes. The virus can be grown in a variety
of cell cultures, such as bovine and ovine fetal lung, kidney and testis, and as well as in cell lines,
such as MDBK and RK-13. Cytopathic effects are characterized by syncytia, intracytoplasmic
and intranuclear inclusion bodies and cell destruction. Antigen detection methods such as
30
immunofluorescence, immunoperoxidase staining or enzyme immunoassay can be used (Haines
et al., 1992). RT-PCR-based diagnostic tests enable accurate and timely detection of bPIV3 from
nasopharyngeal swabs. Seroconversion can be detected 7-10 days following the onset of clinical
signs by HI or virus neutralization or plaque reduction tests.
1.7 Swine Paramyxoviruses
1.7.1 History
The first record of the outbreak of one of two swine paramyxoviruses, ISU92, was
described by Janke et al. (1992). A group of 400 pigs in a continuous-flow finishing barn showed
signs of respiratory and CNS disease. Sick pigs showed mild cough with temperature from 103
to 104.5 °F. Injectable dexamethasone and tylosin were administered and total of seventeen pigs
died within four days after the first appearance of clinical signs. Continued treatment with a
combination of penicillin, dexamethasone, spectinomycin and atropine were used and no more
deaths occurred. Wet, heavy, congested lungs with small areas of consolidation on the ventral
tips of the lung lobes were observed at necropsy.
The disease continued to spread throughout the operation and infected the second
finishing all-in/all-out unit. The entire 400 pigs in the finishing barn were infected within a few
days. Severe dyspnea, coughing and CNS disturbance were observed. Several sick pigs showed
persistent squealing, head pressing, whole body tremors, and hind-limb ataxia (Janke et al.,
2001). In the breeding, farrowing, nursery and grower buildings, located ¼ mile north of the
finishing barns, nursery age pigs showed dyspnea and less cough than finishing pigs; clinical
31
signs in nursing piglets in farrowing barn were more severe; the grower buildings were only mild
affected; few sows and gilts became dyspneic, two or three abortions and two premature
farrowing occurred, however, the cause was not investigated. Injectable antimicrobials were
administered to all affected pigs immediately after first onset of clinical signs and there were no
more death losses due to the outbreak (Janke et al., 2001).
1.7.2 Laboratory Examination
Two live pigs from the second finishing barn were sent to the Veterinary Diagnostic
Laboratory of Iowa State University. CNS disorder was the major signs observed similar to those
seen during the first outbreak. Pigs exhibited depression, whole body tremors, continuous
squealing, and rear-end ataxia. No respiratory symptoms were observed. 20% of lung volume
showed bilateral consolidation on ventral portions of cranial and middle lung lobes. No gross
lesions were noticeable in brain or other internal organs. In histopathologic examination,
moderate to severe bronchointerstitial pneumonia with thickening of alveolar septa containing
mixed inflammatory cells and swollen pneumocytes and endothelial cells were observed. Mild
diffuse gliosis and widespread, mild lymphocytic perivasculitis were seen in brain from both
pigs.
No pseudorabies (PRV), Swine influenza virus (SIV), porcine reproductive and
respiratory syndrome virus (PRRSV), porcine respiratory coronavirus (PRCV) were detected by
either virus isolation or fluorescent antibody test. No significant bacteria were recovered from
the collected tissue samples. Paramyxo-like virus particles were isolated from fetal porcine
32
kidney (FPK) cell culture, which was inoculated with a pooled tissue homogenates. Cytopathic
effect (CPE) was observed in infected cell cultures from second passage onwards (Janke et al.,
2001).
1.7. 3 Pathogenicity studies
Specific pathogen free (SPF) pigs were inoculated with the lung homogenate
(Battrell,1995). No clinical illness, gross or microscopic lesions were observed. No antibody
against ISU92 was detected in the serum of before inoculation or at necropsy. Experimental
inoculation of three-day-old gnotobiotic piglets with cell-culture propagated ISU-92 showed
temporary and slight increase of rectal temperature in some infected pigs. Irregular tan-gray
discoloration was observed in the lung lobes of infected pigs. Lungs with thickened alveolar
septa and proliferation of pneumocytes and brain with glial nodules were observed on
microscopic examination (Janke et al., 2001).
1.7.4 Prevalence studies
To identify the extent of prevalence of swine paramyxoviruses in USA, a virus
neutralization test was developed (Battrell, 1995). Antibodies against ISU92 strain were detected
in the serum of SPF pigs experimentally infected with ISU92 by 7 days post inoculation (DPI),
and remained at detectable levels for the duration of the trial, 24 weeks PI. A seroprevalence
study was performed with 876 serum samples collected from 36 swine farms in Iowa between
33
1988 and 1989. Only 6 samples, representing 5 swine herds, were shown to have anti-ISU92
antibody titers and the seroprevalence of sPMV was believed to be very low (Battrell, 1995).
1.7.5 Texas81 history
Texas81 virus was isolated from the brain of pigs that exhibited respiratory and
neurological disease in Texas State, in 1981 (cited in (Janke et al., 2001). Further information on
the history of this virus is not available.
1.8 Paramyxoviruses as vaccine vector
The first reverse genetic system of nonsegmented negative-strand RNA viruses (NNSV)
was established in 1994, recovering infectious rabies virus from cloned cDNA (Schnell et al.,
1994) (Figure 2). This milestone event made it possible to explore the great potential of NNSVs
to be developed as vaccine vectors (Bukreyev et al., 2006). NNSV as vaccine vectors have many
advantages to become promising viral vector candidates. First, a large number of well-
understood NNSVs belong to this group, such as NDV, and Vesicular stomatitis virus (VSV).
Some of them have the host range restrictively exclusive in human or much attenuated in
primates making them widely acceptable for immunization in human population (Bukreyev et
al., 2006). Many NNSV can induce cell-mediated protective immune responses, systemic IgG
antibody as well as effective local IgA immune response via intranasal infection. Therefore, the
vaccines could be intranasally administrated which will be safer and easier during an epidemic
34
and especially superb in respiratory tract infection, such as SARS and influenza (Bukreyev et al.,
2006). Due to the nature of NNSV replication strategy and genome organization, the possibility
of vaccine genome integrating into host genome and recombination between vaccine and
circulating viruses is extremely low (Bukreyev et al., 2006).
Three strategies were generally used (Figure 3): (i) Wild-type NNSV expressing foreign
genes. Insert a foreign gene into a wild-type NNSV, which is either a naturally attenuated due to
the host range restriction or a genetically engineered mutant. (ii) Antigenic chimeric viruses. A
construct of the chimeric virus use foreign gene/genes in a pathogenic virus to replace the major
protective surface antigen (s) of the vector. (iii) Antigenic chimeric virus expressing additional
foreign gene/genes. It is a combination of the first two strategies that are commonly employed to
produce bivalent vaccines (Bukreyev et al., 2006).
Antigenic chimeric virus B/HPIV3 is an example of application of the second strategy. It
uses bPIV3-Ka, attenuated in human due to the host range restriction (Bailly et al., 2000;
Skiadopoulos et al., 2003a; van Wyke Coelingh et al., 1988), as vector backbone with the
replacement of F and HN glycoprotein from hPIV3, and has been evaluated clinically by the
National Institutes of Allergy and Infectious Diseases as vaccine against hPIV3 (Haller et al.,
2000; Pennathur et al., 2003). Besides, bPIV3 as backbone for replaced F and HN of hPIV3 and
inserted F of RSV was also constructed. The effectiveness of this vaccine against both PIV3 and
RSV challenge has been demonstrated in African green monkeys and is being evaluated in
clinical trials (Sato and Wright, 2008).
35
1.9 Objectives
As new viruses emerge that cause severe disease in pigs and have the potential to cross
species barrier and infect other hosts including humans, it is important that these new viruses
need to be studied further. As a NNSV, the sPMV could be developed as a vaccine vector for
many swine pathogens and even for other species. Understanding the significance of these two
strains of sPMV for swine health and their molecular characterization are the essential steps to
reach these goals. Therefore, the objective of this study is to undertake the biological and
molecular characterizations of these two novel paramyxoviruses, and to study their pathogenicity
in conventionally reared pigs, thus to establish a foundation for development of a reverse
genetics system. Our longterm goal is to develop them into vaccine vectors using the reverse
genetics system.
Objectives:
1. To undertake biological and molecular characterization of two strains of novel swine
paramyxoviruses.
2. To examine the pathogenicity of the two viruses in conventionally reared pigs.
36
1.10 References
Alexander, D. J. (1982). "Avian paramyxoviruses-other than Newcastle disease virus." World's
Poultry Sci J(38): 97-104.
Alexander, D. J., V. S. Hinshaw, et al. (1983). "Characterization of viruses which represent
further distinct serotypes (PMV-8 and PMV-9) of avian paramyxoviruses." Arch Virol
78(1-2): 29-36.
Andrejeva, J., E. Poole, et al. (2002). "The p127 subunit (DDB1) of the UV-DNA damage repair
binding protein is essential for the targeted degradation of STAT1 by the V protein of the
paramyxovirus simian virus 5." J Virol 76(22): 11379-86.
Andrewes, C. H., F. B. Bang, et al. (1959). "Para-influenza viruses 1, 2, and 3: suggested names
for recently described myxoviruses." Virology 8(1): 129-30.
Appel, M. J. (1969). "Pathogenesis of canine distemper." Am J Vet Res 30(7): 1167-82.
Appel, M. J. (1970). "Distemper pathogenesis in dogs." J Am Vet Med Assoc 156(12): 1681-4.
Appel, M. J. and D. H. Percy (1970). "SV-5-like parainfluenza virus in dogs." J Am Vet Med
Assoc 156(12): 1778-81.
Archetti, I. and F. L. Horsfall, Jr. (1950). "Persistent antigenic variation of influenza A viruses
after incomplete neutralization in ovo with heterologous immune serum." J Exp Med
92(5): 441-62.
Arita, M., Y. Ueno, et al. (1981). "Complete heart block in mumps myocarditis." Br Heart J
46(3): 342-4.
Atreya, P. L., M. E. Peeples, et al. (1998). "The NS1 protein of human respiratory syncytial virus
is a potent inhibitor of minigenome transcription and RNA replication." J Virol 72(2):
1452-61.
37
Azimi, P. H., H. G. Cramblett, et al. (1969). "Mumps meningoencephalitis in children." JAMA
207(3): 509-12.
Bailly, J. E., J. M. McAuliffe, et al. (2000). "Sequence determination and molecular analysis of
two strains of bovine parainfluenza virus type 3 that are attenuated for primates." Virus
Genes 20(2): 173-82.
Baker, K. A., R. E. Dutch, et al. (1999). "Structural basis for paramyxovirus-mediated membrane
fusion." Mol Cell 3(3): 309-19.
Banerjee, A. K. and S. Barik (1992). "Gene expression of vesicular stomatitis virus genome
RNA." Virology 188(2): 417-28.
Baron, M. D. and T. Barrett (2000). "Rinderpest viruses lacking the C and V proteins show
specific defects in growth and transcription of viral RNAs." J Virol 74(6): 2603-11.
Bart, M., F. Guscetti, et al. (2000). "Feline infectious pneumonia: a short literature review and a
retrospective immunohistological study on the involvement of Chlamydia spp. and
distemper virus." Vet J 159(3): 220-30.
Basler, C. F., A. Garcia-Sastre, et al. (2005). "A novel paramyxovirus?" Emerg Infect Dis 11(1):
108-12.
Battrell, M. A. (1995). Cultivation, preliminary characterization, and prevalence in swine herds
of porcine paramyxovirus. Veterinary Clinical Sciences. Ames, Iowa State University.
Master of Science: 74.
Baumgartner, W. K., S. Krakowka, et al. (1982). "Acute encephalitis and hydrocephalus in dogs
caused by canine parainfluenza virus." Vet Pathol 19(1): 79-92.
38
Baumgartner, W. K., S. Krakowka, et al. (1982). "Ultrastructural evaluation of the acute
encephalitis and hydrocephalus in dogs caused by canine parainfluenza virus." Vet Pathol
19(3): 305-14.
Ben-Ishai, Z., V. Naftali, et al. (1980). "Human infection by a bovine strain of parainfluenza
virus type 3." J Med Virol 6(2): 165-8.
Bermingham, A. and P. L. Collins (1999). "The M2-2 protein of human respiratory syncytial
virus is a regulatory factor involved in the balance between RNA replication and
transcription." Proc Natl Acad Sci U S A 96(20): 11259-64.
Biron, C. A. and G. C. Sen (2007). Innate Responses to Viral Infections. Fields virology. D. M.
Knipe, P. M. Howley, D. E. Griffinet al. Philadelphia, Lippincott Williams & Wilkins.
One: 249-278.
Bistrian, B., C. A. Phillips, et al. (1972). "Fatal mumps meningoencephalitis. Isolation of virus
premortem and postmortem." JAMA 222(4): 478-9.
Blom, N., S. Gammeltoft, et al. (1999). "Sequence and structure-based prediction of eukaryotic
protein phosphorylation sites." J Mol Biol 294(5): 1351-62.
Blumberg, B. M., K. Rose, et al. (1984). "Analysis of the Sendai virus M gene and protein." J
Virol 52(2): 656-63.
Bossert, B., S. Marozin, et al. (2003). "Nonstructural proteins NS1 and NS2 of bovine respiratory
syncytial virus block activation of interferon regulatory factor 3." J Virol 77(16): 8661-8.
Bowden, T. R. and D. B. Boyle (2005). "Completion of the full-length genome sequence of
Menangle virus: characterisation of the polymerase gene and genomic 5' trailer region."
Arch Virol 150(10): 2125-37.
39
Breker-Klassen, M. M., D. Yoo, et al. (1996). "Comparisons of the F and HN gene sequences of
different strains of bovine parainfluenza virus type 3: relationship to phenotype and
pathogenicity." Can J Vet Res 60(3): 228-36.
Brooksby, J. B. (1967). Variants and immunity: definitions for serological investigation.
International Symposium on foot-and-mouth disease: variants and immunity, Lyon,
France.
Brugh, M. and C. W. Beard (1984). "Atypical disease produced in chickens by Newcastle
disease virus isolated from exotic birds." Avian Dis 28(2): 482-8.
Bryson, D. G., M. S. McNulty, et al. (1979). "The experimental production of pneumonia in
calves by intranasal inoculation of parainfluenza type III virus." Vet Rec 105(25-26):
566-73.
Bukreyev, A., M. H. Skiadopoulos, et al. (2006). "Nonsegmented negative-strand viruses as
vaccine vectors." J Virol 80(21): 10293-306.
Calain, P. and L. Roux (1993). "The rule of six, a basic feature for efficient replication of Sendai
virus defective interfering RNA." J Virol 67(8): 4822-30.
Carbone, K. M. and S. Rubin (2007). Mumps Virus. Fields virology. D. M. Knipe, P. M.
Howley, D. E. Griffinet al. Philadelphia, Lippincott Williams & Wilkins. One: 1527-
1550.
Cassel, W. A. and R. E. Garrett (1965). "Newcastle Disease Virus as an Antineoplastic Agent."
Cancer 18: 863-8.
Cathomen, T., H. Y. Naim, et al. (1998). "Measles viruses with altered envelope protein
cytoplasmic tails gain cell fusion competence." J Virol 72(2): 1224-34.
40
Chadha, M. S., J. A. Comer, et al. (2006). "Nipah virus-associated encephalitis outbreak,
Siliguri, India." Emerg Infect Dis 12(2): 235-40.
Chang, P. C., M. L. Hsieh, et al. (2001). "Complete nucleotide sequence of avian paramyxovirus
type 6 isolated from ducks." J Gen Virol 82(Pt 9): 2157-68.
Chanock, R. M. (1956). "Association of a new type of cytopathogenic myxovirus with infantile
croup." J Exp Med 104(4): 555-76.
Chanock, R. M., R. H. Parrott, et al. (1958). "Newly recognized myxoviruses from children with
respiratory disease." N Engl J Med 258(5): 207-13.
Chant, K., R. Chan, et al. (1998). "Probable human infection with a newly described virus in the
family Paramyxoviridae. The NSW Expert Group." Emerg Infect Dis 4(2): 273-5.
Chattopadhyay, A. and M. S. Shaila (2004). "Rinderpest virus RNA polymerase subunits:
mapping of mutual interacting domains on the large protein L and phosphoprotein p."
Virus Genes 28(2): 169-78.
Chua, K. B., W. J. Bellini, et al. (2000). "Nipah virus: a recently emergent deadly
paramyxovirus." Science 288(5470): 1432-5.
Chua, K. B., K. J. Goh, et al. (1999). "Fatal encephalitis due to Nipah virus among pig-farmers in
Malaysia." Lancet 354(9186): 1257-9.
Chua, K. B., L. F. Wang, et al. (2001). "Tioman virus, a novel paramyxovirus isolated from fruit
bats in Malaysia." Virology 283(2): 215-29.
Chua, K. B., L. F. Wang, et al. (2002). "Full length genome sequence of Tioman virus, a novel
paramyxovirus in the genus Rubulavirus isolated from fruit bats in Malaysia." Arch Virol
147(7): 1323-48.
41
Clark, H. F., F. S. Lief, et al. (1979). "Fer de Lance virus (FDLV): a probable paramyxovirus
isolated from a reptile." J Gen Virol 44(2): 405-18.
Coelingh, K. J., C. C. Winter, et al. (1986). "Conserved epitopes on the hemagglutinin-
neuraminidase proteins of human and bovine parainfluenza type 3 viruses: nucleotide
sequence analysis of variants selected with monoclonal antibodies." J Virol 60(1): 90-6.
Coelingh, K. V. and C. C. Winter (1990). "Naturally occurring human parainfluenza type 3
viruses exhibit divergence in amino acid sequence of their fusion protein neutralization
epitopes and cleavage sites." J Virol 64(3): 1329-34.
Coleman, N. A. and M. E. Peeples (1993). "The matrix protein of Newcastle disease virus
localizes to the nucleus via a bipartite nuclear localization signal." Virology 195(2): 596-
607.
Crennell, S., T. Takimoto, et al. (2000). "Crystal structure of the multifunctional paramyxovirus
hemagglutinin-neuraminidase." Nat Struct Biol 7(11): 1068-74.
Cross, G. M. (1991). "Newcastle disease." Vet Clin North Am Small Anim Pract 21(6): 1231-9.
Curran, J., M. de Melo, et al. (1991). "Characterization of the Sendai virus V protein with an
anti-peptide antiserum." Virology 184(1): 108-16.
Curran, J., J. B. Marq, et al. (1995). "An N-terminal domain of the Sendai paramyxovirus P
protein acts as a chaperone for the NP protein during the nascent chain assembly step of
genome replication." J Virol 69(2): 849-55.
Delenda, C., S. Hausmann, et al. (1997). "Normal cellular replication of Sendai virus without the
trans-frame, nonstructural V protein." Virology 228(1): 55-62.
42
Durbin, A. P., J. M. McAuliffe, et al. (1999). "Mutations in the C, D, and V open reading frames
of human parainfluenza virus type 3 attenuate replication in rodents and primates."
Virology 261(2): 319-30.
Eaton, B. T., C. C. Broder, et al. (2006). "Hendra and Nipah viruses: different and dangerous."
Nat Rev Microbiol 4(1): 23-35.
Eisa, M., A. E. Karrar, et al. (1979). "The occurrence of antibodies to parainfluenza3 virus in
sera of some domestic animals of the Sudan." Br Vet J 135(2): 192-7.
Elankumaran, S., D. Rockemann, et al. (2006). "Newcastle disease virus exerts oncolysis by both
intrinsic and extrinsic caspase-dependent pathways of cell death." J Virol 80(15): 7522-
34.
Ellis, J., L. Hassard, et al. (1998). "Isolation of circovirus from lesions of pigs with postweaning
multisystemic wasting syndrome." Can Vet J 39(1): 44-51.
Evermann, J. F., J. D. Lincoln, et al. (1980). "Isolation of a paramyxovirus from the
cerebrospinal fluid of a dog with posterior paresis." J Am Vet Med Assoc 177(11): 1132-
4.
Fearns, R. and P. L. Collins (1999). "Role of the M2-1 transcription antitermination protein of
respiratory syncytial virus in sequential transcription." J Virol 73(7): 5852-64.
Feldstein, J. D., F. R. Johnson, et al. (1974). "Acute hemorrhagic pancreatitis and pseudocyst due
to mumps." Ann Surg 180(1): 85-8.
Ferraris, O., N. Kessler, et al. (2005). "Sensitivity of influenza viruses to zanamivir and
oseltamivir: a study performed on viruses circulating in France prior to the introduction
of neuraminidase inhibitors in clinical practice." Antiviral Res 68(1): 43-8.
43
Field, H. E., A. C. Breed, et al. (2007). "Epidemiological perspectives on Hendra virus infection
in horses and flying foxes." Aust Vet J 85(7): 268-70.
Field, H. E., J. S. Mackenzie, et al. (2007). "Henipaviruses: emerging paramyxoviruses
associated with fruit bats." Curr Top Microbiol Immunol 315: 133-59.
Fischer-Tenhagen, C., C. Hamblin, et al. (2000). "Serosurvey for selected infectious disease
agents in free-ranging black and white rhinoceros in Africa." J Wildl Dis 36(2): 316-23.
Franke, J., S. Essbauer, et al. (2001). "Identification and molecular characterization of 18
paramyxoviruses isolated from snakes." Virus Res 80(1-2): 67-74.
Fukuhara, N., C. Huang, et al. (2002). "Mutational analysis of the Sendai virus V protein:
importance of the conserved residues for Zn binding, virus pathogenesis, and efficient
RNA editing." Virology 299(2): 172-81.
Galinski, M. S., R. M. Troy, et al. (1992). "RNA editing in the phosphoprotein gene of the
human parainfluenza virus type 3." Virology 186(2): 543-50.
Garcin, D., J. Curran, et al. (2001). "Longer and shorter forms of Sendai virus C proteins play
different roles in modulating the cellular antiviral response." J Virol 75(15): 6800-7.
Garcin, D., M. Itoh, et al. (1997). "A point mutation in the Sendai virus accessory C proteins
attenuates virulence for mice, but not virus growth in cell culture." Virology 238(2): 424-
31.
Garcin, D., J. B. Marq, et al. (2002). "All four Sendai Virus C proteins bind Stat1, but only the
larger forms also induce its mono-ubiquitination and degradation." Virology 295(2): 256-
65.
Gardner, A. E. and R. E. Dutch (2007). "A conserved region in the F(2) subunit of
paramyxovirus fusion proteins is involved in fusion regulation." J Virol 81(15): 8303-14.
44
Garten, W., W. Berk, et al. (1980). "Mutational changes of the protease susceptibility of
glycoprotein F of Newcastle disease virus: effects on pathogenicity." J Gen Virol 50(1):
135-47.
Glaser, A. L., R. W. Renshaw, et al. (2002). "Isolation of Salem virus, a novel equine
paramyxovirus, and assessment of its etiologic role in a disease outbreak." Vet Microbiol
87(3): 205-12.
Gordon, S. C. and C. B. Lauter (1984). "Mumps arthritis: a review of the literature." Rev Infect
Dis 6(3): 338-44.
Gotoh, B., K. Takeuchi, et al. (2003). "The STAT2 activation process is a crucial target of
Sendai virus C protein for the blockade of alpha interferon signaling." J Virol 77(6):
3360-70.
Grdzelishvili, V. Z., S. Smallwood, et al. (2005). "A single amino acid change in the L-
polymerase protein of vesicular stomatitis virus completely abolishes viral mRNA cap
methylation." J Virol 79(12): 7327-37.
Greig, A. S., C. M. Johnson, et al. (1971). "Encephalomyelitis of swine caused by a
haemagglutinating virus. VI. Morphology of the virus." Res Vet Sci 12(4): 305-7.
Haines, D. M., J. C. Kendall, et al. (1992). "Monoclonal and polyclonal antibodies for
immunohistochemical detection of bovine parainfluenza type 3 virus in frozen and
formalin-fixed paraffin-embedded tissues." J Vet Diagn Invest 4(4): 393-9.
Haller, A. A., T. Miller, et al. (2000). "Expression of the surface glycoproteins of human
parainfluenza virus type 3 by bovine parainfluenza virus type 3, a novel attenuated virus
vaccine vector." J Virol 74(24): 11626-35.
45
Hamaguchi, M., T. Yoshida, et al. (1983). "Transcriptive complex of Newcastle disease virus. I.
Both L and P proteins are required to constitute an active complex." Virology 128(1):
105-17.
Harcourt, B. H., A. Tamin, et al. (2001). "Molecular characterization of the polymerase gene and
genomic termini of Nipah virus." Virology 287(1): 192-201.
Hausmann, S., D. Garcin, et al. (1999). "The versatility of paramyxovirus RNA polymerase
stuttering." J Virol 73(7): 5568-76.
He, B., G. Y. Lin, et al. (2001). "The SH integral membrane protein of the paramyxovirus simian
virus 5 is required to block apoptosis in MDBK cells." J Virol 75(9): 4068-79.
He, B., R. G. Paterson, et al. (2002). "Recovery of paramyxovirus simian virus 5 with a V
protein lacking the conserved cysteine-rich domain: the multifunctional V protein blocks
both interferon-beta induction and interferon signaling." Virology 303(1): 15-32.
Heinen, E., W. Herbst, et al. (1998). "Isolation of a cytopathogenic virus from a case of porcine
reproductive and respiratory syndrome (PRRS) and its characterization as parainfluenza
virus type 2." Arch Virol 143(11): 2233-9.
Hiebert, S. W., R. G. Paterson, et al. (1985). "Hemagglutinin-neuraminidase protein of the
paramyxovirus simian virus 5: nucleotide sequence of the mRNA predicts an N-terminal
membrane anchor." J Virol 54(1): 1-6.
Hiebert, S. W., R. G. Paterson, et al. (1985). "Identification and predicted sequence of a
previously unrecognized small hydrophobic protein, SH, of the paramyxovirus simian
virus 5." J Virol 55(3): 744-51.
Hiebert, S. W., C. D. Richardson, et al. (1988). "Cell surface expression and orientation in
membranes of the 44-amino-acid SH protein of simian virus 5." J Virol 62(7): 2347-57.
46
Horikami, S. M., J. Curran, et al. (1992). "Complexes of Sendai virus NP-P and P-L proteins are
required for defective interfering particle genome replication in vitro." J Virol 66(8):
4901-8.
Horikami, S. M., S. Smallwood, et al. (1996). "The Sendai virus V protein interacts with the NP
protein to regulate viral genome RNA replication." Virology 222(2): 383-90.
Horvath, C. M., R. G. Paterson, et al. (1992). "Biological activity of paramyxovirus fusion
proteins: factors influencing formation of syncytia." J Virol 66(7): 4564-9.
Horwood, P. F., J. L. Gravel, et al. (2008). "Identification of two distinct bovine parainfluenza
virus type 3 genotypes." J Gen Virol 89(Pt 7): 1643-8.
Hosaka, M., M. Nagahama, et al. (1991). "Arg-X-Lys/Arg-Arg motif as a signal for precursor
cleavage catalyzed by furin within the constitutive secretory pathway." J Biol Chem
266(19): 12127-30.
Hsu, V. P., M. J. Hossain, et al. (2004). "Nipah virus encephalitis reemergence, Bangladesh."
Emerg Infect Dis 10(12): 2082-7.
Hull, R. N., J. R. Minner, et al. (1956). "New viral agents recovered from tissue cultures of
monkey kidney cells. I. Origin and properties of cytopathogenic agents S.V.1, S.V.2,
S.V.4, S.V.5, S.V.6, S.V.11, S.V.12 and S.V.15." Am J Hyg 63(2): 204-15.
Jack, P. J., D. B. Boyle, et al. (2005). "The complete genome sequence of J virus reveals a
unique genome structure in the family Paramyxoviridae." J Virol 79(16): 10690-700.
Jacobson, E., J. M. Gaskin, et al. (1981). "Illness associated with paramyxo-like virus infection
in a zoologic collection of snakes." J Am Vet Med Assoc 179(11): 1227-30.
Jacobson, E., J. M. Gaskin, et al. (1980). "Paramyxo-like virus infection in a rock rattlesnake." J
Am Vet Med Assoc 177(9): 796-9.
47
Janke, B. H., P. S. Paul, et al. (2001). "Paramyxovirus infection in pigs with interstitial
pneumonia and encephalitis in the United States." J Vet Diagn Invest 13(5): 428-33.
Johnson, K. M., R. M. Chanock, et al. (1960). "Studies of a new human hemadsorption virus. I.
Isolation, properties and characterization." Am J Hyg 71: 81-92.
Jorgensen, E. D., P. L. Collins, et al. (1987). "Cloning and nucleotide sequence of Newcastle
disease virus hemagglutinin-neuraminidase mRNA: identification of a putative sialic acid
binding site." Virology 156(1): 12-24.
Jun, M. H., N. Karabatsos, et al. (1977). "A new mouse paramyxovirus (J virus)." Aust J Exp
Biol Med Sci 55(6): 645-7.
Kahn, C. M. and S. Line, Eds. (2005). The Merck Veterinary Manual, Merck; 9 edition
(February 8, 2005).
Kapil, S., R. W. Allison, et al. (2008). "Canine distemper virus strains circulating among North
American dogs." Clin Vaccine Immunol 15(4): 707-12.
Karabatsos, N. (1985). International Catalogue of Arboviruses. San Antonio, Texas, American
Society of Tropical Medicine and Hygiene.
Karron, R. A. and P. L. Collins (2007). Parainfluenza Viruses. Fields virology. D. M. Knipe, P.
M. Howley, D. E. Griffinet al. Philadelphia, Lippincott Williams & Wilkins. One: 1497-
1526.
Karron, R. A., M. Makhene, et al. (1996). "Evaluation of a live attenuated bovine parainfluenza
type 3 vaccine in two- to six-month-old infants." Pediatr Infect Dis J 15(8): 650-4.
Kato, A., Y. Ohnishi, et al. (2001). "Y2, the smallest of the Sendai virus C proteins, is fully
capable of both counteracting the antiviral action of interferons and inhibiting viral RNA
synthesis." J Virol 75(8): 3802-10.
48
Kirk, M. (1987). "Sensorineural hearing loss and mumps." Br J Audiol 21(3): 227-8.
Klenk, H. D. and W. Garten (1994). "Host cell proteases controlling virus pathogenicity." Trends
Microbiol 2(2): 39-43.
Kohn, A. and P. Fuchs (1969). "Cell fusion by various strains of Newcastle disease virus and
their virulence." J Virol 3(5): 539-40.
Kolakofsky, D., T. Pelet, et al. (1998). "Paramyxovirus RNA synthesis and the requirement for
hexamer genome length: the rule of six revisited." J Virol 72(2): 891-9.
Kolakofsky, D., L. Roux, et al. (2005). "Paramyxovirus mRNA editing, the "rule of six" and
error catastrophe: a hypothesis." J Gen Virol 86(Pt 7): 1869-77.
Komatsu, T., K. Takeuchi, et al. (2004). "C and V proteins of Sendai virus target signaling
pathways leading to IRF-3 activation for the negative regulation of interferon-beta
production." Virology 325(1): 137-48.
Kumar, S., B. Nayak, et al. (2008). "Complete genome sequence of avian paramyxovirus type 3
reveals an unusually long trailer region." Virus Res 137(2): 189-97.
Kvellestad, A., B. H. Dannevig, et al. (2003). "Isolation and partial characterization of a novel
paramyxovirus from the gills of diseased seawater-reared Atlantic salmon (Salmo salar
L)." J Gen Virol 84(Pt 8): 2179-89.
Kvellestad, A., K. Falk, et al. (2005). "Atlantic salmon paramyxovirus (ASPV) infection
contributes to proliferative gill inflammation (PGI) in seawater-reared Salmo salar." Dis
Aquat Organ 67(1-2): 47-54.
Lamb, R. A. (1993). "Paramyxovirus fusion: a hypothesis for changes." Virology 197(1): 1-11.
Lamb, R. A., P. L. Collins, et al. (2005). Virus taxonomy : The Classification and Nomenclature
of Viruses : The eighth report of the International Committee on Taxonomy of Viruses.
49
Family Paramyxoviridae. C. M. Fauquet, V. International Committee on Taxonomy of
and D. International Union of Microbiological Societies. Virology. San Diego; London,
Elsevier Academic Press.
Lamb, R. A., P. L. Collins, et al. (2005). "Virus taxonomy : The Classification and Nomenclature
of Viruses : The eighth report of the International Committee on Taxonomy of Viruses."
Family Paramyxoviridae.
Lamb, R. A., Collins, P.L., Kolakofsky, D., Melero, J.A., Nagai, Y., Oldstone, M.B.A., Pringle,
C.R., Rima, B.K. (2005). Virus taxonomy : The Classification and Nomenclature of
Viruses : The eighth report of the International Committee on Taxonomy of Viruses. San
Diego; London, Elsevier Academic Press.
Lamb RA, C. P., Kolakofsky D, Melero JA, Nagai Y, Oldstone MBA, Pringle CR, Rima BK
(2005). Family Paramyxoviridae. San Diego, Elsevier Acedemic Press.
Lamb, R. A., B. W. Mahy, et al. (1976). "The synthesis of sendai virus polypeptides in infected
cells." Virology 69(1): 116-31.
Lamb, R. A. and G. D. Parks (2007). Paramyxoviridae: The Viruses and Their Replication.
Fields virology. D. M. Knipe, P. M. Howley, D. E. Griffinet al. Philadelphia, Lippincott
Williams & Wilkins. One: 1449-1496.
Lamb, R. A., R. G. Paterson, et al. (2006). "Paramyxovirus membrane fusion: lessons from the F
and HN atomic structures." Virology 344(1): 30-7.
Langedijk, J. P., F. J. Daus, et al. (1997). "Sequence and structure alignment of Paramyxoviridae
attachment proteins and discovery of enzymatic activity for a morbillivirus
hemagglutinin." J Virol 71(8): 6155-67.
50
Lawrence, M. C., N. A. Borg, et al. (2004). "Structure of the haemagglutinin-neuraminidase
from human parainfluenza virus type III." J Mol Biol 335(5): 1343-57.
Leyrer, S., M. Bitzer, et al. (1998). "Sendai virus-like particles devoid of haemagglutinin-
neuraminidase protein infect cells via the human asialoglycoprotein receptor." J Gen
Virol 79 ( Pt 4): 683-7.
Li, T., X. Chen, et al. (2006). "Structure of DDB1 in complex with a paramyxovirus V protein:
viral hijack of a propeller cluster in ubiquitin ligase." Cell 124(1): 105-17.
Li, Z., M. Yu, et al. (2006). "Beilong virus, a novel paramyxovirus with the largest genome of
non-segmented negative-stranded RNA viruses." Virology 346(1): 219-28.
Li, Z., M. Yu, et al. (2005). "Improved rapid amplification of cDNA ends (RACE) for mapping
both the 5' and 3' terminal sequences of paramyxovirus genomes." J Virol Methods
130(1-2): 154-6.
Lin, G. Y., R. G. Paterson, et al. (1998). "The V protein of the paramyxovirus SV5 interacts with
damage-specific DNA binding protein." Virology 249(1): 189-200.
Lin, Y., A. C. Bright, et al. (2003). "Induction of apoptosis by paramyxovirus simian virus 5
lacking a small hydrophobic gene." J Virol 77(6): 3371-83.
Linne, T., M. Berg, et al. (1992). "The molecular biology of the porcine paramyxovirus LPMV."
Vet Microbiol 33(1-4): 263-73.
Lipkind, M., D. Shoham, et al. (1986). "Isolation of a paramyxovirus from pigs in Israel and its
antigenic relationships with avian paramyxoviruses." J Gen Virol 67 ( Pt 3): 427-39.
Liston, P. and D. J. Briedis (1994). "Measles virus V protein binds zinc." Virology 198(1): 399-
404.
51
Lyon, M., C. Leroux, et al. (1997). "Presence of a unique parainfluenza virus 3 strain identified
by RT-PCR in visna-maedi virus infected sheep." Vet Microbiol 57(2-3): 95-104.
Malur, A. G., N. K. Gupta, et al. (2002). "Analysis of the mutations in the active site of the
RNA-dependent RNA polymerase of human parainfluenza virus type 3 (HPIV3)." Gene
Expr 10(3): 93-100.
Marshall, R. G. and G. H. Frank (1975). "Clinical and immunologic responses of calves with
colostrally acquired maternal antibody against parainfluenza-3 virus to homologous viral
infection." Am J Vet Res 36(08): 1085-9.
Melikyan, G. B., R. M. Markosyan, et al. (2000). "Evidence that the transition of HIV-1 gp41
into a six-helix bundle, not the bundle configuration, induces membrane fusion." J Cell
Biol 151(2): 413-23.
Miller, P. J., D. B. Boyle, et al. (2003). "Full-length genome sequence of Mossman virus, a novel
paramyxovirus isolated from rodents in Australia." Virology 317(2): 330-44.
Moreno-Lopez, J., P. Correa-Giron, et al. (1986). "Characterization of a paramyxovirus isolated
from the brain of a piglet in Mexico." Arch Virol 91(3-4): 221-31.
Morrison, T. G. (2003). "Structure and function of a paramyxovirus fusion protein." Biochim
Biophys Acta 1614(1): 73-84.
Murray, K., P. Selleck, et al. (1995). "A morbillivirus that caused fatal disease in horses and
humans." Science 268(5207): 94-7.
Myers, D. L., A. Zurbriggen, et al. (1997). "Distemper: not a new disease in lions and tigers."
Clin Diagn Lab Immunol 4(2): 180-4.
52
Myers, T. M., A. Pieters, et al. (1997). "A highly conserved region of the Sendai virus
nucleocapsid protein contributes to the NP-NP binding domain." Virology 229(2): 322-
35.
Nagai, Y. and H. D. Klenk (1977). "Activation of precursors to both glycoporteins of Newcastle
disease virus by proteolytic cleavage." Virology 77(1): 125-34.
Nagai, Y., H. D. Klenk, et al. (1976). "Proteolytic cleavage of the viral glycoproteins and its
significance for the virulence of Newcastle disease virus." Virology 72(2): 494-508.
Nishio, M., M. Tsurudome, et al. (1990). "Immunological relationships of simian virus 41
(SV41) to other paramyxoviruses and serological evidence of SV41 infection in human
populations." J Gen Virol 71 ( Pt 9): 2093-7.
Nollens, H. H., J. F. Wellehan, et al. (2008). "Characterization of a parainfluenza virus isolated
from a bottlenose dolphin (Tursiops truncatus)." Vet Microbiol 128(3-4): 231-42.
Norris, J. M., M. B. Krockenberger, et al. (2006). "Canine distemper: re-emergence of an old
enemy." Aust Vet J 84(10): 362-3.
Nylund, S., M. Karlsen, et al. (2008). "The complete genome sequence of the Atlantic salmon
paramyxovirus (ASPV)." Virology 373(1): 137-48.
Ogino, T., M. Kobayashi, et al. (2005). "Sendai virus RNA-dependent RNA polymerase L
protein catalyzes cap methylation of virus-specific mRNA." J Biol Chem 280(6): 4429-
35.
Ohsawa, K., A. Yamada, et al. (1998). "Genetic characterization of parainfluenza virus 3 derived
from guinea pigs." J Vet Med Sci 60(8): 919-22.
Oldstone, M. B., D. Homann, et al. (2002). "One, two, or three step: measles virus receptor
dance." Virology 299(2): 162-3.
53
Ortmann, D., M. Ohuchi, et al. (1994). "Proteolytic cleavage of wild type and mutants of the F
protein of human parainfluenza virus type 3 by two subtilisin-like endoproteases, furin
and Kex2." J Virol 68(4): 2772-6.
Palosaari, H., J. P. Parisien, et al. (2003). "STAT protein interference and suppression of
cytokine signal transduction by measles virus V protein." J Virol 77(13): 7635-44.
Parks, J. B., G. Post, et al. (1972). "Parainfluenza-3 virus infection in Rocky Mountain bighorn
sheep." J Am Vet Med Assoc 161(6): 669-72.
Paterson, R. G. and R. A. Lamb (1990). "RNA editing by G-nucleotide insertion in mumps virus
P-gene mRNA transcripts." J Virol 64(9): 4137-45.
Paterson, R. G., G. P. Leser, et al. (1995). "The paramyxovirus SV5 V protein binds two atoms
of zinc and is a structural component of virions." Virology 208(1): 121-31.
Patterson, J. B., D. Thomas, et al. (2000). "V and C proteins of measles virus function as
virulence factors in vivo." Virology 267(1): 80-9.
Peeples, M. E., C. Wang, et al. (1992). "Nuclear entry and nucleolar localization of the
Newcastle disease virus (NDV) matrix protein occur early in infection and do not require
other NDV proteins." J Virol 66(5): 3263-9.
Pennathur, S., A. A. Haller, et al. (2003). "Evaluation of attenuation, immunogenicity and
efficacy of a bovine parainfluenza virus type 3 (PIV-3) vaccine and a recombinant
chimeric bovine/human PIV-3 vaccine vector in rhesus monkeys." J Gen Virol 84(Pt 12):
3253-61.
Philbey, A. W., P. D. Kirkland, et al. (1998). "An apparently new virus (family
Paramyxoviridae) infectious for pigs, humans, and fruit bats." Emerg Infect Dis 4(2):
269-71.
54
Philip, R. N., K. R. Reinhard, et al. (1959). "Observations on a mumps epidemic in a virgin
population." Am J Hyg 69(2): 91-111.
Poch, O., B. M. Blumberg, et al. (1990). "Sequence comparison of five polymerases (L proteins)
of unsegmented negative-strand RNA viruses: theoretical assignment of functional
domains." J Gen Virol 71 ( Pt 5): 1153-62.
Poole, E., B. He, et al. (2002). "The V proteins of simian virus 5 and other paramyxoviruses
inhibit induction of interferon-beta." Virology 303(1): 33-46.
Potier, M., L. Mameli, et al. (1979). "Fluorometric assay of neuraminidase with a sodium (4-
methylumbelliferyl-alpha-D-N-acetylneuraminate) substrate." Anal Biochem 94(2): 287-
96.
Reisinger, R. C., K. L. Heddleston, et al. (1959). "A myxovirus (SF-4) associated with shipping
fever of cattle." J Am Vet Med Assoc 135(3): 147-52.
Robert A. Lamb, G. D. P. (2007). Paramyxoviridae: The Viruses and Their Replication. Fields
virology. D. M. K. Bernard N. Fields, Peter M. Howley, Diane E. Griffin. Philadelphia,
Lippincott Williams & Wilkins. One: 1449-1496.
Rodriguez, J. J., L. F. Wang, et al. (2003). "Hendra virus V protein inhibits interferon signaling
by preventing STAT1 and STAT2 nuclear accumulation." J Virol 77(21): 11842-5.
Rosenberg, F. J., F. S. Lief, et al. (1971). "Studies of canine respiratory viruses. I. Experimental
infection of dogs with an SV5-like canine parainfluenza agent." Am J Epidemiol 94(2):
147-65.
Russell, C. J., K. L. Kantor, et al. (2003). "A dual-functional paramyxovirus F protein regulatory
switch segment: activation and membrane fusion." J Cell Biol 163(2): 363-74.
55
Russell, S. J. and K. W. Peng (2009). "Measles virus for cancer therapy." Curr Top Microbiol
Immunol 330: 213-41.
Ruth A. Karron, P. L. C. (2007). Parainfluenza Viruses. Fields virology. D. M. K. Bernard N.
Fields, Peter M. Howley, Diane E. Griffin. Philadelphia, Lippincott Williams & Wilkins.
One: 1497-1526.
Sakai, Y., S. Suzu, et al. (1987). "Nucleotide sequence of the bovine parainfluenza 3 virus
genome: its 3' end and the genes of NP, P, C and M proteins." Nucleic Acids Res 15(7):
2927-44.
Sanderson, C. M., N. L. McQueen, et al. (1993). "Sendai virus assembly: M protein binds to viral
glycoproteins in transit through the secretory pathway." J Virol 67(2): 651-63.
Sasahara, J., S. Hayashi, et al. (1954). "On a swine virus disease newly discovered in Japan. 1.
Isolation of the virus. 2. Some properties of the virus. ." Virus: 4:131-139.
Sato, M. and P. F. Wright (2008). "Current status of vaccines for parainfluenza virus infections."
Pediatr Infect Dis J 27(10 Suppl): S123-5.
Scheid, A. and P. W. Choppin (1974). "Identification of biological activities of paramyxovirus
glycoproteins. Activation of cell fusion, hemolysis, and infectivity of proteolytic cleavage
of an inactive precursor protein of Sendai virus." Virology 57(2): 475-90.
Schmitt, A. P., B. He, et al. (1999). "Involvement of the cytoplasmic domain of the
hemagglutinin-neuraminidase protein in assembly of the paramyxovirus simian virus 5."
J Virol 73(10): 8703-12.
Schnell, M. J., T. Mebatsion, et al. (1994). "Infectious rabies viruses from cloned cDNA." Embo
J 13(18): 4195-203.
56
Schomacker, H., P. L. Collins, et al. (2004). "In silico identification of a putative new
paramyxovirus related to the Henipavirus genus." Virology 330(1): 178-85.
Shaw, M. L., A. Garcia-Sastre, et al. (2004). "Nipah virus V and W proteins have a common
STAT1-binding domain yet inhibit STAT1 activation from the cytoplasmic and nuclear
compartments, respectively." J Virol 78(11): 5633-41.
Shibuta, H., T. Kanda, et al. (1981). "Parainfluenza 3 virus: plaque-type variants lacking
neuraminidase activity." Infect Immun 34(1): 262-7.
Sidhu, M. S., J. P. Menonna, et al. (1993). "Canine distemper virus L gene: sequence and
comparison with related viruses." Virology 193(1): 50-65.
Skiadopoulos, M. H., A. P. Durbin, et al. (1998). "Three amino acid substitutions in the L protein
of the human parainfluenza virus type 3 cp45 live attenuated vaccine candidate contribute
to its temperature-sensitive and attenuation phenotypes." J Virol 72(3): 1762-8.
Skiadopoulos, M. H., A. C. Schmidt, et al. (2003). "Determinants of the host range restriction of
replication of bovine parainfluenza virus type 3 in rhesus monkeys are polygenic." J
Virol 77(2): 1141-8.
Skiadopoulos, M. H., S. R. Surman, et al. (2002). "Evaluation of the replication and
immunogenicity of recombinant human parainfluenza virus type 3 vectors expressing up
to three foreign glycoproteins." Virology 297(1): 136-52.
Skiadopoulos, M. H., T. Tao, et al. (1999). "Generation of a parainfluenza virus type 1 vaccine
candidate by replacing the HN and F glycoproteins of the live-attenuated PIV3 cp45
vaccine virus with their PIV1 counterparts." Vaccine 18(5-6): 503-10.
Skiadopoulos, M. H., L. Vogel, et al. (2003). "The genome length of human parainfluenza virus
type 2 follows the rule of six, and recombinant viruses recovered from non-
57
polyhexameric-length antigenomic cDNAs contain a biased distribution of correcting
mutations." J Virol 77(1): 270-9.
Spann, K. M., K. C. Tran, et al. (2004). "Suppression of the induction of alpha, beta, and lambda
interferons by the NS1 and NS2 proteins of human respiratory syncytial virus in human
epithelial cells and macrophages." J Virol 78(8): 4363-9.
Spriggs, M. K., P. R. Johnson, et al. (1987). "Sequence analysis of the matrix protein gene of
human parainfluenza virus type 3: extensive sequence homology among
paramyxoviruses." J Gen Virol 68 ( Pt 5): 1491-7.
Stephano, H. A. (1990). Focus on: swine blue eye disease. Foreign animal disease report - U.S.
Department of Agriculture, Animal and Plant Health Inspection Service, Veterinary
Services, Emergency Programs (USA): 11-15.
Stevenson, R. G. and D. E. Hore (1970). "Comparative pathology of lambs and calves infected
with parainfluenza virus type 3." J Comp Pathol 80(4): 613-8.
Storey, D. G., K. Dimock, et al. (1984). "Structural characterization of virion proteins and
genomic RNA of human parainfluenza virus 3." J Virol 52(3): 761-6.
Stricker, R., G. Mottet, et al. (1994). "The Sendai virus matrix protein appears to be recruited in
the cytoplasm by the viral nucleocapsid to function in viral assembly and budding." J Gen
Virol 75 ( Pt 5): 1031-42.
Suzu, S., Y. Sakai, et al. (1987). "Nucleotide sequence of the bovine parainfluenza 3 virus
genome: the genes of the F and HN glycoproteins." Nucleic Acids Res 15(7): 2945-58.
Svenda, M., M. Berg, et al. (1997). "Analysis of the large (L) protein gene of the porcine
rubulavirus LPMV: identification of possible functional domains." Virus Res 48(1): 57-
70.
58
Swierkosz, E. M., D. D. Erdman, et al. (1995). "Isolation and characterization of a naturally
occurring parainfluenza 3 virus variant." J Clin Microbiol 33(7): 1839-41.
Swofford, D. L. ( 2002). PAUP*. Phylogenetic Analysis Using Parsimony (*and Other
Methods). Version 4. , Sinauer Associates, Sunderland, Massachusetts.
Takeuchi, K., T. Komatsu, et al. (2001). "Sendai virus C protein physically associates with
Stat1." Genes Cells 6(6): 545-57.
Teng, M. N. and P. L. Collins (1999). "Altered growth characteristics of recombinant respiratory
syncytial viruses which do not produce NS2 protein." J Virol 73(1): 466-73.
Thomas, S. M., R. A. Lamb, et al. (1988). "Two mRNAs that differ by two nontemplated
nucleotides encode the amino coterminal proteins P and V of the paramyxovirus SV5."
Cell 54(6): 891-902.
Thompson, S. D., W. G. Laver, et al. (1988). "Isolation of a biologically active soluble form of
the hemagglutinin-neuraminidase protein of Sendai virus." J Virol 62(12): 4653-60.
Thorsen, J. and J. P. Henderson (1971). "Survey for antibody to infectious bovine rhinotracheitis
(IBR), bovine virus diarrhea (BVD) and parainfluenza 3 (PI3) in moose sera." J Wildl
Dis 7(2): 93-5.
Tidona, C. A., H. W. Kurz, et al. (1999). "Isolation and molecular characterization of a novel
cytopathogenic paramyxovirus from tree shrews." Virology 258(2): 425-34.
Tong, S., M. Li, et al. (2002). "Regulation of fusion activity by the cytoplasmic domain of a
paramyxovirus F protein." Virology 301(2): 322-333.
Tsai, K. S. and R. G. Thomson (1975). "Bovine parainfluenza type 3 virus infection:
ultrastructural aspects of viral pathogenesis in the bovine respiratory tract." Infect Immun
11(4): 783-803.
59
Tsurudome, M., H. Bando, et al. (1990). "Antigenic and structural properties of a paramyxovirus
simian virus 41 (SV41) reveal a close relationship with human parainfluenza type 2
virus." Virology 179(2): 738-48.
Utz, J. P., V. N. Houk, et al. (1964). "Clinical and Laboratory Studies of Mumps." N Engl J Med
270: 1283-6.
van Wyke Coelingh, K. L., C. Winter, et al. (1985). "Antigenic variation in the hemagglutinin-
neuraminidase protein of human parainfluenza type 3 virus." Virology 143(2): 569-82.
van Wyke Coelingh, K. L., C. C. Winter, et al. (1988). "Attenuation of bovine parainfluenza
virus type 3 in nonhuman primates and its ability to confer immunity to human
parainfluenza virus type 3 challenge." J Infect Dis 157(4): 655-62.
Vigil, A., O. Martinez, et al. (2008). "Recombinant Newcastle disease virus as a vaccine vector
for cancer therapy." Mol Ther 16(11): 1883-90.
Wang, L., B. H. Harcourt, et al. (2001). "Molecular biology of Hendra and Nipah viruses."
Microbes Infect 3(4): 279-87.
Wang, L. F., E. Hansson, et al. (2007). "Full-length genome sequence and genetic relationship of
two paramyxoviruses isolated from bat and pigs in the Americas." Arch Virol 152(7):
1259-71.
Wang, L. F., M. Yu, et al. (2000). "The exceptionally large genome of Hendra virus: support for
creation of a new genus within the family Paramyxoviridae." J Virol 74(21): 9972-9.
Wechsler, S. L., D. M. Lambert, et al. (1985). "Intracellular synthesis of human parainfluenza
type 3 virus-specified polypeptides." J Virol 54(3): 661-4.
60
Whitehead, S. S., A. Bukreyev, et al. (1999). "Recombinant respiratory syncytial virus bearing a
deletion of either the NS2 or SH gene is attenuated in chimpanzees." J Virol 73(4): 3438-
42.
Wilson, R. L., S. M. Fuentes, et al. (2006). "Function of small hydrophobic proteins of
paramyxovirus." J Virol 80(4): 1700-9.
Woods, G. T. (1968). "The natural history of bovine myxovirus parainfluenza-3." JAVMA(152):
771-779.
Yanagi, Y., N. Ono, et al. (2002). "Measles virus receptor SLAM (CD150)." Virology 299(2):
155-61.
Yener, Z., Y. S. Saglam, et al. (2005). "Immunohistochemical detection of parainfluenza type 3
virus antigens in paraffin sections of pneumonic caprine lungs." J Vet Med A Physiol
Pathol Clin Med 52(6): 268-71.
Yin, H. S., R. G. Paterson, et al. (2005). "Structure of the uncleaved ectodomain of the
paramyxovirus (hPIV3) fusion protein." Proc Natl Acad Sci U S A 102(26): 9288-93.
Zaitsev, V., M. von Itzstein, et al. (2004). "Second sialic acid binding site in Newcastle disease
virus hemagglutinin-neuraminidase: implications for fusion." J Virol 78(7): 3733-41.
Zarnke, R. L. and G. A. Erickson (1990). "Serum antibody prevalence of parainfluenza 3 virus in
a free-ranging bison (Bison bison) herd from Alaska." J Wildl Dis 26(3): 416-9.
Zhao, X., M. Singh, et al. (2000). "Structural characterization of the human respiratory syncytial
virus fusion protein core." Proc Natl Acad Sci U S A 97(26): 14172-7.
61
1.11 Tables
Table 1. Examples of Members of the Paramyxoviridae family
Family Paramyxoviridae
Subfamily Paramyxovirinae
Genus Rubulavirus
Mump virus (MuV)
Parainfluenza virus 5 (PIV5/SV5)
Human parainfluenza virus type 2, type 4a and 4b (hPIV2/4a/4b)
Porcine rubulavirus (La-Piedad-Michoacán virus, LPMV)
Genus Avulavirus
Newcastle disease virus (avian paramyxovirus 1, NDV)
Genus Respirovirus
Sendai virus (mouse parainfluenza virus type 1, SeV)
Human parainfluenza virus type 1 and type 3 (hPIV1/3)
Bovine parainfluenza virus type 3 (bPIV3)
Atlantic Salmon Paramyxovirus (ASPV) (?)
T. truncates parainfluenza virus type1 (TtPIV-1) (?)
Genus Henipaviruses
Hendra virus (HeV)
Nipah virus (NiV)
Genus Morbillivirus
Measles virus (MeV)
Canine distemper virus (CDV)
Peste-des-Petits ruminants virus (PPRV)
Rinderpest virus (RPV)
Subfamily Pneumovirinae
Genus Pneumovirus
Human respiratory syncytial virus A2, B1, S2 (hRSV)
Bovine respiratory syncytial virus (bRSV)
Pneumonia virus of mice (PVM)
Genus Metapneumovirus
Human metapneumovirus (hMPV)
Avian metapneumovirus (aMPV)
Unclassifed paramyxoviruses
Fer-de-Lance virus (FDLV)
Tupaia paramyxovirus (TPMV)
Menangle virus (MenV)
Tioman virus (TioV)
Beilong virus (BeV)
J virus (J-V)
Mossman virus (MoV)
1.12 Figures
(A)
(B)
Figure 1. Virion structure of a Paramyxovirus.
(A) Schematic diagram of a paramyxovirus (not drawn to scale) (from Field’s virology, 5
(B) Electron micrograph of paramyxovirus virion.
62
Figure 1. Virion structure of a Paramyxovirus.
Schematic diagram of a paramyxovirus (not drawn to scale) (from Field’s virology, 5
Electron micrograph of paramyxovirus virion.
Schematic diagram of a paramyxovirus (not drawn to scale) (from Field’s virology, 5th edition)
63
Figure 2. Reverse genetics system of ??SV (from (Bukreyev et al., 2006)).
A plasmid encoding a full length antigenomic RNA of a parainfluenza virus is shown at the top. The
extragenic 3’ leader and 5’ trailer regions, individual genes, GS and GE are shown, respectively. The
antigenomic cDNA is flanked at the left by a T7 promoter (T7 pr.), and a self-cleaving ribozyme and T7
terminator (T7 tr.) at the right. Three other T7 expression plasmids encode the N, P, and L support
proteins needed to reconstitute a biologically active nucleocapsid. The T7 RNA polymerase is supplied
from a cotransfected eukaryotic expression plasmid. The plasmids are transfected into a cell monolayer in
which the plasmid-expressed viral RNA and protein components assemble into a functional nucleocapsid
and launch a productive infection. Recovered virus is amplified by passage and can be plaque purified.
64
Figure 3. Strategies for designing a ??SV vector (from (Bukreyev et al., 2006)).
(A) Wild-type NNSV expressing foreign genes.
(B) Antigenic chimeric viruses.
(C) Antigenic chimeric virus expressing additional foreign genes.
65
Chapter 2
Molecular Characterization of Glycoprotein Genes and
Phylogenetic Analysis of Two Swine Paramyxoviruses Isolated From
United States
Dan Qiao1, Bruce H. Janke
2, Subbiah Elankumaran
1.
1Virginia-Maryland Regional College of Veterinary Medicine, Virginia Polytechnic Institute and
State University, Blacksburg, VA.
2Dept. of Veterinary Diagnostic & Production Animal Medicine, College of Veterinary
Medicine, Iowa State University, Ames, IA.
This manuscript has been published in the journal Virus Genes (2009) 39:53-65.
66
Abstract
Two swine Paramyxoviruses (sPMV) (81-19252 (Texas81), and 92-7783 (ISU92) were
isolated from encephalitic pigs in the United States in 1981 and 1992. Antigenic, morphologic
and biological characteristics of these two viruses were essentially similar to members of the
family Paramyxoviridae. Antigenic analysis by indirect fluorescent antibody, immunoblot and
one-way cross-neutralization tests placed these viruses along with bovine parainfluenza 3
(bPIV3) viruses. Purified virions were 50-300 nm in size and morphologically indistinguishable
from other paramyxoviruses. These two viruses hemagglutinated red blood cells and had
neuraminidase activity. The gene junctions of fusion (F) and hemagglutinin (HN) glycoprotein
genes of these viruses contained highly conserved transcription start and stop signal sequences
and trinucleotide intergenic regions similar to other Paramyxoviridae. The F gene of ISU92 was
longer than Texas-81 due to insertion of a 24 nucleotide “U” rich 3’ UTR. Structure based
sequence alignment of glycoproteins of these two sPMVs indicated that they are essentially
similar in structure and function to parainfluenzaviruses, The Texas81 strain was closely related
to bPIV3 Shipping Fever (SF) strain at nucleotide and amino acid level, while the ISU92 strain
was more closely related to bPIV3-910N strain. The envelope glycoproteins of ISU92 had only
~92% and ~96% identity at nucleotide and amino acid levels with bPIV3-SF strain, respectively.
The high sequence identities to bPIV3 indicated cross-species infection in pigs. Phylogenetic
analyses based on both F protein and HN protein suggested the classification of these viruses
into the subfamily Paramyxovirinae, genus Respirovirus and genotype A of bPIV3.
Keywords: Paramyxovirus, Bovine Parainfluenzavirus 3, Glycoproteins, Cross-species
infection, Pigs.
67
2.1 Introduction
Paramyxoviruses are established pathogens of the central nervous and respiratory systems
in many host species. In the last few decades, many novel paramyxoviruses have emerged
causing catastrophic illnesses in different aquatic and terrestrial species of animals and some of
them also made the species jump to humans. Members of the family Paramyxoviridae are
enveloped viruses possessing a non-segmented negative-strand genome and are divided into two
subfamilies, Paramyxovirinae and Pneumovirinae. Currently, there are five genera within the
subfamily Paramyxovirinae: Rubulavirus, Avulavirus, Respirovirus, Morbillivirus, and
Henipavirus (Lamb RA, 2005). La Piedad Michoacán paramyxovirus (LPMV) is the only well
studied neurotropic paramyxovirus isolated from pigs prior to the 1990s. LPMV was first
isolated in central Mexico in the early 1980s (Moreno-Lopez et al., 1986), and it has become
endemic in Mexico (Linne et al., 1992). This virus induced interstitial pneumonia and
encephalitis in pigs. There were extensive records of paramyxoviruses derived from the brain or
nasal swabs of sick pigs in Japan, in 1950s (Philbey et al., 1998), Canada, in 1971 (Ellis et al.,
1998), in Israel in 1986 (Janke et al., 2001) as well as the United States, in 1960s and 1980s in
Texas (Janke et al., 2001). There was also concurrent infection of porcine reproductive and
respiratory syndrome virus and a paramyxovirus in Germany in the 1990s (Heinen et al., 1998)
that has been subsequently named “SER” virus (Tong et al., 2002).
Since 1994, four bat-associated paramyxoviruses have emerged, three of which caused
disease in animals and humans (Wang et al., 2001). In late 1994 in Australia, Hendra virus
(HeV) caused an outbreak of severe respiratory disease resulting in the death of 13 horses and
their trainer (Murray et al., 1995), followed by sporadic HeV outbreaks in horses and humans
68
(Field et al., 2007a). A closely related virus, Nipah virus (NiV) from Malaysia caused severe
febrile encephalitis and death in pigs and humans (Chua et al., 2000), which spread to
Bangladesh and India (Chadha et al., 2006; Hsu et al., 2004). In 1997, Another paramyxovirus,
named Menangle virus (MenV) has been isolated in Australia from still-born pigs with
deformities (Philbey et al., 1998), and associated human illness (Chant et al., 1998). In 2000,
Tioman virus (TioV) was isolated from urine collected beneath a fruit bat colony on Tioman
Island, Malaysia (Chua et al., 2001). Molecular characterization revealed that MenV and TioV
are closely related novel members of the genus Rubulavirus (Bowden and Boyle, 2005; Chua et
al., 2001; Chua et al., 2002). Mapuera virus (MPRV) was isolated in 1979 from the salivary
glands of an apparently healthy fruit bat (Sturnira lilium), captured in the tropical rainforest of
Brazil (Karabatsos, 1985). J-virus (JV), isolated from wild mice in Australia, and Beilong virus
(BeV), originally isolated from human mesangial cells in China and subsequently detected in rat
mesangial cells, represent a new group of paramyxoviruses (Basler et al., 2005; Jack et al., 2005;
Jun et al., 1977; Li et al., 2006b; Schomacker et al., 2004). Recently, novel Paramyxoviruses
were also isolated from Atlantic bottlenose dolphins and Atlantic salmons and characterized
(Nollens et al., 2008; Nylund et al., 2007).
Two swine paramyxoviruses (sPMV) (81-19252 (Texas81), and 92-7783 (ISU92)) were
isolated from the brain of pigs that experienced respiratory and central nervous system disease in
the 1980s and 1990s from South and North Central United States, respectively. ISU92 virus was
isolated from a swine operation in the 1990s in north central United States. The outbreak started
in a continuous-flow finishing barn of 400 pigs with signs of respiratory disease. Affected pigs
showed high fever and mild cough and seventeen pigs died within 4 days. Ten days later, the
epizootic spread to a second finishing barn and affected all pigs of different ages. Encephalitic
69
signs observed from several pigs with persistent squealing, head pressing, whole body tremors,
and hind-limb ataxia (Janke et al., 2001). Texas-81 virus was isolated from the brain of pigs that
exhibited respiratory and neurological disease in Texas State, in 1981. Further information on the
history of this virus is not available. Antigenic analysis by indirect fluorescent antibody assay
(IFA) at the National Veterinary Services Laboratory (NVSL), Ames, Iowa indicated that these
two viruses are closely related to human parainfluenza virus (hPIV) type 1 and 3 and bovine
parainfluenza virus type 3 (bPIV3).
As new viruses emerge that cause severe diseases in pigs and have the potential to cross
species barrier and infect other hosts including humans, it is important that these new viruses
need to be studied further. Although paramyxoviruses have been isolated from swine in United
States and other parts of the world, their importance as swine pathogens or zoonotic agents
remains to be determined. To understand the significance of these two strains of sPMV for swine
health and to determine their taxonomic status, we have initiated molecular characterization
studies. Here, we describe the biological and molecular characterization of the fusion (F) and
hemagglutinin (HN) glycoprotein genes and their phylogenetic identity with other
paramyxoviruses.
2.2 Materials and Methods
2.2.1 Viruses and Cells
Texas-81 and ISU-92 were received from the NVSL, Animal and Plant Health Inspection
Service (APHIS), United States Department of Agriculture (USDA), Ames, Iowa. Porcine
70
Kidney (PK15) cells, tested free of porcine circovirus (PCV) were obtained from Dr. X. J. Meng,
Virginia Polytechnic Institute and State University, and used to propagate these swine
paramyxoviruses. Vero cells (ATCC #C1008) were used for fusion and plaque assays.
2.2.2 Virus purification
Iodixanol gradients (OptiPrep, Sigma) were prepared in phosphate buffered saline (PBS)
(14% to 26%). Cell lysates from virus stock (plaque purified) were layered onto the top of the
gradient and centrifuged for 1.5 h at 250,000 × g in a SW41 Ti rotor. Virus fraction was
collected from the gradient and was either examined by transmission electron microscopy or
analyzed for protein content by immunoblot.
2.2.3 Transmission Electron Microscopy
Purified virus was adsorbed to glow discharged carbon films on 400 mesh grids. The grids were
then washed in PBS and fixed with 2% paraformaldehyde (10 min) and extensively washed with
distilled water before negatively stained with 1% phosphotungstic acid. All specimens were
observed in Philips EM 420 transmission electron microscope operating at 100 KV.
71
2.2.4 Plaque Assay
Confluent Vero cells in 6-well plates were infected with virus stocks prepared from the
third limiting dilution passage in PK15 cells. Viruses were diluted in Dulbecco's Modified Eagle
Medium (DMEM) (Invitrogen) , incubated at 37 °C, in a 5% CO2 incubator for 1 h, washed with
PBS, and then overlaid with 0.8% methyl cellulose in DMEM with 2% FBS. The cells were
fixed with methanol-acetone (1:1) at 6 days post-infection (dpi) and stained with 1% crystal
violet. The mean number of plaque forming units (pfu) ml-1
for each virus was determined.
2.2.5 Hemagglutination (HA) Assay
Swine red blood cells (sRBCs) were washed 3 times with PBS and resuspended in PBS
as a 1% suspension. Texas81 and ISU92 virus stocks prepared in Vero cells were titrated in
doubling dilutions against sRBC in V-bottom microtiter plates (Nunc).
2.2.6 Fusion Index Assay
The fusogenicity of Texas81 and ISU92 viruses was examined as described by Kohn
(Kohn and Fuchs, 1969). Viruses were inoculated into confluent Vero cells in 6-well plates at a
MOI of 0.1. Cells were maintained in DMEM with 2% FBS at 37 °C in a 5% CO2 environment.
After 72 h, the medium was removed, and cells were washed once with 0.02% EDTA and then
incubated with 1 ml of 0.02% EDTA for 2 min at room temperature. The cells were then washed
with PBS and fixed with methanol and stained with hematoxylin-eosin (Hema 3, Sigma). Fusion
72
was quantitated by expressing the fusion index as the ratio of the total number of nuclei to the
number of cells in which these nuclei were observed (i.e., the mean number of nuclei per
cell). The formation of syncytia was visualized by staining virus-infected cells at 48 h with Hema
3 without EDTA treatment.
Fusogenicity of Texas81 and ISU92 F genes were also tested in a plasmid-based system.
The open reading frames of the F and HN genes of Texas81 and ISU92 viruses were cloned into
pCAGGS plasmid and transfected into Vero cells (1µg of each plasmid) using Lipofectamine
2000 (Invitrogen). At 72 h post-transfection, fusion index was calculated as described above.
2.2.7 3euraminidase (3A) activity
The NA activity of the Texas81 and ISU92 strains was determined by a fluorescence-
based NA assay according to the procedures of Potier et al. (Ferraris et al., 2005; Potier et al.,
1979). Newcastle Disease Virus (NDV) Beaudette C strain was used as a standard control virus.
Briefly, serial dilutions of virus strains in dilution buffer (32.5mM MES (2-(%-morpholino)
ethanesulfonic acid, sodium salt, Sigma–Aldrich) pH 5.8, 4mM CaCl2) were prepared in a 96-
well black flat bottom plates. Then, the same volume of substrate buffer (2’-(4-
methylumbelliferyl)-α-D-%-acetylneuraminic acid, sodium salt (MUN, Sigma–Aldrich) prepared
in 32.5mM MES pH 5.8, 4mM CaCl2 buffer) was added to each well. The plate was gently
shaken on a mechanical vibrator and then incubated for 1 h at 37 °C. The reaction was
terminated by adding 150ul of 50mM glycine buffer pH 10.4. The results were read in a
73
VIKTOR multilabel reader (TECAN Safire2) with an excitation wavelength of 360nm and an
emission wavelength of 450nm.
2.2.8 Indirect Fluorescent Antibody (IFA) Test
Virus stocks were inoculated into confluent Vero cells in 8-well chambers at a MOI of
1.0, 0.1, and 0.01. Cells were maintained in DMEM with 2% FBS at 37 °C in a 5% CO2
environment for 48 h and observed for cytopathic effects (CPE). The cells were then washed
with PBS and fixed with methanol-acetone followed by 3 washes with PBST (0.1% Tween 20 in
PBS). The cell monolayers were blocked overnight at 4 °C with PBST containing 5% skim milk
powder (PBSM). After 3 brief washes with PBST, the cells were incubated with anti-bovine
PIV3 polyclonal antibody (NVSL) diluted 1:100 in PBSM and incubated overnight at 4 °C. Then
the cells were washed 3 times with PBST and incubated with FITC-anti bovine IgG (KPL) (1:32
dilution in PBSM) at 37 °C in a moist environment for 1 h. After 3 washes with PBST, the slides
were layered with glycerol-PBS (1:1) and observed under a Nikon Eclipse TS-100
epifluorescence microscope.
2.2.9 Immunoblot
OptiPrep purified virions were subjected to immunoblotting using standard procedures.
Briefly, the proteins were separated in a 4-20% sodium-dodecyl sulphate polyacrylamide gel
electrophoresis (SDS-PAGE) and transferred to Immobilon-P (Millipore) membranes. The viral
74
proteins were probed with anti-bovine PIV3 polyclonal bovine antibody (NVSL) (1:100
dilution), followed by HRP labeled anti-bovine IgG (KPL) (1:500 dilution) secondary antibodies.
The blots were visualized with chemiluminiscent ECL Western blotting system (GE Healthcare).
2.2.10 One-way Cross-neutralization Test
Monospecific convalescent sera were obtained from pigs inoculated intranasally with
5x107TCID50 of Texas81 or ISU92 virus stock. One way-cross neutralization test was
performed in 96-well plates against 500 TCID50 of respective viruses and heat-inactivated, two-
fold diluted sera. The cells were fixed on day 5 and stained with Hema 3 to determine the virus-
neutralization titer.
2.2.11 Reverse Transcription (RT)-Polymerase Chain Reaction (PCR) and Sequencing
RNA extraction and reverse transcription (RT) reactions were performed using standard
procedures. Briefly, virus-infected PK15 cells were scraped into the medium and subjected to
three cycles of freezing and thawing. After initial clarification at 3000 x g for 15 min,
polyethylene glycol (PEG) 8000 (Sigma) was added to the cell lysate to a concentration of 10 %
and the lysate was incubated for 4 h at 4 °C. The virus was pelleted at 12, 000 x g for 60 min at 4
°C, and the viral genomic RNA was extracted from the virus pellet using RNeasy Mini Kit
(QIAgen). Oligonucleotide primers were designed based on consensus bPIV3 F and HN gene
nucleotide sequences (primer sequences available upon request). The complementary DNA
75
(cDNA) copies of the genomic RNA of the two virus strains were synthesized using the specific
oligonucleotide primers and Superscript III reverse transcriptase (Invitrogen). Subsequently,
Platinum Taq DNA Polymerase (Invitrogen) was used to amplify the F or HN gene. The PCR
products were purified using Qiaquick PCR purification kit (Qiagen). The PCR products were
cloned using the TA cloning system (Invitrogen). Both purified PCR products and at least 10
TA clones were sequenced in both directions in an automated sequencer (Core Laboratory
Facility at Virginia Bioinformatics Institute, Virginia Tech). Based on the sequencing results,
primer-walking strategy was employed and new sets of oligonucleotide primers were designed
for sequencing the middle part of the genes.
2.2.12 Determination of antigenic relatedness
The antigenic relatedness of sPMV strains were expressed by R value, calculated using
the following formula created by Archetti and Horsfall (1950)(Archetti and Horsfall, 1950).
where r1 is the ratio of the heterologous titer obtained with virus 2 to the homologous
titer obtained with virus 1; r2 is the ratio of the heterologous titer obtained with virus 1 to the
homologous titer obtained with virus 2; R is a geometric mean of ratio r1 and r2, which is used to
express the antigenic relatedness between two viruses when both antigens and antisera were used
in indirect FA test.
76
R values were interpreted by the method of Brooksby (Brooksby, 1967) for similarity
comparison of two viruses. The criteria are as follows: 1) R value of 1 or close to 1 indicates
antigenic identity between two tested viruses; 2) R value >70% means little or no difference
between two viruses tested; 3) R value between 33% and 70% indicates a minor subtype
difference; 4) R value between 11% and 32% represents a major subtype difference; 5) R value
between 0% and 10% represents a serotype difference.
2.2.13 Data Analysis
Nucleotide sequence editing, alignments and prediction of amino acid sequence and
analyses were conducted using the software package DNASTAR (Lasergene). Phylogenetic
relationships of these two viruses within Paramyxoviridae family were constructed by
Phylogenetic Analysis using Parsimony (PAUP 4.01) software with 1000 bootstrap replicates.
The protein functional analyses of deduced amino acid sequences were done using online
resources available at ExPASy Proteomics tools (http://us.expasy.org/tools/).
2.2.14 Accession numbers for sequence analyses
The sequences of ISU-92 and Texas-81 were deposited in GenBank under accession #
EU439428 and EU439429, respectively. The accession numbers for other viral sequences used
for phylogenetic analysis are: Atlantic salmon paramyxovirus (ASPV), EF646380; Avian
metapneumovirus (aMPV), NC_007652; Avian paramyxovirus 6 (aPMV6), NC_003043;
77
Beilong virus (BeV), NC_007803; Bovine parainfluenza virus 3-910N (bPIV3-910N), D84095;
Bovine parainfluenza virus 3 strain Kansas/15626/84 (bPIV3-Ka), AF178654; Bovine
parainfluenza virus Q5592 (bPIV3-Q5592), EU277658; Bovine parainfluenza virus 3 strain
Shipping Fever (bPIV3-SF), AF178655; Bovine parainfluenza virus 3 strain SK-217 (bPIV3-
SK217), U31671; bovine respiratory syncytial virus (bRSV), NC_001989; Canine distemper
virus (CDV), NC_001921; Dolphin morbillivirus (DMV), NC_005283; Fer-de-lance virus
(FDLV), NC_005084; Hendra virus (HeV), AF017149; Human metapneumovirus (hMPV),
NC_004148; Human parainfluenza virus 1 strain Washington/1964 (hPIV1-Wa), NC_003461;
Human parainfluenza virus 2 (hPIV2), NC_003443; Human parainfluenza virus 3 (hPIV3),
AB012132; Human parainfluenza virus 3-GPv (hPIV3-GPv), NC_001796; Human parainfluenza
virus 3-JS (hPIV3-JS), Z11575; Human respiratory syncytial virus (hRSV), NC_001781; J-virus
(J-V), NC_007454; Measles virus (MeV), NC_001498; Menangle virus (MenV), NC_007620;
Mossman virus (MoV), NC_005339; Mumps virus (MuV), NC_002200; Newcastle disease virus
(NDV), NC_002617; Nipah virus (NiV), NC_002728; Peste-des-petits-ruminants virus (PPRV),
NC_006383; Pneumonia virus of mice, AY573818; Porcine Rubulavirus (PoRV/LPMV),
NC_009640; Rinderpest virus (RPV) (strain Kabete O), NC_006296; Sendai virus (SeV),
NC_001552; Simian parainfluenza virus 5 (SV5), NC_006430; Tioman virus (TioV),
NC_004074; Tupaia paramyxovirus (TPMV), NC_002199.
78
2.3 Results and Discussion
2.3.1 Morphological and Biological Properties
Transmission electron microscopy revealed spherical to pleiomorphic virions
approximately 50-300 nm in diameter morphologically indistinguishable from paramyxoviruses
(Robert A. Lamb, 2007). Intact virions were enveloped and densely packed with surface
projections representing viral glycoprotein spikes. Nucleocapsids were visible and exhibited a
typical “herringbone” pattern (Figure 1). Both Texax81 and ISU92 viruses were able to
agglutinate sRBCs. The HA titers of Texas-81 and ISU-92 were 24 and 2
5, respectively. The
agglutinated sRBCs eluted after 1 h suggesting neuraminidase function. Neuraminidase assay
also confirmed this. bPIV3 has been shown to have hemagglutinating and neuraminidase
functions (Breker-Klassen et al., 1996). The fusion index of Texas81 was 63 nuclei per cell and
ISU92 was 60 nuclei per cell (72 hpi, MOI, 0.1), indicating that these viruses are highly
fusogenic (Figure 2). The fusion index with Texas81 and ISU92 F plasmids with homologous
HN plasmids was 22.7 and 13.5 respectively. The viruses were able to form plaques in Vero cells
at 6 dpi and grew to 2.62×107
pfu ml-1
(Texas81) and 5.75×107
pfu ml-1
(ISU92). Both viruses
produced similar sized plaques in Vero cells (Figure 2).
2.3.2 Antigenic analysis
Antigenic analysis at the National Veterinary Services Laboratory (NVSL), Ames, Iowa
indicated that they were closely related to human parainfluenza virus (hPIV) type 1 and 3 and
bPIV3 (Table 1). Cross-reactivity in several epitopes in F and HN proteins with hPIV3 and
79
bPIV3 has been reported earlier (Coelingh et al., 1986). Bovine anti-bPIV3 serum was able to
detect the cells infected by these viruses (Figure 2) by IFA. Besides, using bovine anti-bPIV3
serum, all the viral proteins were detectable in OptiPrep purified virion preparations (Figure 2).
The protein designations described were based on studies with virion proteins of PIV3 (Storey et
al., 1984; Wechsler et al., 1985). Homologous sera could neutralize virus infectivity of similar
titers and heterologous serum (bPIV3-SF) neutralized virus infectivity of Texas81 at 1:32 and
ISU92 at 1:8, suggesting antigenic variation. The R values of Texas81 and ISU92 strains with
bPIV3-SF strain were 100% and 35%, respectively by IFA. These observations suggest that
Texas81 and ISU92 were antigenically closely related to bPIV3. However, antigenic analysis by
IFA also suggested that ISU92 is a minor subtype of bPIV3, according to the criteria of
Brooksby (1967) (Brooksby, 1967).
2.3.3 Transcriptional start and stop sequences
The nucleotide sequence of F and HN genes of both Texas81 and ISU92 viruses were
determined from RT-PCR products amplified from viral genomic RNA. Individual genes are
transcribed by a start-stop mechanism controlled by conserved sequences at the gene borders in
members of the family Paramyxoviridae. The F and HN genes of Texas81 and ISU92 shared the
universal pattern of paramyxovirus genome structure, flanked at 3’ end with a conserved gene-
start (GS) sequence and at 5’ end with a gene-end (GE) sequence with an intergenic sequence
(IGS) in between. The GS and GE sequences of the F and HN genes were essentially similar to
bPIV3. Only the variable fifth and sixth positions of the GS sequence showed host-specificity
(Table 2). All of them terminated with U-rich GE sequences. The trinucleotide IGS (3’-GAA) of
80
these two viruses were also identical to members of the genera Respirovirus, Morbillivirus, and
Henipavirus (Bailly et al., 2000). A long U-rich sequence was identified in the 3’ UTR of F gene
of ISU92. This is a characteristic feature commonly found in bPIV3 and hPIV3. This has been
shown to result in read-through transcripts of M gene in bPIV3 and hPIV3 (Sakai et al., 1987;
Suzu et al., 1987).
2.3.4 F gene
The F gene of Texas81 strain was 1869 nucleotides (nt) in length with a single ORF of
1620 nt beginning at position 211 (Table 3), capable of encoding a 540 amino acid protein. The
F gene of ISU92 strain was 1893 nt in length with a 1620 nt ORF but with a longer 3’
untranslated region (235 nt). The long 3’ UTR in ISU92 strain had a 24 nt “U” rich insertion
compared to the Texas81 strain. The F protein of ISU92 had a predicted molecular weight of
60,039 Da and an estimated isoelectric point (pI) of 6.797. For Texas-81 strain, the uncleaved F0
protein had a predicted molecular weight of 60,189 Da and an estimated pI of 6.539. The size
determination by immunoblotting confirmed this (Figure 2). The Texas81 strain has 100%
identity with bPIV3-SF strain both in nucleotide and deduced amino acid sequences. ISU92
strain had 98.7% identity in nucleotide sequence and 99.1% identity in amino acid sequences
with bPIV3-SK217 strain, while it had 90.9% and 95% identity with bPIV3-SF strain in
nucleotide and amino acid sequences, respectively (Table 4) for F gene.
The F protein mediates fusion of virus and cell membrane in paramyxoviruses. Fusion
activation is dependent on the cleavage of F0 protein into disulfide-linked subunits F2-s-s-F1. The
81
furin, a subtilisin-like endoprotease, is believed to be one of the proteases that cleaves most F
proteins intracellularly (Klenk and Garten, 1994; Ortmann et al., 1994). In Texas81 and ISU92
viruses, the F cleavage motif L/SRTKR was located between amino acid residues 105 to 109,
and cleavage occurs between residues 109(R) and 110(F). This cleavage site conformed to the
pattern of consensus motif for cleavage by furin (Hosaka et al., 1991), R-X-K/R-R, which is
conserved in the majority of Paramyxovirinae (Robert A. Lamb, 2007). The predicted F cleavage
site was immediately followed by a 25-aa hydrophobic fusion peptide, highly conserved in all
paramyxovirus F proteins (Horvath et al., 1992; Robert A. Lamb, 2007). The cleaved F1 protein
was approximately 51kDa in size. The F protein of both strains, like the F protein of other
paramyxoviruses, was predicted to be a type I membrane protein. The transmembrane region was
near the carboxyl terminal (amino acid residues 497-517), which was thought to serve as an
anchor in the viral envelope, leaving a 23 amino acid cytoplasmic tail (Figure 3).
The F proteins of swine paramyxoviruses are essentially similar in structure and function
to other paramyxoviruses, and especially to BPIV3. Peptides corresponding to the heptad repeat
regions A and B (HRA and HRB) from SV5 (Baker et al., 1999), hRSV (Zhao et al., 2000) and
hPIV3 (Yin et al., 2005), were conserved in the F protein of sPMV. F proteins assembled into
stable six helical bundles (6HBs) (the F1 core), and their structure in hPIV3 had been determined.
Structure based sequence alignment of the sPMV F protein sequences with these 6HB fragments
revealed only minor differences. The conserved blocks in F1 and F2 (CBF1, CBF2) were also
preserved in sPMV as in other paramyxoviruses which strengthens the hypothesis that these
conserved blocks had conserved functions, either in the membrane fusion or in the folding and
processing of the F protein (Gardner and Dutch, 2007). Cysteines, which were important for
disulfide bond formation and secondary structure, were also identical to bPIV3 and hPIV3.
82
Among the five potential conserved N-linked glycosylation sites (N 101, N238, N359, N446, and
N508) in the F protein (Suzu et al., 1987), all but one had the N-X-T motif. The one at position
446 had the N-X-S motif. It should be noted that only one potential glycosylation site (at N101)
was located before the F protein cleavage site, and one site was located in the transmembrane
domain (N508). The other three were located prior to the transmembrane domain in the F1
protein and were, therefore, likely to be exposed on the surface, as in other members of the genus
Respirovirus (Robert A. Lamb, 2007).
2.3.5 H3 gene
The HN gene was 1888 nt in length with a single ORF beginning at position 74 that could
encode a 572 amino acid protein (Table 3). Texas81 strain shared 99.8% identity with bPIV3-SF
strain both in nucleotide and predicted amino acid sequences. ISU92 strain had 98.4% nucleotide
sequence identity and 99.1% amino acid sequence identity with bPIV3-SK217 strain. Identity of
ISU92 with bPIV3-SF strain is 91.7% at nucleotide level and 95.8% at amino acid level (Table
4). Comparing with hPIV3, the two swine viruses had 80.1% ~ 82.7% identities in the HN gene
nucleotide sequences and 76.4% ~ 77.6% identity at deduced amino acid sequences.
The deduced amino acid sequence of the HN protein was 572 residues in length. The HN
protein of ISU92 had a predicted molecular weight of 64,652 Da and an estimated pI of 7.343.
The HN protein of Texas81 strain had a predicted molecular weight of 64,624 Da and an
estimated pI of 7.720. The active site residues predicted from NDV or hPIV3 HN crystal
structure were also conserved in the swine viruses. The major transmembrane region of HN
83
protein was predicted to be from amino acid residues 36 to 54 of the protein as in other type II
membrane glycoproteins. The transmembrane domain at the N-terminal end of the HN protein
contained several conserved substitutions among the examined viruses (Figure 4).
The disulfide bonds in the HN protein C190–C214 (A), C256–C269(C), C355–C469 (D),
C463–C473(E), C535–C544(F), C159–C571(W) and C350–C363(X) were conserved as in NDV
HN or hPIV 3 HN crystal structures (Crennell et al., 2000; Lawrence et al., 2004). Predicted N-
glycosylation sites were conserved in HN proteins as in other members of Paramyxovirinae. In
swine viruses, potential N-linked glycan sites observed at all predicted sites (N8, N308, N351,
N448 and N523) were similar to hPIV3. The counterpart to N351 in NDV HN is N341, which is
glycosylated in that molecule. NDV HN contains a N-linked glycosylation site at N481, but in
hPIV3 HN the sequence at this site is N-P-T and in swine viruses, it is N-P-S, the asparagine
moiety of which is thus not expected to be glycosylated. Texas81 strain had an additional (N15)
N-linked glycosylation acceptor site in the HN protein, which appears to be host specific.
Whether all of the potential N-linked glycan sites are glycosylated awaits future studies. Both
Texas81 and ISU92 viruses contained the conserved NRKSCS neuraminidase active site motif
(Jorgensen et al., 1987). Up to date, all analyzed members of Respirovirus and Rubulavirus had
this sequence (Langedijk et al., 1997).
The sequence analysis showed that Texas81 and ISU92 had higher levels of identity with
bPIV3 than hPIV1 or hPIV3. The 100% identity at nucleotide level between the F protein of
Texas81 and the SF strain of bPIV3 indicated that cross species transmission might occur among
different hosts. However, further studies will be needed to confirm this. On the other hand,
ISU92, which was closely related to the SK217 and 910N strains of bPIV3, possessed host-
84
specific amino acid residues in the F and HN proteins differing from both bPIV3 strains. There
were three host specific amino acid residues (Y100, A437, and V501) in F protein and 3 in the
HN protein (K70, S88 and S387) of ISU92 strain, compared to bPIV3 and hPIV3 (Figures 3 and
4). bPIV3 strains SK217 and SF/Ka were shown to differ in virulence (Breker-Klassen et al.,
1996; Shibuta et al., 1981). This virulence difference had been associated with a change in amino
acid 193 in HN protein which had a dramatic effect on syncytium inducing activity,
neuraminidase activity and hemagglutinating activity (Breker-Klassen et al., 1996). ISU92 had I
at this position, unlike SK217 or 910N, but identical with Texas81 and bPIV3-SF/Ka. Further,
ISU92 strain was more fusogenic than the Texas81 strain. The importance of these residues in
host specificity awaits future reverse genetic studies.
2.3.6 Phylogenetic analysis
Phylogenetic analyses of the full length F and HN genes of these viruses with other
members of the Paramyxoviridae were performed by parsimony analysis. Phylogenetic analysis
of Texas81 and ISU92 based on the deduced amino acid sequences of the F and HN proteins
placed them on the same clade along with bPIV3 (Figure 5). Recently, it has been reported that
there are two genotypes of bPIV3: genotype A and genotype B (Horwood et al., 2008). However,
two subgenotypes of bPIV3 were discernible in genotype A; one represented by 910N-like
viruses and the other represented by Ka, and SF viruses. The Texas81 and SF/Ka strains formed
the first genetic group while ISU92 and 910N strains formed the second genetic group.
Phylogenetic reconstruction with HN gene also confirmed these groupings. Antigenic analysis by
IFA has also confirmed that there are subtypic differences between bPIV3 and sPMV strains as
85
well. The above facts support the classification of these two swine viruses in the genus
Respirovirus, Paramyxovirinae subfamily.
The phylogenetic analyses also indicated that these two strains are very likely the host-
adapted variant strains transmitted from cattle to pigs. The host-specific sequence elements
might contribute to the growth of the virus in heterogeneous hosts (Bailly et al., 2000). Cross-
species infection of bPIV3 in a human (Ben-Ishai et al., 1980), bPIV3 in sheep and ovine PIV-3
in cattle (Stevenson and Hore, 1970) has been reported. This happens to be the first report of
cross-species infection of bPIV3 in pigs. Several studies using reverse genetic system to recover
recombinant PIV3 have been successfully constructed and employed including hPIV3 and bPIV3
(Skiadopoulos et al., 1998; Skiadopoulos et al., 1999). Similar approaches can be undertaken to
determine the importance of the individual or combined effects of host-specific sequence
changes in the pathogenesis and host-adaptation of bPIV3. Further, this would also help in
developing an attenuated phenotype as a vaccine candidate for these viruses.
2.4 Acknowledgments
The authors thank Dr. X. J. Meng, Dr. Laure Deflube, Shobana Raghunath, Thomas
Rogers-Cotrone and Vrushali Chavan and for their excellent technical assistance.
86
2.5 References
Archetti, I. and F. L. Horsfall, Jr. (1950). "Persistent antigenic variation of influenza A viruses
after incomplete neutralization in ovo with heterologous immune serum." J Exp Med
92(5): 441-62.
Bailly, J. E., J. M. McAuliffe, et al. (2000). "Sequence determination and molecular analysis of
two strains of bovine parainfluenza virus type 3 that are attenuated for primates." Virus
Genes 20(2): 173-82.
Baker, K. A., R. E. Dutch, et al. (1999). "Structural basis for paramyxovirus-mediated membrane
fusion." Mol Cell 3(3): 309-19.
Basler, C. F., A. Garcia-Sastre, et al. (2005). "A novel paramyxovirus?" Emerg Infect Dis 11(1):
108-12.
Ben-Ishai, Z., V. Naftali, et al. (1980). "Human infection by a bovine strain of parainfluenza
virus type 3." J Med Virol 6(2): 165-8.
Bowden, T. R. and D. B. Boyle (2005). "Completion of the full-length genome sequence of
Menangle virus: characterisation of the polymerase gene and genomic 5' trailer region."
Arch Virol 150(10): 2125-37.
Breker-Klassen, M. M., D. Yoo, et al. (1996). "Comparisons of the F and HN gene sequences of
different strains of bovine parainfluenza virus type 3: relationship to phenotype and
pathogenicity." Can J Vet Res 60(3): 228-36.
Brooksby, J. B. (1967). Variants and immunity: definitions for serological investigation.
International Symposium on foot-and-mouth disease: variants and immunity, Lyon,
France.
87
Chadha, M. S., J. A. Comer, et al. (2006). "Nipah virus-associated encephalitis outbreak,
Siliguri, India." Emerg Infect Dis 12(2): 235-40.
Chant, K., R. Chan, et al. (1998). "Probable human infection with a newly described virus in the
family Paramyxoviridae. The NSW Expert Group." Emerg Infect Dis 4(2): 273-5.
Chua, K. B., W. J. Bellini, et al. (2000). "Nipah virus: a recently emergent deadly
paramyxovirus." Science 288(5470): 1432-5.
Chua, K. B., L. F. Wang, et al. (2001). "Tioman virus, a novel paramyxovirus isolated from fruit
bats in Malaysia." Virology 283(2): 215-29.
Chua, K. B., L. F. Wang, et al. (2002). "Full length genome sequence of Tioman virus, a novel
paramyxovirus in the genus Rubulavirus isolated from fruit bats in Malaysia." Arch Virol
147(7): 1323-48.
Coelingh, K. J., C. C. Winter, et al. (1986). "Conserved epitopes on the hemagglutinin-
neuraminidase proteins of human and bovine parainfluenza type 3 viruses: nucleotide
sequence analysis of variants selected with monoclonal antibodies." J Virol 60(1): 90-6.
Crennell, S., T. Takimoto, et al. (2000). "Crystal structure of the multifunctional paramyxovirus
hemagglutinin-neuraminidase." Nat Struct Biol 7(11): 1068-74.
Ellis, J., L. Hassard, et al. (1998). "Isolation of circovirus from lesions of pigs with postweaning
multisystemic wasting syndrome." Can Vet J 39(1): 44-51.
Ferraris, O., N. Kessler, et al. (2005). "Sensitivity of influenza viruses to zanamivir and
oseltamivir: a study performed on viruses circulating in France prior to the introduction
of neuraminidase inhibitors in clinical practice." Antiviral Res 68(1): 43-8.
Field, H. E., A. C. Breed, et al. (2007). "Epidemiological perspectives on Hendra virus infection
in horses and flying foxes." Aust Vet J 85(7): 268-70.
88
Gardner, A. E. and R. E. Dutch (2007). "A conserved region in the F(2) subunit of
paramyxovirus fusion proteins is involved in fusion regulation." J Virol 81(15): 8303-14.
Heinen, E., W. Herbst, et al. (1998). "Isolation of a cytopathogenic virus from a case of porcine
reproductive and respiratory syndrome (PRRS) and its characterization as parainfluenza
virus type 2." Arch Virol 143(11): 2233-9.
Horvath, C. M., R. G. Paterson, et al. (1992). "Biological activity of paramyxovirus fusion
proteins: factors influencing formation of syncytia." J Virol 66(7): 4564-9.
Horwood, P. F., J. L. Gravel, et al. (2008). "Identification of two distinct bovine parainfluenza
virus type 3 genotypes." J Gen Virol 89(Pt 7): 1643-8.
Hosaka, M., M. Nagahama, et al. (1991). "Arg-X-Lys/Arg-Arg motif as a signal for precursor
cleavage catalyzed by furin within the constitutive secretory pathway." J Biol Chem
266(19): 12127-30.
Hsu, V. P., M. J. Hossain, et al. (2004). "Nipah virus encephalitis reemergence, Bangladesh."
Emerg Infect Dis 10(12): 2082-7.
Jack, P. J., D. B. Boyle, et al. (2005). "The complete genome sequence of J virus reveals a
unique genome structure in the family Paramyxoviridae." J Virol 79(16): 10690-700.
Janke, B. H., P. S. Paul, et al. (2001). "Paramyxovirus infection in pigs with interstitial
pneumonia and encephalitis in the United States." J Vet Diagn Invest 13(5): 428-33.
Jorgensen, E. D., P. L. Collins, et al. (1987). "Cloning and nucleotide sequence of Newcastle
disease virus hemagglutinin-neuraminidase mRNA: identification of a putative sialic acid
binding site." Virology 156(1): 12-24.
Jun, M. H., N. Karabatsos, et al. (1977). "A new mouse paramyxovirus (J virus)." Aust J Exp
Biol Med Sci 55(6): 645-7.
89
Karabatsos, N. (1985). International Catalogue of Arboviruses. San Antonio, Texas, American
Society of Tropical Medicine and Hygiene.
Klenk, H. D. and W. Garten (1994). "Host cell proteases controlling virus pathogenicity." Trends
Microbiol 2(2): 39-43.
Kohn, A. and P. Fuchs (1969). "Cell fusion by various strains of Newcastle disease virus and
their virulence." J Virol 3(5): 539-40.
Lamb RA, C. P., Kolakofsky D, Melero JA, Nagai Y, Oldstone MBA, Pringle CR, Rima BK
(2005). Family Paramyxoviridae. San Diego, Elsevier Acedemic Press.
Langedijk, J. P., F. J. Daus, et al. (1997). "Sequence and structure alignment of Paramyxoviridae
attachment proteins and discovery of enzymatic activity for a morbillivirus
hemagglutinin." J Virol 71(8): 6155-67.
Lawrence, M. C., N. A. Borg, et al. (2004). "Structure of the haemagglutinin-neuraminidase
from human parainfluenza virus type III." J Mol Biol 335(5): 1343-57.
Li, Z., M. Yu, et al. (2006). "Beilong virus, a novel paramyxovirus with the largest genome of
non-segmented negative-stranded RNA viruses." Virology 346(1): 219-28.
Linne, T., M. Berg, et al. (1992). "The molecular biology of the porcine paramyxovirus LPMV."
Vet Microbiol 33(1-4): 263-73.
Moreno-Lopez, J., P. Correa-Giron, et al. (1986). "Characterization of a paramyxovirus isolated
from the brain of a piglet in Mexico." Arch Virol 91(3-4): 221-31.
Murray, K., P. Selleck, et al. (1995). "A morbillivirus that caused fatal disease in horses and
humans." Science 268(5207): 94-7.
Nollens, H. H., J. F. Wellehan, et al. (2008). "Characterization of a parainfluenza virus isolated
from a bottlenose dolphin (Tursiops truncatus)." Vet Microbiol 128(3-4): 231-42.
90
Nylund, S., M. Karlsen, et al. (2008). "The complete genome sequence of the Atlantic salmon
paramyxovirus (ASPV)." Virology 373(1): 137-48.
Ortmann, D., M. Ohuchi, et al. (1994). "Proteolytic cleavage of wild type and mutants of the F
protein of human parainfluenza virus type 3 by two subtilisin-like endoproteases, furin
and Kex2." J Virol 68(4): 2772-6.
Philbey, A. W., P. D. Kirkland, et al. (1998). "An apparently new virus (family
Paramyxoviridae) infectious for pigs, humans, and fruit bats." Emerg Infect Dis 4(2):
269-71.
Potier, M., L. Mameli, et al. (1979). "Fluorometric assay of neuraminidase with a sodium (4-
methylumbelliferyl-alpha-D-N-acetylneuraminate) substrate." Anal Biochem 94(2): 287-
96.
Robert A. Lamb, G. D. P. (2007). Paramyxoviridae: The Viruses and Their Replication. Fields
virology. D. M. K. Bernard N. Fields, Peter M. Howley, Diane E. Griffin. Philadelphia,
Lippincott Williams & Wilkins. One: 1449-1496.
Sakai, Y., S. Suzu, et al. (1987). "Nucleotide sequence of the bovine parainfluenza 3 virus
genome: its 3' end and the genes of NP, P, C and M proteins." Nucleic Acids Res 15(7):
2927-44.
Schomacker, H., P. L. Collins, et al. (2004). "In silico identification of a putative new
paramyxovirus related to the Henipavirus genus." Virology 330(1): 178-85.
Shibuta, H., T. Kanda, et al. (1981). "Parainfluenza 3 virus: plaque-type variants lacking
neuraminidase activity." Infect Immun 34(1): 262-7.
91
Skiadopoulos, M. H., A. P. Durbin, et al. (1998). "Three amino acid substitutions in the L protein
of the human parainfluenza virus type 3 cp45 live attenuated vaccine candidate contribute
to its temperature-sensitive and attenuation phenotypes." J Virol 72(3): 1762-8.
Skiadopoulos, M. H., T. Tao, et al. (1999). "Generation of a parainfluenza virus type 1 vaccine
candidate by replacing the HN and F glycoproteins of the live-attenuated PIV3 cp45
vaccine virus with their PIV1 counterparts." Vaccine 18(5-6): 503-10.
Stevenson, R. G. and D. E. Hore (1970). "Comparative pathology of lambs and calves infected
with parainfluenza virus type 3." J Comp Pathol 80(4): 613-8.
Storey, D. G., K. Dimock, et al. (1984). "Structural characterization of virion proteins and
genomic RNA of human parainfluenza virus 3." J Virol 52(3): 761-6.
Suzu, S., Y. Sakai, et al. (1987). "Nucleotide sequence of the bovine parainfluenza 3 virus
genome: the genes of the F and HN glycoproteins." Nucleic Acids Res 15(7): 2945-58.
Tong, S., M. Li, et al. (2002). "Regulation of fusion activity by the cytoplasmic domain of a
paramyxovirus F protein." Virology 301(2): 322-333.
Wang, L., B. H. Harcourt, et al. (2001). "Molecular biology of Hendra and Nipah viruses."
Microbes Infect 3(4): 279-87.
Wechsler, S. L., D. M. Lambert, et al. (1985). "Intracellular synthesis of human parainfluenza
type 3 virus-specified polypeptides." J Virol 54(3): 661-4.
Yin, H. S., R. G. Paterson, et al. (2005). "Structure of the uncleaved ectodomain of the
paramyxovirus (hPIV3) fusion protein." Proc Natl Acad Sci U S A 102(26): 9288-93.
Zhao, X., M. Singh, et al. (2000). "Structural characterization of the human respiratory syncytial
virus fusion protein core." Proc Natl Acad Sci U S A 97(26): 14172-7.
92
2.6 Tables
Table 1. Antigenic relationship of ISU92 and Texas81 with other paramyxoviruses
Antibody Titer of Antisera to Viruses by IFA*
Virus ISU92 hPIV
1 hPIV2 hPIV3
hPIV4
A
hPIV
4 B
hPIV
5 LPMV bRSV Texas81
bPIV3
-SF
ISU92 1:1280 1:640 < 1:20 1:320 < 1:20 1:20 1:20 < 1:20 < 1:20 1:320 1:640
hPIV1 < 1:20 < 1:20
hPIV2 < 1:20 < 1:20 1:320 < 1:20 1:80 ≥ 1:80 ≥ 1:80 < 1:20 < 1:20 < 1:20 < 1:20
hPIV3
hPIV4A < 1:20 < 1:20 ≥ 1:80 < 1:20 1:640 ≥ 1:80 ≥ 1:80 < 1:20 < 1:20 < 1:20 < 1:20
hPIV4B < 1:20 1:40 1:320 < 1:20 1:640 1:640 1:640 < 1:20 < 1:20 < 1:20 < 1:20
hPIV5 < 1:20 < 1:20 ≥ 1:160 < 1:20 ≥ 1:80 ≥ 1:80 1:640 < 1:20 < 1:20 < 1:20 < 1:20
LPMV < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 1:1280 < 1:20 < 1:20 < 1:20
bRSV < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 1:2560 < 1:20 < 1:20
Texas81 1:640 1:320 < 1:20 1:640 < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 1:640 1:1280
bPIV3-SF 1:640 < 1:20 < 1:20 1:1280 < 1:20 < 1:20 < 1:20 < 1:20 < 1:20 1:1280 1:2560
*Indirect fluorescent antibody test was performed at the National Veterinary Services Laboratory,
Ames, IA against a panel of paramyxoviruses.
93
Table 2. Comparison of the gene-start and gene-end sequences of sPMV, bPIV3 and
hPIV3.
Gene Strain Gene-start Gene-end
F
Texas81 UCCUAGUUUCa UUCAUGUUUUUU
ISU92 UCCUAGUUUC UUCAUGUUUUUU
bPIV3-SF/Ka UCCUAGUUUC UUCAUGUUUUUU
bPIV3-910? UCCUAGUUUC UUCAUGUUUUUU
hPIV3 UCCUGUUUUC CUAAUAUUUUUU
H?
Texas81 UCCUUGUUUC UUAUUAUUUUUUb
ISU92 UCCUUGUUUC UUAAUGUUUUUU
BPIV3-Ka/SF UCCUUGUUUC UUAUUAUUUUUU
BPIV3-910? UCCUUGUUUC UUAAUGUUUUUU
hPIV3 UCCUCAUUUC UUUAUAUUUUUU
Consensus: UCCUNNUUUC NUNNUNUUUUUU
a. Host-specific nucleotide residues between hPIV3 and bPIV3 are underlined;
b. Positions that display variability within the host group are in bold-face type.
94
Table 3. Comparison of nucleotide sequences between sPMV, bovine and human PIV3
viruses.
Gene Virus ?ucleotide Amino acid 3'UTR(nt) ORF(nt) 5' UTR(nt)
F
Texas81 1869 540 211 1620 38
ISU92 1893 540 235 1620 38
bPIV3-SF/Ka 1869 540 211 1620 38
bPIV3-910N 1893 540 235 1620 38
hPIV3 1851 539 193 1617 41
H?
Texas81 1888 572 73 1716 99
ISU92 1888 572 73 1716 99
bPIV3 1888 572 73 1716 99
hPIV3 1888 572 73 1716 99
95
Table 4. ?ucleotide and Amino acid identities between sPMV, bPIV3 and hPIV3
Virus Strain F H?
?ucleotide Amino acid ?ucleotide Amino acid
Texas81
bPIV3-910N 91.4% 95.2% 91.8% 96.2%
bPIV3-SK217 92.2% 95.9% 92.1% 96.2%
bPIV3-SF 100.0% 100.0% 99.8% 99.8%
bPIV3-Ka 97.8% 98.3% 98.3% 98.3%
hPIV3 82.2% 82.7% 80.1% 76.4%
ISU92
bPIV3-910N 98.0% 98.9% 98.3% 98.8%
bPIV3-SK217 98.7% 99.1% 98.4% 99.1%
bPIV3-SF 90.9% 95.0% 91.7% 95.8%
bPIV3-Ka 91.0% 95.6% 91.4% 94.9%
hPIV3 82.0% 82.5% 82.7% 77.6%
2.7 Figures
Figure 1. Ultrastructure of swine paramyxoviruses.
with 1% phosphotungstic acid and viewed under a transmission electron microscope. (A
ISU92 virus, (B, D) Texas81 virus.
representing the viral glycoprotein spikes. Highly ple
nucleocapsids were indicated by arrow b. Nucleocapsids exhibit a typical “herringbone” pattern.
A
b
C
96
Figure 1. Ultrastructure of swine paramyxoviruses. Purified virions were negatively stained
ith 1% phosphotungstic acid and viewed under a transmission electron microscope. (A
ISU92 virus, (B, D) Texas81 virus. Intact virion with fine surface projections (arrow a)
representing the viral glycoprotein spikes. Highly pleiomorphic viral particles with extruded
nucleocapsids were indicated by arrow b. Nucleocapsids exhibit a typical “herringbone” pattern.
B
a
96K
a
b
D
57K
96K
96K
Purified virions were negatively stained
ith 1% phosphotungstic acid and viewed under a transmission electron microscope. (A, C)
Intact virion with fine surface projections (arrow a)
with extruded
nucleocapsids were indicated by arrow b. Nucleocapsids exhibit a typical “herringbone” pattern.
E D
A B
G H
J 1 2
97
C
F
I H
3
98
Figure 2. (A-C) Syncytium formation in Vero cells by Texas81 and ISU92. The fusogenicity
of Texas81 and ISU92 viruses was examined in Vero cells. A. ISU92; B. Texas81; C. Mock-
infected Vero cells. (D-F) Plaque Assay. Confluent Vero cells in 6-well plates were infected
with serially diluted virus stocks and then overlaid with 0.8% methyl cellulose in DMEM with
2% FBS. Plaque sizes of Texas81 and ISU92 viruses were similar D. ISU92; E. Texas81; F.
mock infected. (G-J) Antigenic analysis of swine paramyxoviruses. (G-I) Indirect fluorescence
antibody assay was performed by infecting Vero cells with swine paramyxoviruses at a MOI of
1.0, 0.1, and 0.01. Virus-specific antigens to the swine viruses were probed with anti-BPIV3
polyclonal bovine antibody (NVSL) (1:100 dilution) followed by anti-bovine FITC-conjugated
antibody. (G) ISU-92, (H) Texas-81, (I) mock infected Vero cells. (J) Optiprep purified virions
of Texas81 (Lane 2) and ISU92 (Lane 3) were used for immunoblotting. The viral proteins were
probed with anti-bPIV3 polyclonal bovine antibody (NVSL), followed by HRP labeled anti-
bovine IgG (KPL) secondary antibodies.
99
Figure 3. Schematic of the predicted domain structure of the swine paramyxovirus F0
protein. Identification of conserved block in F1 (CBF1), conserved block in F2 (CBF2) and
fusion peptide (FP) (Gardner and Dutch, 2007; Yin et al., 2005) regions were obtained from
structure based sequence alignment of the F protein of sPMV with other paramyxoviruses.
Domains are indicated as DI to DIII. TM indicates transmembrane domain. HRA, HRB, and
HRC indicate heptad repeat regions. Conserved amino acid residues are shaded.
CBF1
Texas81 GGLIANCITTTCTCNGIDNRINQSPDQGIKIIT 413
ISU92 GGLIANCITTTCTCNGVDNRINQSPDQGIKIIT 413
bPIV3-SF GGLIANCITTTCTCNGIDNRINQSPDQGIKIIT 413
bPIV3-910N GGLIANCITTTCTCNGVDNRINQSPDQGIKIIT 413
hPIV3 GGVVANCITTTCTCNGIGNRINQPPNQGVKIIT 413
NDV GSVIANCKMTTCRCVNPPGIISQNYGEAVSLID 421
Mump GTIVANCRSLTCLCKSPSYPIYQPDHHAVTTID 406
SV5 GIVYANCRSMLCKCMQPAAVILQPSSSPVTVID 406
Sendai GGVVANCIASTCTCGTGRRPISQDRSKGVVFLT 420
NiV GVLFANCISVTCQCQTTGRAISQSGEQTLLMID 413
HeV GVLFANCISVTCQCQTTGRAISQSGEQTLLMID 413
400 200 300 500 100
HRA D III D I D II HRB TM FP D I D III HRC
110 134 497 517
Texas81 LILSLIPKIENS-HSCGDQQINQYKKLLDRLIIPLYDGLK 95
ISU92 LILSLIPKIENS-HSCGDQQINQYKKLLDRLIIPLYDGLK 95
bPIV3-SF LILSLIPKIENS-HSCGDQQINQYKKLLDRLIIPLYDGLK 95
bPIV3-910N LILSLIPKIENS-HSCGDQQINQYKKLLDRLIIPLYDGLK 95
hPIV3 LILSLIPKIEDS-NSCGDQQIKQYKRLLDRLIIPLYDGLR 95
NDV IIVKLLPNLPKDKEACAKAPLDAYNRTLTTLLTPLGDSIR 102
Mump IVVKLLPNIQPTDNSCEFKSVTQYNKTLSNLLLPIAENIN 88
SV5 IVVKLMPTIDSPISGCNITSISSYNATVTKLLQPIGENLE 88
Sendai IVLSLVPGIDLE-NGCGTAQVIQYKSLLNRLLIPLRDALD 102
NiV IVIKMIPNVSNM-SQCTGSVMENYKTRLNGILTPIKGALE 95
HeV IVIKMIPNVSNV-SKCTGTVMENYKSRLTGILSPIKGAIE 95
CBF2
F2 F1 S - S C63 C192
Texas81 LRTKRF 110
ISU92 SRTKRF 110
bPIV3-SF LRTKRF 110
bPIV3-910N SRTKRF 110
hPIV3 PRTKRF 110
NDV GRQGRL 117
Mump RRHKRF 103
SV5 RRRRRF 103
Sendai VPQSRF 117
NiV VGDVRL 110
HeV VGDVKL 110
Cleavage site
aa
100
(A)
(B)
Conserved Active Site Residues
hPIV3 ?DV SV5 sPMV
R1 192 174 163 192
R4 424 416 405 424
R5 503 498 495 503
Y6 530 526 523 530
E4 409 401 390 409
E6 549 547 544 549
D1 216 198 187 216
Figure 4. Schematic of the H? protein globular head region domain structure of swine
paramyxovirus. (A) The transmembrane domain, sialic acid site (NRKSCS motif) and the
predicted alpha helix regions (Garnier-Robson) of swine paramyxovirus were given as colored
boxes (Crennell et al., 2000). Disulfide bonds followed those used in a structure-based sequence
alignment and the crystal structure of NDV HN protein (Crennell et al., 2000). (B) The
corresponding position of the active site residues in the deduced amino acid sequence of the
sPMV and other paramyxoviruses.
400 200 300 500 100
Y
Z A A
C C
Y
E
E
D
F F Z
D
Sialic acid binding site (aa 252-257)
Transmembrane domain (aa 36-54)
C159 C190 C214 C256 C269 C350 C355
C363
C463 C469
C473
C535 C544 C571
α2 α3 TM α 1
I193
aa
(A)
Figure 5. Phylogenetic analysis.
4.01) software with 1000 bootstrap replicates. (A) Phylogenetic analysis based on F gene
deduced amino acid sequences compared to other
Phylogenetic analysis of PIV3 genotypes based on F and HN gene sequences, respectively.
101
. Phylogenetic analysis. Phylogenetic analysis was performed using Parsimony (PAUP
4.01) software with 1000 bootstrap replicates. (A) Phylogenetic analysis based on F gene
deduced amino acid sequences compared to other Paramyxoviridae family members. (B, C
Phylogenetic analysis of PIV3 genotypes based on F and HN gene sequences, respectively.
Unclassified
Phylogenetic analysis was performed using Parsimony (PAUP
4.01) software with 1000 bootstrap replicates. (A) Phylogenetic analysis based on F gene
family members. (B, C)
Phylogenetic analysis of PIV3 genotypes based on F and HN gene sequences, respectively.
102
(B)
(C)
hPIV3-GPv
hPIV3-JS bPIV3-Q5592
bPIV3-SF
Texas81
bPIV3-Ka
bPIV3-910?
ISU92
bPIV3-SK217
100 100
100
100
90
100
bPIV3 Genotype B
hPIV3
bPIV3
Genotype A
bPIV3-
910?
ISU92 bPIV3-
SK217 hPIV3-
JS
hPIV3-
GPv
bPIV3-
Q5592
bPIV3-
SF
Texas81
bPIV3-
Ka
100
100
100
77
93 bPIV3 Genotype B
hPIV3
bPIV3 Genotype A
103
Chapter 3
Complete Genome Sequence and Pathogenicity of Two Swine
Parainfluenzaviruses Isolated From Pigs in the United States
Dan Qiao1, Bruce H. Janke
2, Subbiah Elankumaran
1.
1Virginia-Maryland Regional College of Veterinary Medicine, Virginia Polytechnic Institute and
State University, Blacksburg, VA.
2Dept. of Veterinary Diagnostic & Production Animal Medicine, College of Veterinary
Medicine, Iowa State University, Ames, IA.
This manuscript is under review in Journal of Virology
104
Abstract
Two novel paramyxoviruses 81-19252 (Texas81) and 92-7783 (ISU92) were isolated
from pigs that experienced respiratory and central nervous system disease in the 1980s and 1990s
from South and North Central United States. The complete genome of Texas81 virus was 15456
nucleotides (nt) and ISU92 was 15480 nt in length consisting of six non-overlapping genes
coding for the nucloeo- (N), phospho- (P), matrix (M), fusion (F), hemagglutinin-neuraminidase
(HN) and large polymerase (L) protein in the order 3'-N-P/C/V-M-F-HN-L-5'. The features
related to virus replication and found to be conserved in most members of Paramyxoviridae were
also found in swine viruses. These include: conserved and complementary 3’ leader and 5’ trailer
regions, trinucleotide intergenic sequences, highly conserved gene start and gene stop signal
sequences. The length of each gene of these two viruses were similar except for the F gene, in
which ISU92 had an additional 24 nt “U” rich 3’ untranslated region (UTR). The P gene of these
viruses were predicted to express P protein from the primary transcript and edit a portion of its
mRNA to encode V and D proteins, and the C protein was expected to be expressed from an
alternate translation initiation codon from the P gene as in respiroviruses. Sequence specific
features related to virus replication and host specific amino acid signatures in viral proteins
indicated that these viruses probably originated from bovine parainfluenzavirus 3. Pairwise
comparison of deduced amino acid sequences of swine viral proteins with members of
Paramyxoviridae and phylogenetic analysis based on the individual gene as well as predicted
amino acid sequences suggested that these swine parainfluenzaviruses (sPIV3) are novel
members of the genus Respirovirus of the Paramyxovirinae subfamily and can be grouped into
two subgenotypes of genotype A of bovine parainfluenza virus 3. The mild clinical signs and
undetectable gross and microscopic lesions observed in sPIV3-infected pigs indicate the
105
inapparent nature of these viruses in conventionally reared pigs. Seroprevalence studies in serum
samples collected from pig farms in Minnesota and Iowa in 2007-2008 by indirect ELISA
revealed that sPIV3 are not circulating in these farms. The mild pathogenicity of sPIV3 can
facilitate its development as a vaccine vector.
106
3.1 Introduction
Outbreaks of many novel paramyxoviruses causing catastrophic illnesses have been
reported all over the world in the last few decades. A large and diverse host species are involved,
including avian, porcine, canine, bovine, equine, ovine, human, reptiles and aquatic species
(Franke et al., 2001; Horwood et al., 2008; Nollens et al., 2008; Nylund et al., 2007; Nylund et
al., 2008; Robert A. Lamb, 2007). Cases of cross-species transmission and pathogen jumping to
humans were also reported (Chua et al., 1999; Field et al., 2007a), demonstrating the value of
characterizing new animal pathogens, even if their pathogenic potential was currently unknown.
Prior to 1990s, only La Piedad Michoacán paramyxovirus (LPMV) has been well studied as a
neurotropic paramyxovirus isolated from pigs. Many paramyxoviruses as porcine pathogen have
been reported since 1950s all over the world, including Japan (Philbey et al., 1998), Canada
(Ellis et al., 1998), Israel (Janke et al., 2001) as well as the United States in Texas (Janke et al.,
2001). There was also concurrent infection of porcine reproductive and respiratory syndrome
virus (PRRSV) and a paramyxovirus in Germany in the 1990s (Heinen et al., 1998) that has been
subsequently named “SER” virus (Tong et al., 2002). Four bat-associated paramyxoviruses were
reported to cause animals and human diseases in 1994 (Wang et al., 2001). Hendra virus (HeV)
and Nipah virus (NiV), which were identified to cause an outbreak of severe respiratory disease
and death in horses and their trainer, and severe febrile encephalitis and death in pigs and
farmers, respectively, have been classified as Henipavirus as a genus in subfamily
Paramyxovirinae (Chadha et al., 2006; Chua et al., 2000; Field et al., 2007a; Hsu et al., 2004;
Murray et al., 1995).
Some recently isolated viruses, such as Menangle virus (MenV) (Philbey et al., 1998),
107
Tupaia paramyxovirus (TPMV) (Tidona et al, 1999), Tioman virus (TioV) (Chua et al., 2001),
Mossman virus (MoV) (Miller et al, 2003) J-virus (J-V) (Jack et al., 2005; Jun et al., 1977),
Beilong virus (BeV) (Li et al., 2006b), Mapuera virus (MPRV) (Karabatsos, 1985), T. truncates
parainfluenza virus type 1 (TtPIV-1) isolated from bottlenose dolphins (Nollens et al., 2008), and
Atlantic salmon paramyxovirus (ASPV) (Nylund et al., 2008) remain unclassified below
subfamily level. Most of them have been well characterized genetically, and complete genome
sequences are available. All members of the subfamily Paramyxovirinae, have six invariant
genes in the order 3′– N – P – M – F – A – L –5′, indicating the nucleocapsid, phospho-, matrix,
fusion, attachment and large polymerase proteins, respectively (Lamb and Parks, 2007).
Recently, we have reported the antigenic and molecular characterization of glycoprotein
genes of two novel swine parainfluenza type 3 viruses (sPIV3) isolated from the pigs that
experienced respiratory and central nervous system (CNS) disease (Qiao et al., 2009). These two
sPIV3 strains were antigenically and genetically closely related to bovine parainfluenzavirus 3
(bPIV3) and were closely related to the genus Respirovirus (Qiao et al., 2009). However, the
pathogenicity of these sPIV3 in conventionally reared pigs and the complete genome sequences
of these isolates are presently unknown.
In cattle, bPIV3 infection results in asymptomatic infection to severe respiratory disease,
but no neurological disease has been reported due to bPIV3 in cattle (Dinter and Morein, 1990).
Limited sequence polymorphism has been reported among bPIV3 strains (Coelingh and Winter,
1990; Swierkosz et al., 1995). Recently, after analysis of Australian isolates of bPIV3, two
distinct genotypes of bPIV3: genotypes A and B, have been proposed (Horwood et al., 2008). In
this study, we have performed a complete genome sequence analysis of these novel sPIV3 and
108
determined their pathogenicity in conventionally reared pigs. Our analysis indicated that there
are two distinct genetic groupings discernible within genotype A, represented by bPIV3 shipping
fever strain (bPIV3-SF)-like and bPIV3 910N strain (bPIV3-910N)-like viruses with one swine
virus strain in each of these groups. Several species-specific amino acid residues were identified
that may dictate host range. But, both swine viruses induced a very mild respiratory illness
without any neurological signs in young piglets, suggesting that co-infection with other
infectious agents or the presence of other environmental factors may be required to precipitate
clinical disease.
3.2 Materials and Methods
3.2.1 Viruses and Cells
Texas 81-19252 (Texas81), and ISU-92-Minnesota isolate 92-7783 (ISU92) viruses were
obtained from the National Veterinary Services Laboratory (NVSL), Animal and Plant Health
Inspection Service (APHIS), United States Department of Agriculture (USDA), Ames, Iowa.
Porcine Kidney (PK15) cells, tested free of porcine circovirus (PCV) were obtained from Dr. X.
J. Meng, Virginia Polytechnic Institute and State University, and used to propagate these viruses
for the first three passages. Vero cells (ATCC #CCL-81) were used for all other tests as
described earlier (Qiao, Janke et al, 2009).
109
3.2.2 Reverse Transcription (RT)-Polymerase Chain Reaction (PCR) and Sequencing
RNA extraction and reverse transcription (RT) reactions were performed using standard
procedures. Briefly, virus-infected PK15 cells were scraped into the medium and subjected to
three cycles of freezing and thawing. After initial clarification at 3000 x g for 15 min,
polyethylene glycol (PEG) 8000 (Sigma) was added to the cell lysate to a concentration of 10 %
and the lysate was incubated for 4 h at 4 °C. The virus was pelleted at 12, 000 x g for 60 min at 4
°C, and the viral genomic RNA was extracted from the virus pellet using RNeasy Mini Kit
(QIAgen). Oligonucleotide primers were designed based on consensus bPIV3 and hPIV3
nucleotide sequences (Table 1). Based on the sequencing results, new sets of oligonucleotide
primers were designed and primer-walking strategy was employed for sequencing the gap areas.
The leader and trailer sequences were determined according to the RACE method of Li et al (Li
et al., 2005). Briefly, a single set of adaptor and identical set of reagents were used. The two
RACE methods differ only in the order of adaptor ligation and cDNA synthesis. In the 5’ RACE,
adaptor ligation was carried out after cDNA synthesis whereas in the 3’ RACE the order was
reversed (Figure 1).
The complementary DNA (cDNA) copies of the genomic RNA of the two virus strains
were synthesized using the specific oligonucleotide primers and Superscript III reverse
transcriptase (Invitrogen). Subsequently, Platinum Taq DNA Polymerase (Invitrogen) was used
to amplify each fragment with the following cycling parameters: 94◦C for 4 min, followed by 30
cycles of 94◦ C for 30 seconds, 55
◦ C for 30 seconds, 72
◦ C for 1 minute, and a final 7 minutes
extension at 72◦ C. The PCR products were purified using Qiaquick PCR purification kit
(Qiagen). To ensure the consensus sequence, every nucleotide in the genome was sequenced
110
once from purified PCR products and at least from 3 independent TA clones in both directions in
an automated sequencer (Core Laboratory Facility at Virginia Bioinformatics Institute, Virginia
Tech).
3.2.3 Data Analysis
Nucleotide sequence editing, alignment, prediction of amino acid sequences and analyses
were conducted using the software package DNASTAR (Lasergene). Phylogenetic
reconstructions of these two viruses were performed using Parsimony (PAUP 4.01) (Swofford,
2002) software with 1000 bootstrap replicates.
3.2.4 Accession 3umbers for Sequence Analysis
The sequences of ISU92 and Texas81 were deposited in GenBank under accession #
EU439428 and EU439429, respectively. The accession numbers for other viral sequences used
for phylogenetic analysis are: Atlantic salmon paramyxovirus (ASPV), EF646380; Avian
metapneumovirus (aMPV), NC_007652; Avian paramyxovirus 2 (aPMV2), EU338414; Avian
paramyxovirus 6 (aPMV6), NC_003043; Beilong virus (BeV), NC_007803; Bovine
parainfluenza virus 3 strain 910N (bPIV3-910N), D84095; Bovine parainfluenza virus 3 strain
Kansas/15626/84 (bPIV3-Ka), AF178654; Bovine parainfluenza virus strain Q5592 (bPIV3-
Q5592), EU277658; Bovine parainfluenza virus 3 strain Shipping Fever (bPIV3-SF), AF178655;
Bovine respiratory syncytial virus (bRSV), NC_001989; Canine distemper virus (CDV),
111
NC_001921; Dolphin morbillivirus (DMV), NC_005283; Fer-de-lance virus (FDLV),
NC_005084; Hendra virus (HeV), AF017149; Human metapneumovirus (hMPV), NC_004148;
Human parainfluenza virus 1 strain Washington/1964 (hPIV1-Wa), NC_003461; Human
parainfluenza virus 2 (hPIV2), NC_003443; Human parainfluenza virus 3 (hPIV3), AB012132;
Human parainfluenza virus 3-GPv (hPIV3-GPv), NC_001796; Human parainfluenza virus 3-JS
(hPIV3-JS), Z11575; Human respiratory syncytial virus (hRSV), NC_001781; J-virus (J-V),
NC_007454; Measles virus (MeV), NC_001498; Menangle virus (MenV), NC_007620;
Mossman virus (MoV), NC_005339; Mumps virus (MuV), NC_002200; Newcastle disease virus
(NDV), NC_002617; Nipah virus (NiV), NC_002728; Peste-des-petits-ruminants virus (PPRV),
NC_006383; Pneumonia virus of mice, AY573818; Porcine Rubulavirus (PoRV/LPMV),
NC_009640; Rinderpest virus (RPV) (strain Kabete O), NC_006296; Sendai virus (SeV),
NC_001552; Simian parainfluenza virus 5 (SV5), NC_006430; Tioman virus (TioV),
NC_004074; Tupaia paramyxovirus (TPMV), NC_002199.
The consensus nucleotide sequence of hPIV3 Wash/47885/57 (hPIV3-Wa) was
assembled from individual gene sequences from GenBank (Bailly et al., 2000) including,
M11849 (N gene), M14552 (N gene), X04612 (N gene), M14890 (P gene), X04721 (P gene),
D00130 (M gene), M16458 (M gene), M16569 (M gene), Y00119 (M gene), M14892 (F gene),
S82195 (F gene), M21649 (F, HN, L gene and 5’ genomic termini), Z26523 (HN gene), M17641
(HN gene), M20402 (HN and partial L gene), X03967 (3’ genomic termini).
112
3. 2.5 Pathogenicity Studies in Pigs
A total of eighteen 6-weeks old Yorkshire crossbred pigs (less than 25 lbs body weight) were
obtained from the Swine facility at Virginia Tech and randomly divided into 3 groups of 6
piglets. They were determined to be free of antibodies to PRRSV, Swine influenza virus, and
PCV-2. The pigs were allowed to acclamatize for a week before the start of the experiment. The
rectal temperatures were recorded two times a day (morning and evening). Clinical signs were
observed three times a day (every 8 h) after inoculation until day 10. Treatment groups were
inoculated intranasally with 2 ml (5x107TCID50/ml) of virus stock with 1 ml in each nostril. The
control group was inoculated intranasally with 2 ml phosphate buffered saline (PBS) with 1 ml in
each nostril. From each of these groups, three pigs were euthanized on day 6 and 10,
respectively. The clinical signs were scored on a 0 to 3 scale for physical appearance (normal,
dull, lameness, recumbency), activity (alert, anorectic, mild response, no response), respiratory
signs (none, sneezing, heavy nasal discharge, dyspnea) and other signs/body weight loss (none,
<10% weight loss, 10-15% weight loss and >15% weight loss).
Blood was collected before inoculation and at necropsy. Serum was tested against the
respective virus strains by virus neutralization (VN) test as described (Battrell, 1995). Trachea,
lung, heart, brain, liver, spleen, and other internal organs were collected at necropsy, fixed in
10% neutral buffered formalin and used for histopathologic examination. Paraffin embedded
tissue sections were employed for immunohistochemistry using bovine anti-bPIV3-SF
polyclonal antiserum (NVSL, Ames, IA). Nasal and fecal swabs, blood, and 20% suspensions of
lung and brain were subjected to virus isolation in Vero cells. The serum samples were examined
by VN test in 96-well plates using homologous viruses.
113
3.2.6 Development of indirect Enzyme-linked immunosorbent assay (ELISA) for serology
The ISU92 virus stock prepared in Vero (1x108 pfu/ml) cells was used as an antigen to
coat the polystyrene ELISA plates (Nunclon). The optimum dilution of antigen and serum were
determined by checkerboard titration. The indirect ELISA is performed as follows: Briefly, a
pre-determined concentration of antigen in coating buffer (KPL, Kirkegaard & Perry
Laboratories, Inc.) was used to coat each well. The plates were then covered with parafilm and
incubated overnight at 4°C. The plates were washed once with wash buffer (KPL) in an ELISA
plate washer (TECAN, HydorFLEX). After blocking the unbound sites with a commercial
blocking buffer (KPL) for 1 h, 100ul of 1 in 50 dilution of serum was added and the plates were
incubated at 37°C for 1 h. Duplicate wells were set up for each sample and blank wells were set
up with only diluent buffer. The plates were then washed three times with a brief soak and shake
between each wash. The bound antigen-antibody complexes were probed with anti-species IgG
horseradish peroxidase (HRP) secondary antibody diluted 1:500 and the plate was incubated for
a further 1 h at 37°C. After washing the plates 3 times, 100 ul of TMB microwell substrate
(KPL) was used to develop color for 10 min and then 100 ul BlueSTOPTM
Solution (KPL) was
added to each well to stop the reaction. The absorbances were read at 650 nm immediately
(TECAN, Safire2). A cut-off value of two times the mean of negative serum absorbance + 1
standard deviation was chosen based on the results of checkerboard titrations with known
positive and negative sera samples. One hundred randomly selected pig serum samples from
different age groups obtained from 5 swine farms in Minnesota and Iowa in 2007-2008 were
screened for the presence of sPIV3 antibodies. The sera samples from pigs experimentally
inoculated with ISU92 or Texas81 were also subjected to ELISA. The mean values from
duplicate wells were used for analysis.
114
3.3 Results
3.3.1 Genome Features
The complete genome of Texas81 is 15456 nucleotides (nt) in length and 15480 nt for
ISU92. The genome length is divisible by six and consistent with the “rule of six” as described
for most other members of Paramyxoviridae (Calain and Roux, 1993; Kolakofsky et al., 1998;
Kolakofsky et al., 2005). The genome contains six discrete, non-overlapping transcription units.
The coding capacity of the genome is 93.3% in Texas81 and 93.2% in ISU92. Both viruses have
conserved gene start (GS), gene end (GE) and strictly conserved trinucleotide intergenic
sequence (IGS), for all the 6 genes compared to bPIV3 (Table 2). ISU92 shared the identical GS
and GE with bPIV3-910N strain, while Texas81 shared the identical GS and GE with bPIV3-
SF/Ka strain, except the GS of L gene, which is identical with bPIV3-910N strain.
The genomic temini of members of Paramyxoviridae are observed to have
complementarity between the 3′ and 5′ termini (Li et al., 2005). These conserved terminal
sequences, especially the first 12~13 nt, are believed to contain the genome and anti-genome
promoters essential for replication and transcription (Robert A. Lamb, 2007). The swine viruses
have a 55 nt 3’ leader before the transcription start site for the N gene, the length of which is
conserved among almost all of the members of subfamily Paramyxovirinae. The 5’ trailer of
swine viruses is 44 nt long following the L gene transcription stop site and the length is variable
among Paramyxovirinae subfamily but conserved among parainfluenza type 3 (PIV3) viruses.
Overall, the swine viruses possess a 96.4% (53 nt out of 55 nt) identity in the leader region with
bPIV3, while a 92.7% (51 nt out of 55 nt) identity with hPIV3. In trailer region, there is a 97.7%
(43 nt out of 44 nt) identity between swine viruses and bPIV3, and 90.9% (40 nt out of 44 nt)
115
identity with hPIV3. The exact complementarity at the first 14 nt of 3’ genomic leader and
overall 65.9% (ISU92)/63.6% (Texas81) complementarity (29(ISU92)/28 (Texas81) nt out of 44
nt) between the 3’ leader and 5’ trailer termini suggest conserved elements in the 3’ promoter
regions of the genome and antigenome (Figure 2).
3.3.2 Genome organization
The genome organization of swine viruses can best be described as 3’-N-P/V/D-M-F-
HN-L-5’ and can potentially encode 9 proteins. By inserting a broad distribution of Gs at the
mRNA editing site, V and D proteins were predicted to express from the P gene of both ISU92
and Texas81. The features of six genes and corresponding proteins of two viruses were shown in
Table 3. The identity of Texas81 with ISU92 genome is 94.1% at nucleotide level. The identity
between swine viruses and bPIV3 is 98.2% at the highest (between Texas81 and bPIV3-SF)
level, while the identity between swine viruses and hPIV3 is 80.1% at the highest (between
Texas81 and hPIV3-JS) level. Analysis of the start sites of each gene and the P gene editing site
of Texas81 and ISU92, and the hexamer phasing positions of “2,1,1,1,1,2,2”, which is shown to
be genus-specific within the Paramyxovirinae (Harcourt et al., 2001; Kolakofsky et al., 1998) are
identical with hPIV3 and bPIV3 (Table 4).
116
3.3.2.1 The %ucleoprotein (%) Gene
The N gene of both Texas81 and ISU92 is 1646 nt long and encodes a N protein of 515
amino acid (aa) long, with a predicted molecular weight (MW) of 57.3 k daltons (kDa) and pI of
5.0 (Texas81) and 5.2 (ISU92), respectively. The N protein tightly binds to the entire length of
genomic and antigenomic RNA to form the nucleocapsid and it is also associated with the
polymerase complex during transcription and replication. A highly conserved motif located near
the middle of all members of Paramyxovirinae N protein, which is thought to be essential in N-N
self assembly and N-RNA interaction process, is F-X4-Y-X3-Ø-S-Ø-A-M (where X is any
residue and Ø is an aromatic amino acid) (Myers et al., 1997b; Robert A. Lamb, 2007). This
motif is also seen within the central domain of the N protein of swine viruses, presented as
323FAPGNYPALWSYAM
336. In SeV and other paramyxoviruses, the first residue of this motif
F324 (annotated in SeV) is needed for correct self-assembly and another residue Y260
(annotated in SeV) (Myers et al., 1997b) is critical for N-viral RNA binding. These two residues
are conserved in swine viruses as F323 and Y259, respectively. The last 24% sequence of
carboxy terminal of N (aa 394 to 515) has a very low identity with other members of
Paramyxoviridae. This region with consistently low similarity is where most of the
phosphorylation and antigenic sites of the protein (Robert A. Lamb, 2007; Ruth A. Karron, 2007)
are located. The N protein of ISU92 and Texas81 has 97.1% amino acid sequence identity with
each other. When aligned with selected members from Paramyxoviridae, the identities decreased
in order: subfamily Paramyxovirinae, Respirovirus (60.6%-100%); Morbillivirus (18.9%-
23.4%); Henipavirus (19.8%-20.2%); Avulavirus (17.7%-20.6%); Rubulavirus (17.4%-19.2%);
subfamily Pneumovirinae, Metapneumovirus (11.5%-12.2%); Pneumovirus (11.1%-11.8%);
unclassified viruses, ASPV (23.4%-24.8%), BeV (23.3%-23.8%), J-V (20.2%-21.5%) (Table 5).
117
3.3.2.2 The Phosphoprotein (P) Gene and P/C/V Editing
The P gene of the two strains of sPIV3 is 1995 nt long with a major ORF of 1788 nt
encoding the large P protein of 596 aa long with a calculated size of 66.3 kDa (ISU92) and 69.2
kDa (Texas81) and pI of 5.4 and 5.6, respectively (Table 3). The sequence identity between two
sPMV P genes is 87.6% and when compared with other Paramyxoviruses P proteins, it is poorly
conserved (Table 5).
The N terminal of P protein of paramyxoviruses are heavily phosphorylated at serine and
threonine residues (Robert A. Lamb, 2007). There are 44 serine and 16 threonine residues in
Texas81 P protein and 50 serine and 17 threonine residues in ISU92 P protein identified as
potential phosphorylation sites using NetPhos 2.0 server (Blom et al., 1999)
(http://www.cbs.dtu.dk/services/%etPhos/).
The P gene contains an mRNA editing site, 5’AAAAAAGGG3’(mRNA sense) in both
Texas81 and ISU92 (794-802 nt), which is identical to those of other respiroviruses (Figure 3).
By sequencing at least 40 clones of cDNA from the mRNA of two strains, we found that
Texas81 had 1-4 G insertions while ISU92 had a broader distribution of G insertions, (1-9 Gs) at
the editing sites. The insertion of G residues during mRNA synthesis can shift the translational
reading frame and thus potentially generate V (+1/4/7 Gs) protein, predicted to be 412 aa long of
47.8 kDa in ISU92 and 46.7 kDa in Texas81, with identity of 83.3% between two strains, and D
(+2/5/8 Gs) protein, 367 aa long of 41.3 kDa in ISU92 and 41.5 kDa in Texas81 with identity of
84.0% between two strains. The predicted V and D proteins will be amino co-terminal with P
(+0/3/6/9 Gs) protein (first 241 aa). In sPIV3, the C protein is predicted to be initiated 10 nt
downstream of the P protein start codon by alternate translation initiation AUG codon and
118
predicted to be 201 aa long with MW of 23.6 kDa in ISU92 and 23.7 kDa in Texas81 with
identity of 91.1% between two strains.
At the C-terminal of V protein, sPIV3 contains all seven conserved invariantly placed
cysteine residues, highly conserved motifs H-R-R-E and W-C-N-P, known among
paramyxovirus V proteins (Figure 4). This cysteine-rich C-terminal is shown to be involved in
coordinating two zinc molecules per V protein and may play an important role in viral
pathogenesis and blocking of host interferon defense mechanisms (He et al., 2002; Patterson et
al., 2000; Poole et al., 2002; Robert A. Lamb, 2007).
3.3.2.3 The Matrix protein (M) Gene
The M gene is 1149 nt long with a single ORF of 1053 nt. The encoded protein is 351 aa
long with a predicted MW of 39.3 kDa and a pI of 9.5 (Texas81) and 9.6 (ISU92). The M protein
is the most abundant virion structural protein located in the inner surface of envelope. It interacts
with the cytoplasmic tails of the integral membrane proteins, lipid bilayer and the nucleocapsids,
and plays an important role in virion assembly, budding, release as well as transport of viral
components (Robert A. Lamb, 2007; Ruth A. Karron, 2007). M protein is considered to be the
most conserved parainfluenza viral protein (Spriggs et al., 1987). The nuclear localization signal
(NLS) (245
KMGRMYSVEYCKQKIEK261
) of M protein in swine viruses is highly conserved in
PIV3 (Coleman and Peeples, 1993; Peeples et al., 1992). The ISU92 virus M protein has 96.6%
amino acid sequence identity with Texas81. The amino acid sequence identity with members of
the other genera of Paramyxovirinae decreased in the following order: Respiroviruses (63.1%-
119
100%); Morbilliviruses (33.5%-37.2%); Henipaviruses (31.9%-32.7); Avulaviruses (17.9%-
22.9%); Rubulaviruses (18.1%-19.9%); with unclassified viruses, ASPV (39.2%-40.1%), J-V
(35.7%-36%), BeV (35.7%-36%). There was only less than 10% identity when sPIV3 were
compared with the members of Pneumovirinae.
3.3.2.4 The Fusion Protein (F) Gene and Hemagglutination-%euraminidase Protein (H%) Gene
We have recently reported the molecular characterization of the envelope glycoprotein
genes of these two swine viruses (Qiao et al., 2009). The molecular features of these two genes
are shown in Table 3. There were several amino acid changes in the antigenic sites of the F
protein differing from hPIV3 but conserved as in bPIV3. They include: E101N, V/T367I (only in
ISU92), S418Q, T492A, T513V.
3.3.2.5 The Large Polymerase Protein (L) Gene
The L gene of sPIV3 is 6795 nt long, with a major 6699 nt long ORF encoding a 2233 aa
protein with a pI of 6.3 for Texas81 or 6.2 for ISU92, and MW of 25.6 kDa. The L protein of
parainfluenzaviruses is the major RNA polymerase (RNAP) component and it is responsible for
nucleotide polymerization, mRNA capping, methylation and polyadenylation (Robert A. Lamb,
2007). It is proposed that there are six highly conserved domains (DI-DVI) in nonsegmented
negative-strand virus (NNSV) and each domain may be individually responsible for each of the
L protein multiple functions (Poch et al., 1990; Sidhu et al., 1993; Svenda et al., 1997). Pairwise
120
alignment of sPIV3 along with the other paramyxoviruses revealed all the six domains, highly
conserved A to D subdomains within DIII and a highly variable hinge region between DII and
DIII (Figure 5). A highly conserved stretch (positions 543 to 562) within DII, proposed to be a
template recognition site, was present in sPIV3 L protein and matched the pattern of basic and
hydrophobic amino acid pair repeats every four residues as described (Poch et al. 1990). The
highly conserved 772
GDNQ775
motif, which is believed to be the active site for nucleotide
polymerization (Chattopadhyay and Shaila, 2004; Malur et al., 2002), was present in subdomain
C in DIII. The L protein of swine viruses also contained a putative ATP binding site with motif
1786K-X21-G-E-G-A-G
1810 (Poch et al., 1990) in DVI. The L protein of Texas81 has 99.2%
amino acid sequence identity with ISU92, 59.7%-98.7% with Respiroviruses, 38.8%-39.7% with
Henipaviruses, 37.2%-42.5% with Morbilliviruses, 28.3%-29.8% with Rubulaviruses, 26.2%-
27.2% with Avulaviruses, 48.3%-48.5% with ASPV, 38.6%-38.8% with J-V, 37.9%-38% with
BeV, 16.7%-17.0% with Metapneumoviruses, and 15.1%-15.5% with Pneumoviruses.
3.3.3 Phylogenetic analysis
Phylogenetic trees were generated based on N, P, M, F, HN, L nucleotide sequence,
deduced amino acid sequences, and complete genome sequence of sPIV3 with other
representative members of all the five genera of family Paramyxoviridae and found to be similar.
The sPIV3 strains were phylogenetically closely related to genus Respirovirus within
Paramyxovirinae subfamily, and Texas81 and ISU92 belonged to two subgenotypes of genotype
A and the Australian bPIV3 strain Q5592 formed the genotype B (Figure 6). The phylogenetic
reconstructions of representative trees are shown (Figure 6).
121
3.3.4 Pathogenicity
Conventionally reared pigs infected intranasally with either of the two viruses resulted in
mild respiratory signs only. None of the infected pigs developed neurological signs or elevated
body temperatures throughout the experimental period (Figure 7). Two pigs from each of the
infected groups developed mild respiratory signs at 2 days post inoculation (DPI) (mean clinical
score 1). One pig from Texas81 group had diarrhea on day 2 and another on day 3 (mean clinical
score 1). The gross lesions at necropsy on 6 and 10 DPI from virus-infected pigs were
unremarkable, such as segmented, thickened small intestine and greenish milky intestinal
contents. Histologically, no microscopic lesions were observed. Virus isolation attempts were
unsuccessful on swab and tissue samples collected at day 6 and 10 DPI except from one nasal
swab sample from Texas81 virus infected pig on day 6. None of the lung tissues examined by
immnohistochemistry using polyclonal anti-bPIV3-SF serum revealed the presence of virus-
specific antigen. Pre-inoculation serum samples were negative for sPIV3-specific antibodies by
VN test. The homologous neutralization titers of sera samples at 10 DPI ranged from 1:8 to1:16,
but none of the infected pigs had VN antibodies at 6 DPI.
3.3.5 Serum antibody responses to sPIV3 in pigs detected by indirect ELISA
None of the 100 serum samples obtained from pigs aged 19 days to 70 days from the 5
swine farms designated A, B, C, D, E in Minnesota and Iowa in 2007-2008 were positive by
ELISA suggesting the absence of prevalence of sPIV3 in these farms. The sera samples from
experimentally inoculated pigs were positive at 6 and 10 dpi and the pre-inoculation samples and
122
sera from mock-infected pigs were negative. These results confirmed the neutralization test
results of sera from experimentally infected pigs. However, the fact that 6 dpi samples also
showed positive result in ELISA but not in neutralization test suggests that ELISA is capable of
detecting non-neutralizing antibodies. A large number samples need to be screened by both tests
to determine the relative merits of ELISA over virus neutralization test for prevalence studies.
But, the indirect ELISA can be used as a simple screening test for the presence of sPIV3
antibodies.
3.4 Discussion
The recent insurgence of novel paramyxoviruses of zoonotic importance necessitates the
close monitoring of viral pathogens with respiratory and neurological tropism in animals.
Although, several paramyxoviruses have been isolated from swine in USA and other parts of the
world, many except a few have shown the potential to be extremely virulent and infect across
species (Field et al., 2007b). The epidemiologic significance of many of the swine
paramyxovirus isolates has never been examined except for the initial case reports (Janke et al.,
2001; Philbey et al., 1998).
In this study, we have performed detailed analysis of two swine viruses isolated in the
United States between 1980 and early 1990s. Our preliminary study of the morphologic,
antigenic characteristics and sequence analysis of the envelope glycoproteins indicated that these
two viruses belonged in the genus Respirovirus, subfamily Paramyxovirinae. We have further
characterized these isolates for their complete genomic sequence and features, and their
123
pathogenicity in conventionally reared pigs. Our comprehensive studies revealed that these
sPIV3 are host-adapted variants of bPIV3, possibly transferred from cattle to pigs but failed to
establish an active enzootic state.
The mild clinical signs and undetectable gross and microscopic lesions observed in
sPIV3-infected pigs indicate the inapparent nature of these viruses in pigs. It has been reported
that bPIV3 can be isolated from clinically normal cattle (Rosenberg et al., 1971). It is generally
accepted that co-infection of bPIV3 along with other viruses and Mannheimia/Pasturella species
could precipitate the classical shipping fever syndrome (Battrell, 1995; Woods, 1968). A variety
of factors such as environmental temperature, transportation, hygiene, stocking density, co-
mingling, and host immune status can contribute to increased susceptibility to secondary
bacterial infections and severity of clinical disease (Battrell, 1995; Woods, 1968). The outbreak
of disease in 1980s and 1990s in pigs with these sPIV3, therefore, might have resulted from
coinfection with other pathogens. Initial pathogenicity studies in gnotobiotic piglets with ISU92
strain also resulted in mild respiratory disease and microscopic pathology (Janke et al., 2001),
suggesting this possibility. Further, our limited serological prevalence studies in sera samples
collected between 2007 and 2008 also indicated that sPIV3 are not prevalent in the field. An
earlier study examining the seroprevalence of pigs from Iowa indicated that there was a very low
seroprevalence. From 876 serum samples collected from 36 swine farms in 1988 to 1989, only 6
samples, representing 5 swine herds, were detected to have anti-ISU92 antibody titers (Battrell,
1995).
The complete genome of sPIV3 is 15456 nt in Texas81 and 15480 nt in ISU92, which is
typical of genome sizes (15500 nt) in paramyxoviruses. However, the recently determined
124
sequences of aPMV6 (16236 nt) (Chang et al., 2001), aPMV3 (16272 nt) (Kumar et al., 2008),
NiV (18246 nt) (Harcourt et al., 2001; Wang et al., 2001), HeV (18234 nt) (Wang et al., 2001), J-
V (18954 nt) (Jack et al., 2005), BeV (19212 nt) (Li et al., 2006b), MoV(16650 nt) (Miller et al.,
2003), TPMV (17904 nt) (Tidona et al., 1999) and ASPV (16965 nt) (Nylund et al., 2008) show
a greater genome length ranging from ~16300 nt to ~19200 nt. The lengths of the genome of
sPIV3 conform to the “rule of six” which is consistent in members of subfamily
Paramyxovirinae (Calain and Roux, 1993) and this is thought to be associated with nucleocapsid
organization in which each N protein monomer bind to six nucleotides of the viral genome.
Recombinant PIV with a genome length that was not an even multiple of six has been shown to
mutate to conform to the rule (Skiadopoulos et al., 2002; Skiadopoulos et al., 2003b).
The genome organization of these two strains of sPIV3 is essentially consistent with
members of the subfamily Paramyxovirinae. The transcriptional start signal is conserved as in
the consensus sequence of genus Respirovirus. The trinucleotide IGS between the gene
boundaries is an exact resemblance to the ones of Respirovirus, Morbillivirus and Henipavirus,
but differ from the variable-length intergenic regions found in the Rubulavirus (1-47nt),
Avulavirus (1-63nt) and Pneumovirus (1-56nt) (Robert A. Lamb, 2007). The length of the 3’
leader is consistent in most known paramyxoviruses (55nt), except hPIV2 (70nt) (Robert A.
Lamb, 2007). The length of 5’ trailer in Paramyxoviridae is more variable, ranging from the
shortest 21 nt in hPIV2 (Ruth A. Karron, 2007) to 707 nt in aPMV3 (Kumar et al., 2008) as the
longest trailer among members of family Paramyxoviridae. The 5’ trailer of sPIV3 is 44 nt
within the 25-58 nt range seen in Respirovirus, Morbillivirus, Rubulavirus and Henipavirus
genera. The overall complementarity between 3’ and 5’ termini was as high as 65.9%
125
(ISU92)/63.6% (Texas81) in sPIV3, and this high complementarity was also seen in most
members of the Paramyxovirinae.
The total coding percentage of the sPIV3 is 93% which is similar to what is found in
other Paramyxovirinae with an average of 92% coding capacity (Wang et al., 2000). The
genome contains six genes: N, P, M, F, HN, L, as found in most members of Paramyxoviridae.
In some of the members, instead of HN, the H or G proteins serve as attachment proteins and
some Rubulaviruses, Avulaviruses (APMV6) and all Pneumoviruses also encode a third integral
membrane protein, SH, in the genome. The genome of swine viruses can potentially encode 9
proteins including the six invariant structural proteins and three accessory proteins, V, D, C,
which are all derived from P/C/V gene by a mechanism known as mRNA editing (V and D) or
alternative translation initiation (C).
The mRNA editing in P/C/V gene is a common feature in Respiroviruses,
Morbilliviruses, Henipaviruses and Avulaviruses, and is considered as a remarkable example of
exploiting the coding capacity of viruses (Robert A. Lamb, 2007). The V protein plays important
roles in virus replication (Baron and Barrett, 2000; Curran et al., 1991), function as a negative
regulator to inhibit RNA synthesis (Baron and Barrett, 2000; Delenda et al., 1997; Durbin et al.,
1999), and inhibit host cell antiviral response by interacting with cellular proteins (Andrejeva et
al., 2002; Lin et al., 1998). The C-terminal V-specific domain is highly conserved among
paramyxoviruses with invariantly spaced histidine and cysteine residues forming a domain (cys-
rich domain) that binds two zinc molecules per V protein (Fukuhara et al., 2002; Li et al., 2006a;
Liston and Briedis, 1994; Paterson et al., 1995). In sPIV3, the C-terminal of V protein contains
all of the seven conserved cysteine residues and motifs H-R-R-E and W-C-N-P. The presence of
126
these domains suggests a similar function for the V protein of swine viruses as in other
paramyxoviruses. The role of D in viral growth cycle has not been understood (Lamb and Parks,
2007). The C protein ORF is commonly observed in Respiroviruses and Morbilliviruses (Robert
A. Lamb, 2007). C proteins are small basic polypeptides that may involve in the viral growth
cycle, control of viral RNA synthesis (Lamb and Parks, 2007), counteracting host cell antiviral
pathways (Komatsu et al., 2004) and facilitating the release of virus from infected cells (Garcin
et al., 1997; Kato et al., 2001). Both the editing site and the predicted size of accessory proteins
of sPIV3 highly resemble that of hPIV3 and bPIV3 and may have similar functional roles.
The amino acid identities with the corresponding proteins of other Paramyxoviruses
clearly place the sPIV3 as novel viruses in the genus Respirovirus with a high level of identity to
bPIV3. The overall conservation of homologous proteins in paramyxoviruses is generally
consistent with the description in the most recent ICTV report, V-C≥L>M>F>N, and HN>V>P
(Lamb, 2005). Limited sequence polymorphism has been reported among bPIV3 strains (Bailly
et al., 2000; Coelingh and Winter, 1990; Swierkosz et al., 1995). The host specific amino acids
identified in bPIV3 (Bailly et al. 2000) were invariable between bPIV3 and sPIV3 but, further
amino acid changes noticed in envelope glycoproteins (Qiao, Janke et al, 2009) and P/N473H in
P gene and amino acid residues A326T and I924M in the L gene, suggest that the sPIV3 is
adapting to the swine host. The bPIV3-910N strain was a plaque-type variant and reported to
have intermediate fusion capabilities but avirulent in mice (Shibuta et al., 1981). The bPIV3-SF
strain was originally obtained from a calf showing signs of shipping fever (Breker-Klassen et al.,
1996). The antigenic site amino acid residues in F protein (Van Wyke Coelingh and Winter,
1990) were conserved in both strains of sPIV3 as in bPIV3. The fusogenicity of both Texas81
127
and ISU92 were comparable (Qiao, Janke et al, 2009). Detailed epitope mapping studies with F
and HN monoclonal antibodies are needed to elucidate host-specific antigenic site variations.
The genomic organization, amino acid identities of homologous proteins, phylogenetic
analysis based on the genome sequences and antigenic analysis all support the classification of
these two novel strains of sPIV3 into Respirovirus genus in Paramyxovirinae subfamily and
Paramyxoviridae family.
This mild pathogenicity of sPIV3 can facilitate its development as a vaccine vector. The
bovine/hPIV3 chimeric virus (Bailly et al., 2000; van Wyke Coelingh et al., 1988), as a vector
backbone with the replacement of F and HN glycoprotein from hPIV3 has been evaluated as a
vaccine against hPIV3 (Haller et al., 2000; Pennathur et al., 2003). Besides, bPIV3 as backbone
with replaced F and HN of hPIV3 and inserted F of RSV were also constructed. The
effectiveness of this vaccine against both PIV3 and RSV challenge has been demonstrated in
African green monkeys and is being evaluated in clinical trials (Sato and Wright, 2008). The
promising outcome of the vectored vaccines using paramyxoviruses and the biological and
molecular characteristics of swine viruses described here suggest a great potential for sPIV3 to
be developed as a vaccine vector. To fulfill this goal, the prevalence of sPIV3 in human
population needs to be ascertained and potential risk of increased pathogenicity by co-infection
need to be further studied. The screening ELISA method developed by us with sPIV3 antigen
can be used to detect seroprevalence in human and animal populations.
128
3.5 Acknowledgments
The authors thank Dr. X. J. Meng, Dr. Lijuan Yuan, Dr. Kevin Myles and Dr. Chris
Roberts for their constructive crtiticism and lab members Dr. Laure Deflube, Shobana
Raghunath, Vrushali Chavan, Thomas Rogers-Cotrone and Gopakumar Moorkanat for their
excellent technical assistance and help.
129
3.6 References
Alexander, D.J. (1982) Avian paramyxoviruses-other than Newcastle disease virus. World's
Poultry Sci J(38), 97-104.
Alexander, D.J., Hinshaw, V.S., Collins, M.S. and Yamane, N. (1983) Characterization of
viruses which represent further distinct serotypes (PMV-8 and PMV-9) of avian
paramyxoviruses. Arch Virol 78(1-2), 29-36.
Andrejeva, J., Poole, E., Young, D.F., Goodbourn, S. and Randall, R.E. (2002) The p127 subunit
(DDB1) of the UV-DNA damage repair binding protein is essential for the targeted
degradation of STAT1 by the V protein of the paramyxovirus simian virus 5. J Virol
76(22), 11379-86.
Andrewes, C.H., Bang, F.B., Chanock, R.M. and Zhdanov, V.M. (1959) Para-influenza viruses
1, 2, and 3: suggested names for recently described myxoviruses. Virology 8(1), 129-30.
Appel, M.J. (1969) Pathogenesis of canine distemper. Am J Vet Res 30(7), 1167-82.
Appel, M.J. (1970) Distemper pathogenesis in dogs. J Am Vet Med Assoc 156(12), 1681-4.
Appel, M.J. and Percy, D.H. (1970) SV-5-like parainfluenza virus in dogs. J Am Vet Med Assoc
156(12), 1778-81.
Archetti, I. and Horsfall, F.L., Jr. (1950) Persistent antigenic variation of influenza A viruses
after incomplete neutralization in ovo with heterologous immune serum. J Exp Med
92(5), 441-62.
Arita, M., Ueno, Y. and Masuyama, Y. (1981) Complete heart block in mumps myocarditis. Br
Heart J 46(3), 342-4.
130
Atreya, P.L., Peeples, M.E. and Collins, P.L. (1998) The NS1 protein of human respiratory
syncytial virus is a potent inhibitor of minigenome transcription and RNA replication. J
Virol 72(2), 1452-61.
Azimi, P.H., Cramblett, H.G. and Haynes, R.E. (1969) Mumps meningoencephalitis in children.
JAMA 207(3), 509-12.
Bailly, J.E., McAuliffe, J.M., Skiadopoulos, M.H., Collins, P.L. and Murphy, B.R. (2000)
Sequence determination and molecular analysis of two strains of bovine parainfluenza
virus type 3 that are attenuated for primates. Virus Genes 20(2), 173-82.
Baker, K.A., Dutch, R.E., Lamb, R.A. and Jardetzky, T.S. (1999) Structural basis for
paramyxovirus-mediated membrane fusion. Mol Cell 3(3), 309-19.
Banerjee, A.K. and Barik, S. (1992) Gene expression of vesicular stomatitis virus genome RNA.
Virology 188(2), 417-28.
Baron, M.D. and Barrett, T. (2000) Rinderpest viruses lacking the C and V proteins show
specific defects in growth and transcription of viral RNAs. J Virol 74(6), 2603-11.
Bart, M., Guscetti, F., Zurbriggen, A., Pospischil, A. and Schiller, I. (2000) Feline infectious
pneumonia: a short literature review and a retrospective immunohistological study on the
involvement of Chlamydia spp. and distemper virus. Vet J 159(3), 220-30.
Basler, C.F., Garcia-Sastre, A. and Palese, P. (2005) A novel paramyxovirus? Emerg Infect Dis
11(1), 108-12.
Battrell, M.A. (1995) Cultivation, preliminary characterization, and prevalence in swine herds of
porcine paramyxovirus, Iowa State University.
Baumgartner, W.K., Krakowka, S., Koestner, A. and Evermann, J. (1982a) Acute encephalitis
and hydrocephalus in dogs caused by canine parainfluenza virus. Vet Pathol 19(1), 79-92.
131
Baumgartner, W.K., Krakowka, S., Koestner, A. and Evermann, J. (1982b) Ultrastructural
evaluation of the acute encephalitis and hydrocephalus in dogs caused by canine
parainfluenza virus. Vet Pathol 19(3), 305-14.
Ben-Ishai, Z., Naftali, V., Avram, A. and Yatziv, S. (1980) Human infection by a bovine strain
of parainfluenza virus type 3. J Med Virol 6(2), 165-8.
Bermingham, A. and Collins, P.L. (1999) The M2-2 protein of human respiratory syncytial virus
is a regulatory factor involved in the balance between RNA replication and transcription.
Proc Natl Acad Sci U S A 96(20), 11259-64.
Biron, C.A. and Sen, G.C. (2007) Innate Responses to Viral Infections. In: D.M. Knipe, P.M.
Howley, D.E. Griffin, R.A. Lamb, M.A. Martin, B. Roizman and S.E. Straus (Eds),
Fields virology, 5, revised ed., pp. 249-278. Vol. One. Two vols. Lippincott Williams &
Wilkins, Philadelphia.
Bistrian, B., Phillips, C.A. and Kaye, I.S. (1972) Fatal mumps meningoencephalitis. Isolation of
virus premortem and postmortem. JAMA 222(4), 478-9.
Blom, N., Gammeltoft, S. and Brunak, S. (1999) Sequence and structure-based prediction of
eukaryotic protein phosphorylation sites. J Mol Biol 294(5), 1351-62.
Blumberg, B.M., Rose, K., Simona, M.G., Roux, L., Giorgi, C. and Kolakofsky, D. (1984)
Analysis of the Sendai virus M gene and protein. J Virol 52(2), 656-63.
Bossert, B., Marozin, S. and Conzelmann, K.K. (2003) Nonstructural proteins NS1 and NS2 of
bovine respiratory syncytial virus block activation of interferon regulatory factor 3. J
Virol 77(16), 8661-8.
132
Bowden, T.R. and Boyle, D.B. (2005) Completion of the full-length genome sequence of
Menangle virus: characterisation of the polymerase gene and genomic 5' trailer region.
Arch Virol 150(10), 2125-37.
Breker-Klassen, M.M., Yoo, D. and Babiuk, L.A. (1996) Comparisons of the F and HN gene
sequences of different strains of bovine parainfluenza virus type 3: relationship to
phenotype and pathogenicity. Can J Vet Res 60(3), 228-36.
Brooksby, J.B. (1967) Variants and immunity: definitions for serological investigation.
International Symposium on foot-and-mouth disease: variants and immunity, 1–10.
Brugh, M. and Beard, C.W. (1984) Atypical disease produced in chickens by Newcastle disease
virus isolated from exotic birds. Avian Dis 28(2), 482-8.
Bryson, D.G., McNulty, M.S., Ball, H.J., Neill, S.D., Connor, T.J. and Cush, P.F. (1979) The
experimental production of pneumonia in calves by intranasal inoculation of
parainfluenza type III virus. Vet Rec 105(25-26), 566-73.
Bukreyev, A., Skiadopoulos, M.H., Murphy, B.R. and Collins, P.L. (2006) Nonsegmented
negative-strand viruses as vaccine vectors. J Virol 80(21), 10293-306.
Calain, P. and Roux, L. (1993) The rule of six, a basic feature for efficient replication of Sendai
virus defective interfering RNA. J Virol 67(8), 4822-30.
Carbone, K.M. and Rubin, S. (2007) Mumps Virus. In: D.M. Knipe, P.M. Howley, D.E. Griffin,
R.A. Lamb, M.A. Martin, B. Roizman and S.E. Straus (Eds), Fields virology, 5, revised
ed., pp. 1527-1550. Vol. One. Two vols. Lippincott Williams & Wilkins, Philadelphia.
Cassel, W.A. and Garrett, R.E. (1965) Newcastle Disease Virus as an Antineoplastic Agent.
Cancer 18, 863-8.
133
Cathomen, T., Naim, H.Y. and Cattaneo, R. (1998) Measles viruses with altered envelope
protein cytoplasmic tails gain cell fusion competence. J Virol 72(2), 1224-34.
Chadha, M.S., Comer, J.A., Lowe, L., Rota, P.A., Rollin, P.E., Bellini, W.J., Ksiazek, T.G. and
Mishra, A. (2006) Nipah virus-associated encephalitis outbreak, Siliguri, India. Emerg
Infect Dis 12(2), 235-40.
Chang, P.C., Hsieh, M.L., Shien, J.H., Graham, D.A., Lee, M.S. and Shieh, H.K. (2001)
Complete nucleotide sequence of avian paramyxovirus type 6 isolated from ducks. J Gen
Virol 82(Pt 9), 2157-68.
Chanock, R.M. (1956) Association of a new type of cytopathogenic myxovirus with infantile
croup. J Exp Med 104(4), 555-76.
Chanock, R.M., Parrott, R.H., Cook, K., Andrews, B.E., Bell, J.A., Reichelderfer, T., Kapikian,
A.Z., Mastrota, F.M. and Huebner, R.J. (1958) Newly recognized myxoviruses from
children with respiratory disease. N Engl J Med 258(5), 207-13.
Chant, K., Chan, R., Smith, M., Dwyer, D.E. and Kirkland, P. (1998) Probable human infection
with a newly described virus in the family Paramyxoviridae. The NSW Expert Group.
Emerg Infect Dis 4(2), 273-5.
Chattopadhyay, A. and Shaila, M.S. (2004) Rinderpest virus RNA polymerase subunits: mapping
of mutual interacting domains on the large protein L and phosphoprotein p. Virus Genes
28(2), 169-78.
Chua, K.B., Bellini, W.J., Rota, P.A., Harcourt, B.H., Tamin, A., Lam, S.K., Ksiazek, T.G.,
Rollin, P.E., Zaki, S.R., Shieh, W., Goldsmith, C.S., Gubler, D.J., Roehrig, J.T., Eaton,
B., Gould, A.R., Olson, J., Field, H., Daniels, P., Ling, A.E., Peters, C.J., Anderson, L.J.
134
and Mahy, B.W. (2000) Nipah virus: a recently emergent deadly paramyxovirus. Science
288(5470), 1432-5.
Chua, K.B., Goh, K.J., Wong, K.T., Kamarulzaman, A., Tan, P.S., Ksiazek, T.G., Zaki, S.R.,
Paul, G., Lam, S.K. and Tan, C.T. (1999) Fatal encephalitis due to Nipah virus among
pig-farmers in Malaysia. Lancet 354(9186), 1257-9.
Chua, K.B., Wang, L.F., Lam, S.K., Crameri, G., Yu, M., Wise, T., Boyle, D., Hyatt, A.D. and
Eaton, B.T. (2001) Tioman virus, a novel paramyxovirus isolated from fruit bats in
Malaysia. Virology 283(2), 215-29.
Chua, K.B., Wang, L.F., Lam, S.K. and Eaton, B.T. (2002) Full length genome sequence of
Tioman virus, a novel paramyxovirus in the genus Rubulavirus isolated from fruit bats in
Malaysia. Arch Virol 147(7), 1323-48.
Clark, H.F., Lief, F.S., Lunger, P.D., Waters, D., Leloup, P., Foelsch, D.W. and Wyler, R.W.
(1979) Fer de Lance virus (FDLV): a probable paramyxovirus isolated from a reptile. J
Gen Virol 44(2), 405-18.
Coelingh, K.J., Winter, C.C., Murphy, B.R., Rice, J.M., Kimball, P.C., Olmsted, R.A. and
Collins, P.L. (1986) Conserved epitopes on the hemagglutinin-neuraminidase proteins of
human and bovine parainfluenza type 3 viruses: nucleotide sequence analysis of variants
selected with monoclonal antibodies. J Virol 60(1), 90-6.
Coelingh, K.V. and Winter, C.C. (1990) Naturally occurring human parainfluenza type 3 viruses
exhibit divergence in amino acid sequence of their fusion protein neutralization epitopes
and cleavage sites. J Virol 64(3), 1329-34.
Coleman, N.A. and Peeples, M.E. (1993) The matrix protein of Newcastle disease virus localizes
to the nucleus via a bipartite nuclear localization signal. Virology 195(2), 596-607.
135
Crennell, S., Takimoto, T., Portner, A. and Taylor, G. (2000) Crystal structure of the
multifunctional paramyxovirus hemagglutinin-neuraminidase. Nat Struct Biol 7(11),
1068-74.
Cross, G.M. (1991) Newcastle disease. Vet Clin North Am Small Anim Pract 21(6), 1231-9.
Curran, J., de Melo, M., Moyer, S. and Kolakofsky, D. (1991) Characterization of the Sendai
virus V protein with an anti-peptide antiserum. Virology 184(1), 108-16.
Curran, J., Marq, J.B. and Kolakofsky, D. (1995) An N-terminal domain of the Sendai
paramyxovirus P protein acts as a chaperone for the NP protein during the nascent chain
assembly step of genome replication. J Virol 69(2), 849-55.
Delenda, C., Hausmann, S., Garcin, D. and Kolakofsky, D. (1997) Normal cellular replication of
Sendai virus without the trans-frame, nonstructural V protein. Virology 228(1), 55-62.
Dinter, Z. and Morein, B. (1990) Virus Infections of Ruminants. Elsevier Science & Technology
(August 1, 1990), Amsterdam, The Netherlands.
Durbin, A.P., McAuliffe, J.M., Collins, P.L. and Murphy, B.R. (1999) Mutations in the C, D, and
V open reading frames of human parainfluenza virus type 3 attenuate replication in
rodents and primates. Virology 261(2), 319-30.
Eaton, B.T., Broder, C.C., Middleton, D. and Wang, L.F. (2006) Hendra and Nipah viruses:
different and dangerous. Nat Rev Microbiol 4(1), 23-35.
Eisa, M., Karrar, A.E. and Abdel Rahim, A.H. (1979) The occurrence of antibodies to
parainfluenza3 virus in sera of some domestic animals of the Sudan. Br Vet J 135(2),
192-7.
136
Elankumaran, S., Rockemann, D. and Samal, S.K. (2006) Newcastle disease virus exerts
oncolysis by both intrinsic and extrinsic caspase-dependent pathways of cell death. J
Virol 80(15), 7522-34.
Ellis, J., Hassard, L., Clark, E., Harding, J., Allan, G., Willson, P., Strokappe, J., Martin, K.,
McNeilly, F., Meehan, B., Todd, D. and Haines, D. (1998) Isolation of circovirus from
lesions of pigs with postweaning multisystemic wasting syndrome. Can Vet J 39(1), 44-
51.
Evermann, J.F., Lincoln, J.D. and McKiernan, A.J. (1980) Isolation of a paramyxovirus from the
cerebrospinal fluid of a dog with posterior paresis. J Am Vet Med Assoc 177(11), 1132-
4.
Fearns, R. and Collins, P.L. (1999) Role of the M2-1 transcription antitermination protein of
respiratory syncytial virus in sequential transcription. J Virol 73(7), 5852-64.
Feldstein, J.D., Johnson, F.R., Kallick, C.A. and Doolas, A. (1974) Acute hemorrhagic
pancreatitis and pseudocyst due to mumps. Ann Surg 180(1), 85-8.
Ferraris, O., Kessler, N. and Lina, B. (2005) Sensitivity of influenza viruses to zanamivir and
oseltamivir: a study performed on viruses circulating in France prior to the introduction
of neuraminidase inhibitors in clinical practice. Antiviral Res 68(1), 43-8.
Field, H.E., Breed, A.C., Shield, J., Hedlefs, R.M., Pittard, K., Pott, B. and Summers, P.M.
(2007a) Epidemiological perspectives on Hendra virus infection in horses and flying
foxes. Aust Vet J 85(7), 268-70.
Field, H.E., Mackenzie, J.S. and Daszak, P. (2007b) Henipaviruses: emerging paramyxoviruses
associated with fruit bats. Curr Top Microbiol Immunol 315, 133-59.
137
Fischer-Tenhagen, C., Hamblin, C., Quandt, S. and Frolich, K. (2000) Serosurvey for selected
infectious disease agents in free-ranging black and white rhinoceros in Africa. J Wildl
Dis 36(2), 316-23.
Franke, J., Essbauer, S., Ahne, W. and Blahak, S. (2001) Identification and molecular
characterization of 18 paramyxoviruses isolated from snakes. Virus Res 80(1-2), 67-74.
Fukuhara, N., Huang, C., Kiyotani, K., Yoshida, T. and Sakaguchi, T. (2002) Mutational analysis
of the Sendai virus V protein: importance of the conserved residues for Zn binding, virus
pathogenesis, and efficient RNA editing. Virology 299(2), 172-81.
Galinski, M.S., Troy, R.M. and Banerjee, A.K. (1992) RNA editing in the phosphoprotein gene
of the human parainfluenza virus type 3. Virology 186(2), 543-50.
Garcin, D., Curran, J., Itoh, M. and Kolakofsky, D. (2001) Longer and shorter forms of Sendai
virus C proteins play different roles in modulating the cellular antiviral response. J Virol
75(15), 6800-7.
Garcin, D., Itoh, M. and Kolakofsky, D. (1997) A point mutation in the Sendai virus accessory C
proteins attenuates virulence for mice, but not virus growth in cell culture. Virology
238(2), 424-31.
Garcin, D., Marq, J.B., Strahle, L., le Mercier, P. and Kolakofsky, D. (2002) All four Sendai
Virus C proteins bind Stat1, but only the larger forms also induce its mono-ubiquitination
and degradation. Virology 295(2), 256-65.
Gardner, A.E. and Dutch, R.E. (2007) A conserved region in the F(2) subunit of paramyxovirus
fusion proteins is involved in fusion regulation. J Virol 81(15), 8303-14.
138
Garten, W., Berk, W., Nagai, Y., Rott, R. and Klenk, H.D. (1980) Mutational changes of the
protease susceptibility of glycoprotein F of Newcastle disease virus: effects on
pathogenicity. J Gen Virol 50(1), 135-47.
Glaser, A.L., Renshaw, R.W., Trock, S.C., Brady, R.C. and Dubovi, E.J. (2002) Isolation of
Salem virus, a novel equine paramyxovirus, and assessment of its etiologic role in a
disease outbreak. Vet Microbiol 87(3), 205-12.
Gordon, S.C. and Lauter, C.B. (1984) Mumps arthritis: a review of the literature. Rev Infect Dis
6(3), 338-44.
Gotoh, B., Takeuchi, K., Komatsu, T. and Yokoo, J. (2003) The STAT2 activation process is a
crucial target of Sendai virus C protein for the blockade of alpha interferon signaling. J
Virol 77(6), 3360-70.
Grdzelishvili, V.Z., Smallwood, S., Tower, D., Hall, R.L., Hunt, D.M. and Moyer, S.A. (2005) A
single amino acid change in the L-polymerase protein of vesicular stomatitis virus
completely abolishes viral mRNA cap methylation. J Virol 79(12), 7327-37.
Greig, A.S., Johnson, C.M. and Bouillant, A.M. (1971) Encephalomyelitis of swine caused by a
haemagglutinating virus. VI. Morphology of the virus. Res Vet Sci 12(4), 305-7.
Haines, D.M., Kendall, J.C., Remenda, B.W., Breker-Klassen, M.M. and Clark, E.G. (1992)
Monoclonal and polyclonal antibodies for immunohistochemical detection of bovine
parainfluenza type 3 virus in frozen and formalin-fixed paraffin-embedded tissues. J Vet
Diagn Invest 4(4), 393-9.
Haller, A.A., Miller, T., Mitiku, M. and Coelingh, K. (2000) Expression of the surface
glycoproteins of human parainfluenza virus type 3 by bovine parainfluenza virus type 3, a
novel attenuated virus vaccine vector. J Virol 74(24), 11626-35.
139
Hamaguchi, M., Yoshida, T., Nishikawa, K., Naruse, H. and Nagai, Y. (1983) Transcriptive
complex of Newcastle disease virus. I. Both L and P proteins are required to constitute an
active complex. Virology 128(1), 105-17.
Harcourt, B.H., Tamin, A., Halpin, K., Ksiazek, T.G., Rollin, P.E., Bellini, W.J. and Rota, P.A.
(2001) Molecular characterization of the polymerase gene and genomic termini of Nipah
virus. Virology 287(1), 192-201.
Hausmann, S., Garcin, D., Delenda, C. and Kolakofsky, D. (1999) The versatility of
paramyxovirus RNA polymerase stuttering. J Virol 73(7), 5568-76.
He, B., Lin, G.Y., Durbin, J.E., Durbin, R.K. and Lamb, R.A. (2001) The SH integral membrane
protein of the paramyxovirus simian virus 5 is required to block apoptosis in MDBK
cells. J Virol 75(9), 4068-79.
He, B., Paterson, R.G., Stock, N., Durbin, J.E., Durbin, R.K., Goodbourn, S., Randall, R.E. and
Lamb, R.A. (2002) Recovery of paramyxovirus simian virus 5 with a V protein lacking
the conserved cysteine-rich domain: the multifunctional V protein blocks both interferon-
beta induction and interferon signaling. Virology 303(1), 15-32.
Heinen, E., Herbst, W. and Schmeer, N. (1998) Isolation of a cytopathogenic virus from a case
of porcine reproductive and respiratory syndrome (PRRS) and its characterization as
parainfluenza virus type 2. Arch Virol 143(11), 2233-9.
Hiebert, S.W., Paterson, R.G. and Lamb, R.A. (1985a) Hemagglutinin-neuraminidase protein of
the paramyxovirus simian virus 5: nucleotide sequence of the mRNA predicts an N-
terminal membrane anchor. J Virol 54(1), 1-6.
140
Hiebert, S.W., Paterson, R.G. and Lamb, R.A. (1985b) Identification and predicted sequence of a
previously unrecognized small hydrophobic protein, SH, of the paramyxovirus simian
virus 5. J Virol 55(3), 744-51.
Hiebert, S.W., Richardson, C.D. and Lamb, R.A. (1988) Cell surface expression and orientation
in membranes of the 44-amino-acid SH protein of simian virus 5. J Virol 62(7), 2347-57.
Horikami, S.M., Curran, J., Kolakofsky, D. and Moyer, S.A. (1992) Complexes of Sendai virus
NP-P and P-L proteins are required for defective interfering particle genome replication
in vitro. J Virol 66(8), 4901-8.
Horikami, S.M., Smallwood, S. and Moyer, S.A. (1996) The Sendai virus V protein interacts
with the NP protein to regulate viral genome RNA replication. Virology 222(2), 383-90.
Horvath, C.M., Paterson, R.G., Shaughnessy, M.A., Wood, R. and Lamb, R.A. (1992) Biological
activity of paramyxovirus fusion proteins: factors influencing formation of syncytia. J
Virol 66(7), 4564-9.
Horwood, P.F., Gravel, J.L. and Mahony, T.J. (2008) Identification of two distinct bovine
parainfluenza virus type 3 genotypes. J Gen Virol 89(Pt 7), 1643-8.
Hosaka, M., Nagahama, M., Kim, W.S., Watanabe, T., Hatsuzawa, K., Ikemizu, J., Murakami,
K. and Nakayama, K. (1991) Arg-X-Lys/Arg-Arg motif as a signal for precursor
cleavage catalyzed by furin within the constitutive secretory pathway. J Biol Chem
266(19), 12127-30.
Hsu, V.P., Hossain, M.J., Parashar, U.D., Ali, M.M., Ksiazek, T.G., Kuzmin, I., Niezgoda, M.,
Rupprecht, C., Bresee, J. and Breiman, R.F. (2004) Nipah virus encephalitis
reemergence, Bangladesh. Emerg Infect Dis 10(12), 2082-7.
141
Hull, R.N., Minner, J.R. and Smith, J.W. (1956) New viral agents recovered from tissue cultures
of monkey kidney cells. I. Origin and properties of cytopathogenic agents S.V.1, S.V.2,
S.V.4, S.V.5, S.V.6, S.V.11, S.V.12 and S.V.15. Am J Hyg 63(2), 204-15.
Jack, P.J., Boyle, D.B., Eaton, B.T. and Wang, L.F. (2005) The complete genome sequence of J
virus reveals a unique genome structure in the family Paramyxoviridae. J Virol 79(16),
10690-700.
Jacobson, E., Gaskin, J.M., Page, D., Iverson, W.O. and Johnson, J.W. (1981) Illness associated
with paramyxo-like virus infection in a zoologic collection of snakes. J Am Vet Med
Assoc 179(11), 1227-30.
Jacobson, E., Gaskin, J.M., Simpson, C.F. and Terrell, T.G. (1980) Paramyxo-like virus infection
in a rock rattlesnake. J Am Vet Med Assoc 177(9), 796-9.
Janke, B.H., Paul, P.S., Landgraf, J.G., Halbur, P.G. and Huinker, C.D. (2001) Paramyxovirus
infection in pigs with interstitial pneumonia and encephalitis in the United States. J Vet
Diagn Invest 13(5), 428-33.
Johnson, K.M., Chanock, R.M., Cook, M.K. and Huebner, R.J. (1960) Studies of a new human
hemadsorption virus. I. Isolation, properties and characterization. Am J Hyg 71, 81-92.
Jorgensen, E.D., Collins, P.L. and Lomedico, P.T. (1987) Cloning and nucleotide sequence of
Newcastle disease virus hemagglutinin-neuraminidase mRNA: identification of a putative
sialic acid binding site. Virology 156(1), 12-24.
Jun, M.H., Karabatsos, N. and Johnson, R.H. (1977) A new mouse paramyxovirus (J virus). Aust
J Exp Biol Med Sci 55(6), 645-7.
Kahn, C.M. and Line, S., eds. (2005) The Merck Veterinary Manual. 9th ed. Merck; 9 edition
(February 8, 2005).
142
Kapil, S., Allison, R.W., Johnston, L., 3rd, Murray, B.L., Holland, S., Meinkoth, J. and Johnson,
B. (2008) Canine distemper virus strains circulating among North American dogs. Clin
Vaccine Immunol 15(4), 707-12.
Karabatsos, N. (1985), International Catalogue of Arboviruses, 3rd ed. American Society of
Tropical Medicine and Hygiene, San Antonio, Texas.
Karron, R.A. and Collins, P.L. (2007) Parainfluenza Viruses. In: D.M. Knipe, P.M. Howley,
D.E. Griffin, R.A. Lamb, M.A. Martin, B. Roizman and S.E. Straus (Eds), Fields
virology, 5, revised ed., pp. 1497-1526. Vol. One. Two vols. Lippincott Williams &
Wilkins, Philadelphia.
Karron, R.A., Makhene, M., Gay, K., Wilson, M.H., Clements, M.L. and Murphy, B.R. (1996)
Evaluation of a live attenuated bovine parainfluenza type 3 vaccine in two- to six-month-
old infants. Pediatr Infect Dis J 15(8), 650-4.
Kato, A., Ohnishi, Y., Kohase, M., Saito, S., Tashiro, M. and Nagai, Y. (2001) Y2, the smallest
of the Sendai virus C proteins, is fully capable of both counteracting the antiviral action
of interferons and inhibiting viral RNA synthesis. J Virol 75(8), 3802-10.
Kirk, M. (1987) Sensorineural hearing loss and mumps. Br J Audiol 21(3), 227-8.
Klenk, H.D. and Garten, W. (1994) Host cell proteases controlling virus pathogenicity. Trends
Microbiol 2(2), 39-43.
Kohn, A. and Fuchs, P. (1969) Cell fusion by various strains of Newcastle disease virus and their
virulence. J Virol 3(5), 539-40.
Kolakofsky, D., Pelet, T., Garcin, D., Hausmann, S., Curran, J. and Roux, L. (1998)
Paramyxovirus RNA synthesis and the requirement for hexamer genome length: the rule
of six revisited. J Virol 72(2), 891-9.
143
Kolakofsky, D., Roux, L., Garcin, D. and Ruigrok, R.W. (2005) Paramyxovirus mRNA editing,
the "rule of six" and error catastrophe: a hypothesis. J Gen Virol 86(Pt 7), 1869-77.
Komatsu, T., Takeuchi, K., Yokoo, J. and Gotoh, B. (2004) C and V proteins of Sendai virus
target signaling pathways leading to IRF-3 activation for the negative regulation of
interferon-beta production. Virology 325(1), 137-48.
Kumar, S., Nayak, B., Collins, P.L. and Samal, S.K. (2008) Complete genome sequence of avian
paramyxovirus type 3 reveals an unusually long trailer region. Virus Res 137(2), 189-97.
Kvellestad, A., Dannevig, B.H. and Falk, K. (2003) Isolation and partial characterization of a
novel paramyxovirus from the gills of diseased seawater-reared Atlantic salmon (Salmo
salar L). J Gen Virol 84(Pt 8), 2179-89.
Kvellestad, A., Falk, K., Nygaard, S.M., Flesja, K. and Holm, J.A. (2005) Atlantic salmon
paramyxovirus (ASPV) infection contributes to proliferative gill inflammation (PGI) in
seawater-reared Salmo salar. Dis Aquat Organ 67(1-2), 47-54.
Lamb, R.A. (1993) Paramyxovirus fusion: a hypothesis for changes. Virology 197(1), 1-11.
Lamb, R.A., Collins, P.L., Kolakofsky, D., Melero, J.A., Nagai, Y., Oldstone, M.B.A., Pringle,
C.R. and Rima, B.K. (2005a) Virus taxonomy : The Classification and Nomenclature of
Viruses : The eighth report of the International Committee on Taxonomy of Viruses.
Family Paramyxoviridae.
Elsevier Academic Press. (2005b) Virus taxonomy : The Classification and Nomenclature of
Viruses : The eighth report of the International Committee on Taxonomy of Viruses.
Lamb, R.A., Collins, P.L., Kolakofsky, D., Melero, J.A., Nagai, Y., Oldstone, M.B.A.,
Pringle, C.R. and Rima, B.K. 0122499514 9780122499517.
144
Lamb, R.A., Collins, P.L., Kolakofsky, D., Melero, J.A., Nagai, Y., Oldstone, M.B.A., Pringle,
C.R., Rima, B.K. (2005) Virus taxonomy : The Classification and Nomenclature of
Viruses : The eighth report of the International Committee on Taxonomy of Viruses.
Family Paramyxoviridae., edited by C.M. Fauquet, V. International Committee on
Taxonomy of and D. International Union of Microbiological Societies. Virology.
Elsevier Academic Press, San Diego; London.
Lamb RA, C.P., Kolakofsky D, Melero JA, Nagai Y, Oldstone MBA, Pringle CR, Rima BK.
(2005) Family Paramyxoviridae, 655-668 pp. Virus taxonomy: 8th Report of the
International Comittee on Taxonomy of Viruses., edited by M.M. Fauquet CM, Maniloff
J, Desselberger U, Ball LA. Elsevier Acedemic Press, San Diego.
Lamb, R.A., Mahy, B.W. and Choppin, P.W. (1976) The synthesis of sendai virus polypeptides
in infected cells. Virology 69(1), 116-31.
Lamb, R.A. and Parks, G.D. (2007) Paramyxoviridae: The Viruses and Their Replication. In:
D.M. Knipe, P.M. Howley, D.E. Griffin, R.A. Lamb, M.A. Martin, B. Roizman and S.E.
Straus (Eds), Fields virology, 5, revised ed., pp. 1449-1496. Vol. One. Two vols.
Lippincott Williams & Wilkins, Philadelphia.
Lamb, R.A., Paterson, R.G. and Jardetzky, T.S. (2006) Paramyxovirus membrane fusion: lessons
from the F and HN atomic structures. Virology 344(1), 30-7.
Langedijk, J.P., Daus, F.J. and van Oirschot, J.T. (1997) Sequence and structure alignment of
Paramyxoviridae attachment proteins and discovery of enzymatic activity for a
morbillivirus hemagglutinin. J Virol 71(8), 6155-67.
145
Lawrence, M.C., Borg, N.A., Streltsov, V.A., Pilling, P.A., Epa, V.C., Varghese, J.N., McKimm-
Breschkin, J.L. and Colman, P.M. (2004) Structure of the haemagglutinin-neuraminidase
from human parainfluenza virus type III. J Mol Biol 335(5), 1343-57.
Leyrer, S., Bitzer, M., Lauer, U., Kramer, J., Neubert, W.J. and Sedlmeier, R. (1998) Sendai
virus-like particles devoid of haemagglutinin-neuraminidase protein infect cells via the
human asialoglycoprotein receptor. J Gen Virol 79 ( Pt 4), 683-7.
Li, T., Chen, X., Garbutt, K.C., Zhou, P. and Zheng, N. (2006a) Structure of DDB1 in complex
with a paramyxovirus V protein: viral hijack of a propeller cluster in ubiquitin ligase.
Cell 124(1), 105-17.
Li, Z., Yu, M., Zhang, H., Magoffin, D.E., Jack, P.J., Hyatt, A., Wang, H.Y. and Wang, L.F.
(2006b) Beilong virus, a novel paramyxovirus with the largest genome of non-segmented
negative-stranded RNA viruses. Virology 346(1), 219-28.
Li, Z., Yu, M., Zhang, H., Wang, H.Y. and Wang, L.F. (2005) Improved rapid amplification of
cDNA ends (RACE) for mapping both the 5' and 3' terminal sequences of paramyxovirus
genomes. J Virol Methods 130(1-2), 154-6.
Lin, G.Y., Paterson, R.G., Richardson, C.D. and Lamb, R.A. (1998) The V protein of the
paramyxovirus SV5 interacts with damage-specific DNA binding protein. Virology
249(1), 189-200.
Lin, Y., Bright, A.C., Rothermel, T.A. and He, B. (2003) Induction of apoptosis by
paramyxovirus simian virus 5 lacking a small hydrophobic gene. J Virol 77(6), 3371-83.
Linne, T., Berg, M., Bergvall, A.C., Hjertner, B. and Moreno-Lopez, J. (1992) The molecular
biology of the porcine paramyxovirus LPMV. Vet Microbiol 33(1-4), 263-73.
146
Lipkind, M., Shoham, D. and Shihmanter, E. (1986) Isolation of a paramyxovirus from pigs in
Israel and its antigenic relationships with avian paramyxoviruses. J Gen Virol 67 ( Pt 3),
427-39.
Liston, P. and Briedis, D.J. (1994) Measles virus V protein binds zinc. Virology 198(1), 399-404.
Lyon, M., Leroux, C., Greenland, T., Chastang, J., Patet, J. and Mornex, J.F. (1997) Presence of
a unique parainfluenza virus 3 strain identified by RT-PCR in visna-maedi virus infected
sheep. Vet Microbiol 57(2-3), 95-104.
Malur, A.G., Gupta, N.K., De Bishnu, P. and Banerjee, A.K. (2002) Analysis of the mutations in
the active site of the RNA-dependent RNA polymerase of human parainfluenza virus
type 3 (HPIV3). Gene Expr 10(3), 93-100.
Marshall, R.G. and Frank, G.H. (1975) Clinical and immunologic responses of calves with
colostrally acquired maternal antibody against parainfluenza-3 virus to homologous viral
infection. Am J Vet Res 36(08), 1085-9.
Melikyan, G.B., Markosyan, R.M., Hemmati, H., Delmedico, M.K., Lambert, D.M. and Cohen,
F.S. (2000) Evidence that the transition of HIV-1 gp41 into a six-helix bundle, not the
bundle configuration, induces membrane fusion. J Cell Biol 151(2), 413-23.
Miller, P.J., Boyle, D.B., Eaton, B.T. and Wang, L.F. (2003) Full-length genome sequence of
Mossman virus, a novel paramyxovirus isolated from rodents in Australia. Virology
317(2), 330-44.
Moreno-Lopez, J., Correa-Giron, P., Martinez, A. and Ericsson, A. (1986) Characterization of a
paramyxovirus isolated from the brain of a piglet in Mexico. Arch Virol 91(3-4), 221-31.
Morrison, T.G. (2003) Structure and function of a paramyxovirus fusion protein. Biochim
Biophys Acta 1614(1), 73-84.
147
Murray, K., Selleck, P., Hooper, P., Hyatt, A., Gould, A., Gleeson, L., Westbury, H., Hiley, L.,
Selvey, L., Rodwell, B. and et al. (1995) A morbillivirus that caused fatal disease in
horses and humans. Science 268(5207), 94-7.
Myers, D.L., Zurbriggen, A., Lutz, H. and Pospischil, A. (1997a) Distemper: not a new disease
in lions and tigers. Clin Diagn Lab Immunol 4(2), 180-4.
Myers, T.M., Pieters, A. and Moyer, S.A. (1997b) A highly conserved region of the Sendai virus
nucleocapsid protein contributes to the NP-NP binding domain. Virology 229(2), 322-35.
Nagai, Y. and Klenk, H.D. (1977) Activation of precursors to both glycoporteins of Newcastle
disease virus by proteolytic cleavage. Virology 77(1), 125-34.
Nagai, Y., Klenk, H.D. and Rott, R. (1976) Proteolytic cleavage of the viral glycoproteins and its
significance for the virulence of Newcastle disease virus. Virology 72(2), 494-508.
Nishio, M., Tsurudome, M., Bando, H. and Ito, Y. (1990) Immunological relationships of simian
virus 41 (SV41) to other paramyxoviruses and serological evidence of SV41 infection in
human populations. J Gen Virol 71 ( Pt 9), 2093-7.
Nollens, H.H., Wellehan, J.F., Saliki, J.T., Caseltine, S.L., Jensen, E.D., Van Bonn, W. and
Venn-Watson, S. (2008) Characterization of a parainfluenza virus isolated from a
bottlenose dolphin (Tursiops truncatus). Vet Microbiol 128(3-4), 231-42.
Norris, J.M., Krockenberger, M.B., Baird, A.A. and Knudsen, G. (2006) Canine distemper: re-
emergence of an old enemy. Aust Vet J 84(10), 362-3.
Nylund, S., Karlsen, M. and Nylund, A. (2008) The complete genome sequence of the Atlantic
salmon paramyxovirus (ASPV). Virology 373(1), 137-48.
148
Ogino, T., Kobayashi, M., Iwama, M. and Mizumoto, K. (2005) Sendai virus RNA-dependent
RNA polymerase L protein catalyzes cap methylation of virus-specific mRNA. J Biol
Chem 280(6), 4429-35.
Ohsawa, K., Yamada, A., Takeuchi, K., Watanabe, Y., Miyata, H. and Sato, H. (1998) Genetic
characterization of parainfluenza virus 3 derived from guinea pigs. J Vet Med Sci 60(8),
919-22.
Oldstone, M.B., Homann, D., Lewicki, H. and Stevenson, D. (2002) One, two, or three step:
measles virus receptor dance. Virology 299(2), 162-3.
Ortmann, D., Ohuchi, M., Angliker, H., Shaw, E., Garten, W. and Klenk, H.D. (1994)
Proteolytic cleavage of wild type and mutants of the F protein of human parainfluenza
virus type 3 by two subtilisin-like endoproteases, furin and Kex2. J Virol 68(4), 2772-6.
Palosaari, H., Parisien, J.P., Rodriguez, J.J., Ulane, C.M. and Horvath, C.M. (2003) STAT
protein interference and suppression of cytokine signal transduction by measles virus V
protein. J Virol 77(13), 7635-44.
Parks, J.B., Post, G., Thorne, T. and Nash, P. (1972) Parainfluenza-3 virus infection in Rocky
Mountain bighorn sheep. J Am Vet Med Assoc 161(6), 669-72.
Paterson, R.G. and Lamb, R.A. (1990) RNA editing by G-nucleotide insertion in mumps virus P-
gene mRNA transcripts. J Virol 64(9), 4137-45.
Paterson, R.G., Leser, G.P., Shaughnessy, M.A. and Lamb, R.A. (1995) The paramyxovirus SV5
V protein binds two atoms of zinc and is a structural component of virions. Virology
208(1), 121-31.
Patterson, J.B., Thomas, D., Lewicki, H., Billeter, M.A. and Oldstone, M.B. (2000) V and C
proteins of measles virus function as virulence factors in vivo. Virology 267(1), 80-9.
149
Peeples, M.E., Wang, C., Gupta, K.C. and Coleman, N. (1992) Nuclear entry and nucleolar
localization of the Newcastle disease virus (NDV) matrix protein occur early in infection
and do not require other NDV proteins. J Virol 66(5), 3263-9.
Pennathur, S., Haller, A.A., MacPhail, M., Rizzi, T., Kaderi, S., Fernandes, F., Bicha, L.,
Schickli, J.H., Tang, R.S., Chen, W., Nguyen, N., Mathie, S., Mehta, H. and Coelingh,
K.L. (2003) Evaluation of attenuation, immunogenicity and efficacy of a bovine
parainfluenza virus type 3 (PIV-3) vaccine and a recombinant chimeric bovine/human
PIV-3 vaccine vector in rhesus monkeys. J Gen Virol 84(Pt 12), 3253-61.
Philbey, A.W., Kirkland, P.D., Ross, A.D., Davis, R.J., Gleeson, A.B., Love, R.J., Daniels, P.W.,
Gould, A.R. and Hyatt, A.D. (1998) An apparently new virus (family Paramyxoviridae)
infectious for pigs, humans, and fruit bats. Emerg Infect Dis 4(2), 269-71.
Philip, R.N., Reinhard, K.R. and Lackman, D.B. (1959) Observations on a mumps epidemic in a
virgin population. Am J Hyg 69(2), 91-111.
Poch, O., Blumberg, B.M., Bougueleret, L. and Tordo, N. (1990) Sequence comparison of five
polymerases (L proteins) of unsegmented negative-strand RNA viruses: theoretical
assignment of functional domains. J Gen Virol 71 ( Pt 5), 1153-62.
Poole, E., He, B., Lamb, R.A., Randall, R.E. and Goodbourn, S. (2002) The V proteins of simian
virus 5 and other paramyxoviruses inhibit induction of interferon-beta. Virology 303(1),
33-46.
Potier, M., Mameli, L., Belisle, M., Dallaire, L. and Melancon, S.B. (1979) Fluorometric assay
of neuraminidase with a sodium (4-methylumbelliferyl-alpha-D-N-acetylneuraminate)
substrate. Anal Biochem 94(2), 287-96.
150
Qiao, D., Janke, B.H. and Elankumaran, S. (2009) Molecular characterization of glycoprotein
genes and phylogenetic analysis of two swine paramyxoviruses isolated from United
States. Virus Genes 39(1), 53-65.
Reisinger, R.C., Heddleston, K.L. and Manthei, C.A. (1959) A myxovirus (SF-4) associated with
shipping fever of cattle. J Am Vet Med Assoc 135(3), 147-52.
Robert A. Lamb, G.D.P. (2007) Paramyxoviridae: The Viruses and Their Replication. In:
D.M.K. Bernard N. Fields, Peter M. Howley, Diane E. Griffin (Ed), Fields virology, 5,
revised ed., pp. 1449-1496. Vol. One. Two vols. Lippincott Williams & Wilkins,
Philadelphia.
Rodriguez, J.J., Wang, L.F. and Horvath, C.M. (2003) Hendra virus V protein inhibits interferon
signaling by preventing STAT1 and STAT2 nuclear accumulation. J Virol 77(21), 11842-
5.
Rosenberg, F.J., Lief, F.S., Todd, J.D. and Reif, J.S. (1971) Studies of canine respiratory viruses.
I. Experimental infection of dogs with an SV5-like canine parainfluenza agent. Am J
Epidemiol 94(2), 147-65.
Russell, C.J., Kantor, K.L., Jardetzky, T.S. and Lamb, R.A. (2003) A dual-functional
paramyxovirus F protein regulatory switch segment: activation and membrane fusion. J
Cell Biol 163(2), 363-74.
Russell, S.J. and Peng, K.W. (2009) Measles virus for cancer therapy. Curr Top Microbiol
Immunol 330, 213-41.
Ruth A. Karron, P.L.C. (2007) Parainfluenza Viruses. In: D.M.K. Bernard N. Fields, Peter M.
Howley, Diane E. Griffin (Ed), Fields virology, 5, revised ed., pp. 1497-1526. Vol. One.
Two vols. Lippincott Williams & Wilkins, Philadelphia.
151
Sakai, Y., Suzu, S., Shioda, T. and Shibuta, H. (1987) Nucleotide sequence of the bovine
parainfluenza 3 virus genome: its 3' end and the genes of NP, P, C and M proteins.
Nucleic Acids Res 15(7), 2927-44.
Sanderson, C.M., McQueen, N.L. and Nayak, D.P. (1993) Sendai virus assembly: M protein
binds to viral glycoproteins in transit through the secretory pathway. J Virol 67(2), 651-
63.
Sasahara, J., Hayashi, S., Kumagai, T., Yamamoto, Y., hirasawa, K., Munekata, K., Okaniwa, A.
and Kato, K. (1954) On a swine virus disease newly discovered in Japan. 1. Isolation of
the virus. 2. Some properties of the virus. . Virus, 4:131-139.
Sato, M. and Wright, P.F. (2008) Current status of vaccines for parainfluenza virus infections.
Pediatr Infect Dis J 27(10 Suppl), S123-5.
Scheid, A. and Choppin, P.W. (1974) Identification of biological activities of paramyxovirus
glycoproteins. Activation of cell fusion, hemolysis, and infectivity of proteolytic cleavage
of an inactive precursor protein of Sendai virus. Virology 57(2), 475-90.
Schmitt, A.P., He, B. and Lamb, R.A. (1999) Involvement of the cytoplasmic domain of the
hemagglutinin-neuraminidase protein in assembly of the paramyxovirus simian virus 5. J
Virol 73(10), 8703-12.
Schnell, M.J., Mebatsion, T. and Conzelmann, K.K. (1994) Infectious rabies viruses from cloned
cDNA. Embo J 13(18), 4195-203.
Schomacker, H., Collins, P.L. and Schmidt, A.C. (2004) In silico identification of a putative new
paramyxovirus related to the Henipavirus genus. Virology 330(1), 178-85.
152
Shaw, M.L., Garcia-Sastre, A., Palese, P. and Basler, C.F. (2004) Nipah virus V and W proteins
have a common STAT1-binding domain yet inhibit STAT1 activation from the
cytoplasmic and nuclear compartments, respectively. J Virol 78(11), 5633-41.
Shibuta, H., Kanda, T., Hazama, A., Adachi, A. and Matumoto, M. (1981) Parainfluenza 3 virus:
plaque-type variants lacking neuraminidase activity. Infect Immun 34(1), 262-7.
Sidhu, M.S., Menonna, J.P., Cook, S.D., Dowling, P.C. and Udem, S.A. (1993) Canine
distemper virus L gene: sequence and comparison with related viruses. Virology 193(1),
50-65.
Skiadopoulos, M.H., Durbin, A.P., Tatem, J.M., Wu, S.L., Paschalis, M., Tao, T., Collins, P.L.
and Murphy, B.R. (1998) Three amino acid substitutions in the L protein of the human
parainfluenza virus type 3 cp45 live attenuated vaccine candidate contribute to its
temperature-sensitive and attenuation phenotypes. J Virol 72(3), 1762-8.
Skiadopoulos, M.H., Schmidt, A.C., Riggs, J.M., Surman, S.R., Elkins, W.R., St Claire, M.,
Collins, P.L. and Murphy, B.R. (2003a) Determinants of the host range restriction of
replication of bovine parainfluenza virus type 3 in rhesus monkeys are polygenic. J Virol
77(2), 1141-8.
Skiadopoulos, M.H., Surman, S.R., Riggs, J.M., Orvell, C., Collins, P.L. and Murphy, B.R.
(2002) Evaluation of the replication and immunogenicity of recombinant human
parainfluenza virus type 3 vectors expressing up to three foreign glycoproteins. Virology
297(1), 136-52.
Skiadopoulos, M.H., Tao, T., Surman, S.R., Collins, P.L. and Murphy, B.R. (1999) Generation
of a parainfluenza virus type 1 vaccine candidate by replacing the HN and F
153
glycoproteins of the live-attenuated PIV3 cp45 vaccine virus with their PIV1
counterparts. Vaccine 18(5-6), 503-10.
Skiadopoulos, M.H., Vogel, L., Riggs, J.M., Surman, S.R., Collins, P.L. and Murphy, B.R.
(2003b) The genome length of human parainfluenza virus type 2 follows the rule of six,
and recombinant viruses recovered from non-polyhexameric-length antigenomic cDNAs
contain a biased distribution of correcting mutations. J Virol 77(1), 270-9.
Spann, K.M., Tran, K.C., Chi, B., Rabin, R.L. and Collins, P.L. (2004) Suppression of the
induction of alpha, beta, and lambda interferons by the NS1 and NS2 proteins of human
respiratory syncytial virus in human epithelial cells and macrophages [corrected]. J Virol
78(8), 4363-9.
Spriggs, M.K., Johnson, P.R. and Collins, P.L. (1987) Sequence analysis of the matrix protein
gene of human parainfluenza virus type 3: extensive sequence homology among
paramyxoviruses. J Gen Virol 68 ( Pt 5), 1491-7.
(1990) Focus on: swine blue eye disease. Stephano, H.A.
Stevenson, R.G. and Hore, D.E. (1970) Comparative pathology of lambs and calves infected
with parainfluenza virus type 3. J Comp Pathol 80(4), 613-8.
Storey, D.G., Dimock, K. and Kang, C.Y. (1984) Structural characterization of virion proteins
and genomic RNA of human parainfluenza virus 3. J Virol 52(3), 761-6.
Stricker, R., Mottet, G. and Roux, L. (1994) The Sendai virus matrix protein appears to be
recruited in the cytoplasm by the viral nucleocapsid to function in viral assembly and
budding. J Gen Virol 75 ( Pt 5), 1031-42.
154
Suzu, S., Sakai, Y., Shioda, T. and Shibuta, H. (1987) Nucleotide sequence of the bovine
parainfluenza 3 virus genome: the genes of the F and HN glycoproteins. Nucleic Acids
Res 15(7), 2945-58.
Svenda, M., Berg, M., Moreno-Lopez, J. and Linne, T. (1997) Analysis of the large (L) protein
gene of the porcine rubulavirus LPMV: identification of possible functional domains.
Virus Res 48(1), 57-70.
Swierkosz, E.M., Erdman, D.D., Bonnot, T., Schneiderheinze, C. and Waner, J.L. (1995)
Isolation and characterization of a naturally occurring parainfluenza 3 virus variant. J
Clin Microbiol 33(7), 1839-41.
Swofford, D.L. ( 2002) PAUP*. Phylogenetic Analysis Using Parsimony
(*and Other Methods). Version 4. . Sinauer Associates, Sunderland,
Massachusetts.
Takeuchi, K., Komatsu, T., Yokoo, J., Kato, A., Shioda, T., Nagai, Y. and Gotoh, B. (2001)
Sendai virus C protein physically associates with Stat1. Genes Cells 6(6), 545-57.
Teng, M.N. and Collins, P.L. (1999) Altered growth characteristics of recombinant respiratory
syncytial viruses which do not produce NS2 protein. J Virol 73(1), 466-73.
Thomas, S.M., Lamb, R.A. and Paterson, R.G. (1988) Two mRNAs that differ by two
nontemplated nucleotides encode the amino coterminal proteins P and V of the
paramyxovirus SV5. Cell 54(6), 891-902.
Thompson, S.D., Laver, W.G., Murti, K.G. and Portner, A. (1988) Isolation of a biologically
active soluble form of the hemagglutinin-neuraminidase protein of Sendai virus. J Virol
62(12), 4653-60.
155
Thorsen, J. and Henderson, J.P. (1971) Survey for antibody to infectious bovine rhinotracheitis
(IBR), bovine virus diarrhea (BVD) and parainfluenza 3 (PI3) in moose sera. J Wildl Dis
7(2), 93-5.
Tidona, C.A., Kurz, H.W., Gelderblom, H.R. and Darai, G. (1999) Isolation and molecular
characterization of a novel cytopathogenic paramyxovirus from tree shrews. Virology
258(2), 425-34.
Tong, S., Li, M., Vincent, A., Compans, R.W., Fritsch, E., Beier, R., Klenk, C., Ohuchi, M. and
Klenk, H.D. (2002) Regulation of fusion activity by the cytoplasmic domain of a
paramyxovirus F protein. Virology 301(2), 322-333.
Tsai, K.S. and Thomson, R.G. (1975) Bovine parainfluenza type 3 virus infection: ultrastructural
aspects of viral pathogenesis in the bovine respiratory tract. Infect Immun 11(4), 783-
803.
Tsurudome, M., Bando, H., Nishio, M., Iwamoto, Y., Kawano, M., Kondo, K., Komada, H. and
Ito, Y. (1990) Antigenic and structural properties of a paramyxovirus simian virus 41
(SV41) reveal a close relationship with human parainfluenza type 2 virus. Virology
179(2), 738-48.
Utz, J.P., Houk, V.N. and Alling, D.W. (1964) Clinical and Laboratory Studies of Mumps. N
Engl J Med 270, 1283-6.
van Wyke Coelingh, K.L., Winter, C. and Murphy, B.R. (1985) Antigenic variation in the
hemagglutinin-neuraminidase protein of human parainfluenza type 3 virus. Virology
143(2), 569-82.
van Wyke Coelingh, K.L., Winter, C.C., Tierney, E.L., London, W.T. and Murphy, B.R. (1988)
Attenuation of bovine parainfluenza virus type 3 in nonhuman primates and its ability to
156
confer immunity to human parainfluenza virus type 3 challenge. J Infect Dis 157(4), 655-
62.
Vigil, A., Martinez, O., Chua, M.A. and Garcia-Sastre, A. (2008) Recombinant Newcastle
disease virus as a vaccine vector for cancer therapy. Mol Ther 16(11), 1883-90.
Wang, L., Harcourt, B.H., Yu, M., Tamin, A., Rota, P.A., Bellini, W.J. and Eaton, B.T. (2001)
Molecular biology of Hendra and Nipah viruses. Microbes Infect 3(4), 279-87.
Wang, L.F., Hansson, E., Yu, M., Chua, K.B., Mathe, N., Crameri, G., Rima, B.K., Moreno-
Lopez, J. and Eaton, B.T. (2007) Full-length genome sequence and genetic relationship
of two paramyxoviruses isolated from bat and pigs in the Americas. Arch Virol 152(7),
1259-71.
Wang, L.F., Yu, M., Hansson, E., Pritchard, L.I., Shiell, B., Michalski, W.P. and Eaton, B.T.
(2000) The exceptionally large genome of Hendra virus: support for creation of a new
genus within the family Paramyxoviridae. J Virol 74(21), 9972-9.
Wechsler, S.L., Lambert, D.M., Galinski, M.S. and Pons, M.W. (1985) Intracellular synthesis of
human parainfluenza type 3 virus-specified polypeptides. J Virol 54(3), 661-4.
Whitehead, S.S., Bukreyev, A., Teng, M.N., Firestone, C.Y., St Claire, M., Elkins, W.R.,
Collins, P.L. and Murphy, B.R. (1999) Recombinant respiratory syncytial virus bearing a
deletion of either the NS2 or SH gene is attenuated in chimpanzees. J Virol 73(4), 3438-
42.
Wilson, R.L., Fuentes, S.M., Wang, P., Taddeo, E.C., Klatt, A., Henderson, A.J. and He, B.
(2006) Function of small hydrophobic proteins of paramyxovirus. J Virol 80(4), 1700-9.
Woods, G.T. (1968) The natural history of bovine myxovirus parainfluenza-3. JAVMA(152),
771-779.
157
Yanagi, Y., Ono, N., Tatsuo, H., Hashimoto, K. and Minagawa, H. (2002) Measles virus receptor
SLAM (CD150). Virology 299(2), 155-61.
Yener, Z., Saglam, Y.S., Timurkaan, N. and Ilhan, F. (2005) Immunohistochemical detection of
parainfluenza type 3 virus antigens in paraffin sections of pneumonic caprine lungs. J Vet
Med A Physiol Pathol Clin Med 52(6), 268-71.
Yin, H.S., Paterson, R.G., Wen, X., Lamb, R.A. and Jardetzky, T.S. (2005) Structure of the
uncleaved ectodomain of the paramyxovirus (hPIV3) fusion protein. Proc Natl Acad Sci
U S A 102(26), 9288-93.
Zaitsev, V., von Itzstein, M., Groves, D., Kiefel, M., Takimoto, T., Portner, A. and Taylor, G.
(2004) Second sialic acid binding site in Newcastle disease virus hemagglutinin-
neuraminidase: implications for fusion. J Virol 78(7), 3733-41.
Zarnke, R.L. and Erickson, G.A. (1990) Serum antibody prevalence of parainfluenza 3 virus in a
free-ranging bison (Bison bison) herd from Alaska. J Wildl Dis 26(3), 416-9.
Zhao, X., Singh, M., Malashkevich, V.N. and Kim, P.S. (2000) Structural characterization of the
human respiratory syncytial virus fusion protein core. Proc Natl Acad Sci U S A 97(26),
14172-7.
158
3.7 Tables
Table 1. Primer list
Primer ID Sequence (from 5’ to 3’)a
Primers
for
RT-PCR
BPN-GS-f 44
AAAAATTAACTTAGGATTAAAGAACTTTACCGAA77
BPN-M-f 785
ACAGAGCTTGGTAACACTCATGGTTGAAAC814
BPN-GE-r 1721
TAATTTCCATTAATCCTAAGTTTTTCTTACTTGTTG1686
BPP-GS-f 1688
ACAAGTAAGAAAAACTTAGGATTAATGGAAATTATC1723
BPP-M-f 2368
CAGTACATTTGATTCAGGATATACCAGTATAGTGAC2403
BPP-GE-r 3718
TTAGTCCTTTCATCCTAAGTTTTTCTTAATCATCTATG3671
BPM-GS-f 3672
ATAGATGATTAAGAAAAACTTAGGATGAAAGGACTAA3717
BPM-GE-r 4870
TGATCCCTTTGATCCTAAGTTTTTGATTTTTCTCCTG4834
BPF-GS-f 4835
AGGAGAAAAATCAAAAACTTAGGATCAAAGGGAT4838
BPF-M-f 5423
ATAGGGATAGCCACTTCAGCACAAATCACC5452
BPF-GE-r 6742
GAACAACTTTGTTCCTAAGTTTTTTGTACTTTTTAT6707
BPHN-GS-f 6714
GTACAAAAAACTTAGGAACAAAGTTGTTC6742
BPHN-M-f 7325
CCAGGACCAGGTTTATTAGCAACATCTACTACAG7358
BPHN-GE-r 8638
TTTCTTGCACACTTTTCTCCTAAGTTTTTTATTATTTC8601
BPL1-GS-f 8602
AAATAATAAAAAACTTAGGAGAAAAGTGTGCAAG8635
BPL1-M-r 10046
AGTTAAGTCTTCATCCAATTGAGGCTCTATAAAC10013
BPL2-M-f 9993
AATTTGACAAGTTTATAGGAGCCTCAATTGGATGAAG10038
BPL2-M-r 11385
TATTTTGGGTTATAGTTGGGTTTATATTCATTC11352
BPL3-M-f 11307
GTATGCTCAATCTTCAAAAATATCCAACAG11336
BPL3-M-r 12706
GTACTCTCCTCTAACCTAAATAGATATTCAAATACACT12669
BPL4-M-f 12594
ATATGTCTATTAAAGAAGCAAATGAAACTAAAGATACA12632
BPL4-M-r 14130
AATTATAATAATTTATTGCAGGACCGAGTGTAGC14097
BPL5-M-f 14054
CCTTTTTAGGAGAAGGAGCAGGAGCTATGTTAG14086
BPL5-GE-r 15430
GTATATATATATTACATGTTTTTCTTACTTTTCATTTTGTTG15389
Primers
for
sequencing
BPN-M-f-seq 1420
ATGAGCCTCGGTCATCCATAGTTCC1444
BPP-M-r-seq 2139
GTTCTACTATCTGGGCTGCTTCCTCTCC2112
BPM-M-f-seq 4704
GATGCAGTTCTCCAGCCTTCATTACC4729
BPHN-M-r-seq 7065
GTTCCAATGTCATCCGAAGTCCTCTG7039
BPHN-M-f-seq 8368
CAGAACACTTCCAGCTGCATATACAACAAC8437
BPL1-M-r-seq 9645
CATTAGGTATTTCCTCTGTTGTACACTCAGC9615
BPL2-M-f-seq 10573
CTACAGATATATACAATGATGGATACGAAACCG10605
BPL3-M-r-seq 11734
CCAGATAGTAATGGGTTTGGTGAGTCC11708
Pimers for
RACE
DT89 CCAAA ACGCCATTTCCACCT TCTCT TC
DT88 GAAGAGAAGGTGGAAATGGCGTTTTGG
ISU-5-1 14780
GATAATGAGGCCATATCATACAGCACT14806
ISU-5-2 14911
CAATTAAAGATGTTATGTTCGAATGGGTC14939
ISU-5-3 15034
ATAAGGGAAAACTAAGATTATTATCACGAAG14994
ISU-3-1 499
CAGTCAGTTGTCTTTTCATAAACCATCTC471
ISU-3-2 166
GATTTTGTTATATTCTCTTGCCTACGC140
TX-5-1 14925
CATGACAATAAAGACATAAATTAGGAGGAAG14956
TX-5-2 15025
GGATATCATTATCTTTATCAACCAGATTACTG15056
TX-5-3 15158
TATTGTCAAAAGTTACAAAGAACACATAGG15187
TX-3-1 405
CATATTTAACATCTGCATTACTACCATTTG376
TX-3-2 166
GATTTTGTTATGTTCTCCTGCCTACG141
a. All primer sequences were given from 5’ to 3’. The numbers in superscript indicate the expected
position of the primer in bPIV3-SF/Ka genome. DT88 and DT89 were the primers used in Li et al., 2005
for RACE.
159
Table 2. Comparison of the gene-start and gene end signals of sPIV3, bPIV3 and hPIV3.
Gene Strain Gene-start Gene-end
N
Texas81 UCCUAAUUUC UUCAUUCUUUUUa
ISU92 UCCUAAUUUC UUCAUUCUUUUU
bPIV3-Ka/SF UCCUAAUUUC UUCAUUCUUUUU
bPIV3-910N UCCUAAUUUC UUCAUUCUUUUU
bPIV3-Q5592 UCCUAAUUUC UUUAUUCUUUUU
hPIV3 UCCUAAUUUC UUUAUUCUUUUU
P
Texas81 UCCUAAUUACb UUCAUUCUUUUU
ISU92 UCCUAAUUGC UUCAUUCUUUUU
bPIV3-Ka/SF UCCUAAUUAC UUCAUUCUUUUU
bPIV3-910N UCCUAAUUGC UUCAUUCUUUUU
bPIV3-Q5592 UCCUAAUUGC CUAAUUCUUUUUc
hPIV3 UCCUAAUUUC UUCAUUCUUUUU
M
Texas81 UCCUACUUUC UUUUU-----------------AGUUUUU
ISU92 UCCUAUUUUC UUUUU-----------------AGUUUUU
bPIV3-Ka/SF UCCUACUUUC UUUUU-----------------AGUUUUU
bPIV3-910N UCCUAUUUUC UUUUU-----------------AGUUUUU
bPIV3-Q5592 UCCUUAUUUC UUUUU-----------------AGUUUUU
hPIV3 UCCUAAUUUC UUUAUUCCCUAUUAGUUUUU
F
Texas81 UCCUAGUUUC UUCAUGUUUUUU
ISU92 UCCUAGUUUC UUCAUGUUUUUU
bPIV3-Ka/SF UCCUAGUUUC UUCAUGUUUUUU
bPIV3-910N UCCUAGUUUC UUCAUGUUUUUU
bPIV3-Q5592 UCCUAGUUUU UUUAUCUUUUUU
hPIV3 UCCUGUUUUC CUAAUAUUUUUU
HN
Texas81 UCCUUGUUUC UUAUUAUUUUUU
ISU92 UCCUUGUUUC UUAAUGUUUUUU
bPIV3-Ka/SF UCCUUGUUUC UUAUUAUUUUUU
bPIV3-910N UCCUUGUUUC UUAAUGUUUUUU
bPIV3-Q5592 UCCUUGUUUC UUAUUAUUUUUU
hPIV3 UCCUCAUUUC UUUAUAUUUUUU
L
Texas81 UCCUCCUUUC UUCAUUCUUUUU
ISU92 UCCUCCUUUC UUCAUUCUUUUU
bPIV3-Ka/SF UCCUCUUUUC UUCAUUCUUUUU
bPIV3-910N UCCUCCUUUC UUCAUUCUUUUU
bPIV3-Q5592 UCCUCUUUUC UUUAUUCUUUUU
hPIV3 UCCUCGUUUC UUCAUUCUUUUU
Consensus: UCCUNNUUNC NUNNUNNUUUUU
a. Host-specific nucleotide residues between hPIV3 and bPIV3 are in red;
b. Positions that display variability within the host group are in blue;
c. Positions that unique in bPIV3-Q5592 are in bold.
160
Table 3. Comparison of gene sequences between swine, bovine and human PIV3 viruses
Gene Virus
mRNA Deduced protein
Length 3’ UTR
(nt)
ORF
(nt)
5' UTR
(nt) Length Calculated MW pI
N
Texas81 1646 55 1545 46 515 57303.70 5.009
ISU92 1646 55 1545 46 515 57340.89 5.217
bPIV3a 1646 55 1545 46 515 57303.70 5.009
hPIV3 1646 55 1545 46 515 57840.25 5.212
P
Texas81 1995 79 1788 128 596 69185.44 5.789
ISU92 1995 79 1788 128 596 66290.29 5.718
bPIV3 1995 79 1788 128 596 66459.46 5.576
hPIV3 2013 79 1809 125 603 67794.65 5.292
M
Texas81 1149 32 1053 64 351 39327.09 9.473
ISU92 1149 32 1053 64 351 39252.06 9.610
bPIV3 1149 32 1053 64 351 39327.09 9.473
hPIV3 1155 32 1059 64 353 39571.39 9.582
F
Texas81 1869 211 1620 38 540 60188.74 6.539
ISU92 1893 235 1620 38 540 60039.42 6.797
bPIV3
1869 211
1620
38
540
60188.74 6.539
1893(910N) 235 38 60007.41 7.025
1887(Q5592) 223 44 60128.69 6.796
hPIV3 1851 193 1617 41 539 59978.35 7.499
HN
Texas81 1888 73 1716 99 572 64624.47 7.720
ISU92 1888 73 1716 99 572 64652.46 7.343
bPIV3 1888 73
1716 99 572 64623.48 7.869
1912(Q5592) 97 64431.41 7.504
hPIV3 1888 73 1716 99 572 64313.66 7.546
L
Texas81 6795 22 6699 74 2233 255734.70 6.281
ISU92 6795 22 6699 74 2233 255814.76 6.161
bPIV3 6795 22 6699 74 2233 255801.85 6.220
hPIV3 6795 22 6699 74 2233 256071.48 6.394
a bPIV3 indicates bPIV3 shipping fever stain if not specified.
161
Table 4. Subunit hexamer phasing positions for gene start sites and P editing sites of a
selection of Paramyxovirinae
Genus Virus(es) N P/V M F HN L P Edit
Respirovirus
sPIV3 2 1 1 1 1 2 2
hPIV3, bPIV3 2 1 1 1 1 2 2
SeV 2 1 1 1 1 2 1
Rubulavirus SV5 2 1 1 2 1 6 3
MuV 2 1 6 1 1 6 3
Morbillivirus CDV,DMV 2 2 4 2 3 2 6
MeV, RPV 2 2 4 3 3 2 6
Avulavirus NDV 2 4 4 4 3 6 1
Henipavirus HeV 2 3 4 4 4 3 5
Unclassified
ASPV 2 2 1 2 3 4 2
TPMV 2 2 1 3 3 2 6
FDLV 2 2 4 3 6 3 2
162
Table 5. Amino acid identities of swine parainfluenzaviruses with analogous proteins in
other paramyxoviruses.
Paramyxovirus
genus Species
% Amino acid identiy between sPIV3 and other paramyxovirus proteins
N P M F Aa L
Tb Ib T I T I T I T I T I
Respirovirus
sPIV3b 97.1 87.6 96.6 95.0 96.0 99.2
bPIV3 100 97.1 100 87.6 100 96.6 100 95.0 99.8 95.8 98.7 98.2
hPIV3 86.2 86.4 64.3 65.4 92.6 92.0 82.6 81.9 77.1 77.6 90.6 90.6
hPIV1 60.6 61.0 24.1 24.5 64.6 63.1 42.7 42.7 45.8 45.6 60.7 60.7
SeV 62.6 62.6 23.7 24.5 64.0 63.7 43.1 42.9 46.7 46.0 59.7 59.7
Rubulavirus
MenV 19.2 19.2 9.2 9.2 19.9 19.9 23.4 23.0 15.2 15.4 28.5 28.5
SV5 18.5 18.8 8.8 8.5 18.4 18.1 24.8 24.0 25.9 25.5 29.4 29.4
hPIV2 18.5 18.6 6.4 5.9 18.7 18.4 25.2 25.0 24.0 24.4 28.4 28.3
LPMV 18.3 18.8 8.5 8.8 18.2 18.8 24.4 24.4 25.6 25.6 28.5 28.4
Avulavirus
NDV 20.1 20.3 5.9 5.9 19.9 20.5 25.0 24.9 23.2 23.0 26.2 26.3
aPMV2 20.6 20.0 10.7 10.2 17.9 18.2 22.0 22.2 21.0 21.2 27.2 27.1
aPMV6 17.9 17.7 7.6 8.8 22.9 22.3 24.2 24.6 20.9 20.5 26.8 26.8
Morbillivirus MeV 20.8 20.8 9.4 9.4 37.2 37.2 25.7 25.7 11.6 11.8 37.6 37.6
RPV 19.8 19.4 9.5 9.7 37.2 37.2 24.8 24.2 11.6 11.3 37.4 37.6
Henipavirus NiV 20.2 19.8 10.0 10.0 32.5 31.9 27.7 28.1 18.9 19.4 39.7 39.7
HeV 20.2 19.8 10.6 10.0 32.7 32.5 26.9 26.7 18.9 19.6 38.8 38.8
Metapneumovirus hMPV 12.2 11.5 13.9 13.9 10.6 9.8 15.3 15.3 10.6 11.0 16.7 16.8
aMPV 12.0 11.5 14.3 15.0 9.8 9.1 14.6 14.8 8.8 9.1 17.0 17.0
Pneumovirus hRSV 11.1 11.5 12.0 12.0 9.4 9.4 13.2 12.9 11.7 12.3 15.1 15.1
bRSV 11.1 11.8 12.9 14.0 9.8 9.8 12.9 13.2 12.0 12.0 15.4 15.1
Unclassified virus
ASPV 24.8 23.4 9.5 10.5 39.2 40.1 31.7 31.7 37.0 37.4 48.3 48.5
BeV 23.8 23.3 8.9 9.1 36.0 35.7 28.0 27.6 24.2 24.4 37.9 38.0
J-V 20.5 21.5 7.5 7.8 36.0 35.7 28.9 29.3 24.1 24.8 38.6 38.8
FDLV 21.4 21.7 11.3 12.3 36.0 35.8 30.1 30.3 36.4 36.6 42.4 42.5
a A, attachment protein. The attachment protein for morbilliviruses is H; for henipaviruses,
metapneumoviruses, pneumoviruses, BeV, J-V is G; for remaining is HN.
b T indicates Texas81, I indicates ISU92, the identities in the row sPIV3 indicates the identities between
the two swine strains.
163
3.8 Figures
Figure 1. Strategy for rapid Amplification of cD?A Ends (RACE) (adapted from Li et al.
2005). For 5′RACE, cDNA synthesis was carried out first using a virus-specific primer-1 (VSP5-
1), followed by RNaseH treatment, then ligation of adaptor (DT88). In 3′ RACE, adaptor ligation
was carried out first directly with the viral RNA, followed by cDNA synthesis using the DT89
primer complementary to adaptor DT88. The remaining steps of the primary and hemi-nested
PCRs are the same for both RACE methods with DT89 and VSPs using standard procedures.
164
(A) 3’ leader
bPIV3-910N 3’-UGGUUUGUUCUCUUCUCUGAACGAACCCUUAUAAUUAAGUCUAUUUUUAAUUGAA
bPIV3-Ka 3’-UGGUUUGUUCUCUUCUCUGAACGAACCCUUAUAAUUAAGUUUAUUUUUAAUUGAA
bPIV3-SF 3’-UGGUUUGUUCUCUUCUCUGAACGAACCCUUAUAAUUAAGUUUAUUUUUAAUUGAA
bPIV3-Q5592 3’-UGGUUUGUUCUCUUCUCUGAACGAACCUUUAUGUUUAAGUUUAGUUUUAAUUGAA
hPIV3-Wash 3’-UGGUUUGUUCUCUUCUUUGAACAAACCUUUAUAUUUAAAUUUAAUUUUAAUUGAA
hPIV3-JS 3’-UGGUUUGUUCUCUUCUUUGAACAGACCCUUAUAUUUAAAUUGAAAUUUAAUUGAA
ISU92 3’-UGGUUUGUUCUCUUCUCUGAACAAACCCUUAUAAUUAAGUUUAUUUUUAAUUGAA
Texas81 3’-UGGUUUGUUCUCUUCUCUGAACAGACCCUUAUAAUUAAGUUUAUUUUUAAUUGAA
(B) 5’ trailer bPIV3-910N GUAUAUUAUAUAUAUAUGGUUUGUCUCAAAAAGAGAACAAACCA-5’
bPIV3-Ka GUACAUUAUAUAUAUAUGGUUUGUCUCAAAAAGAGAACAAACCA-5’
bPIV3-SF GUAUAUUAUAUGUAUAUGGUUUGUCUCAAAAAGAGAACAAACCA-5’
bPIV3-Q5592 GUAUUUUAUAUAUAUAUGGUUUGUCUCAAAAAGAGAACAAACCA-5’
hPIV3-Wash GUACAUUAUAUAUAUAUGGUUUGUCUCAAGAAGAGAACAAACCA-5’
hPIV3-JS GUACAUUAUAUAUAUAUGGUUUGUCUCAAGAAGAGAACAAACCA-5’
ISU92 GUAUAUUAUAUAUAUAUGGUUUGUCUCAAAAAGAGAACAAACCA-5’
Texas81 GUAUAUUAUAUGUAUAUGGUUUGUCUUAAAAAGAGAACAAACCA-5’
(C) Genomic termini ISU92
3’- UGGUUUGUUCUCUUCUCUGAACAAACCCUUAUAAUUAAGUUUAUUUUUAAUUGAA
5’- ACCAAACAAGAGAAAAACUCUGUUUGGUAUAUAUAUAUUAUAUG
Texas81
3’- UGGUUUGUUCUCUUCUCUGAACAGACCCUUAUAAUUAAGUUUAUUUUUAAUUGAA
5’- ACCAAACAAGAGAAAAAUUCUGUUUGGUAUAUGUAUAUUAUAUG
Figure 2. ?ucleotide sequence of the 3’ leader (A), 5’ trailer (B) regions and genomic
termini (C) of PIV3 genomic R?A. Sequences are 3’ to 5’ in negative sense. (A,B) Nucleotide
residues in blue are host-specific (bPIV3 or hPIV3). Host-specific positions are those where
bPIV3 strains share an assignment and hPIV3 strains share a different assignment. Positions that
display variability within a host species are in red. (C) Shading indicates complementary base
pairs.
165
Figure 3. Schematic of P protein structure, P gene expression strategy and R?A editing site
sequence of swine viruses compared with other paramyxoviruses. The scale bar at the top
indicates the amino acid of P protein, and the boxes below indicate possible reading frames of
protein P, V, D and C. known functional domains are indicated for chaperoning uassembled N
proteins during the nascent chain assembly of genome replication (N), self-assembly as a
tetramer (4’mer), L protein-binding site (L), and N-RNA-binding site (N:RNA) based on the
study of sendai virus (Robert A. Lamb, 2007). In the editing site sequences, AnGn elements are
spacing between An and Gn to facilitate visual comparison (Hausmann et al., 1999; Robert A.
Lamb, 2007).
aa 400 200 300 500 100
N 4’mer N:RNA L
Editing Site (794-802 nt)
V protein (412 aa) +1G
D protein (367 aa) +2G
C protein (201 aa) Alternative initiation
Cys-Rich
sPIV3 AAAAAA GGG
Respirovirus AAAAAA GGG
Morbillivirus AAAAA GGG
Rubulavirus AAGA GGGG(n)
Avulavirus AAAAA GGG
Henipavirus AAAAA GGG
ASPV AAAAAA GG
J-V AAAAAA GG
BeV AAAAA GG
FDLV AUAA GGGGGG
TPMV AAAAAA GG
Polymerase cofactor Nascent chain assembly P protein
(596 aa)
166
Figure 4. Amino acid sequence alignment of the conserved cysteine-rich C-terminal region
of selected paramyxovirus V proteins. Positions of the conserved seven conserved cysteine
residues that are involved in Zn binding are underlined.
Texas81 SWCNPICSKIRPIPRQESCVCGECPKQCRYCI
ISU92 SWCNPICSKIRPIPRQESCVCGECPKQCGYCI
bPIV3-SF SWCNPICSKIRPIPRQESCVCGECPKQCRYCI
hPIV3 SWCNPICSKIRPVPRQESCVCGECPKQCGYCI
SeV SWCNPVCSRIRIIPRRELCVCKTCPKVCKLCR
MenV EWCNPICHPISQSTFRGSCRCGNCPGICSLCE
SV5 EWCNPSCSPITAAARRFECTCHQCPVTCSECE
hPIV2 EWCNPRCAPVTASARKFTCTCGSCPSICGECE
LPMV EWCNPACSPISMEPRYYQCTCGTCPAKCPQCA
NDV SWCNPSWSPIKAEPKQYPCFCGSFPPTCRLCA
aPMV2 SWCNPVCSPIRSEPRREKCTCGTCPESCILCR
aPMV6 EWCNPVCAPVTPEPRAFKCICGRCPRVCINCR
MeV EWCNPICHPISQSTFRGSCRCGNCPGICSLCE
RPV RWCNPTCSKVTVGTVRAKCICGECPRVCEQCI
Nipah EWCNPACSRITPLPRRQECQCGECPTECFHCG
HeV EWCNPVCSRITPQPRKQECYCGECPTECSQCC
J-V EWCNPQCAPITVTPTQSRCTCGECPKVCARCI
BeV EWCNPQCAPLTVTPTQKECSCGECPRQCARCI
ASPV SWCNPQCAPIRRTPYREVCRCGGCPEECPDCS
TPMV SWCNPMCARIRPLPIREICVCGRCPLKCSKCL
FDLV EFCNPMCSRITPDFKPKICVCGECPRYCPRCK
167
Figure 5. Schematic overview of important features and conserved domains found in the
predicted L-protein amino acid sequences. Positions of the conserved RNA-dependent RNA
polymerase major domains DI-DVI, and subdomains A–D within DIII (Poch et al., 1990) are
indicated. In addition, the template recognition site in DII, conserved GDNQ sequence in
subdomain C, and a putative ATP-binding site motif (K–X21–G–E–G–A–G) in major domain
VI (Harcourt et al., 2001) are shown.
1600 800 1200 2000 400
Template recognition site
(543-562)
ʬ
225-417 653-876 927-1092 1129-1378 1770-1851
ATP binding site 1786
K-X21-G-E-G-A-G1810
Hinge
DIII DIV DVI DI DII DV
503-607
B C A D
659-671 768-777 838-851 730-754
Polymerization active site 772
G-D-N-Q775
aa
(A)
Figure 6. Phylogenetic analysis.
4.01) analysis with 1000 bootstrap replicate
compared with other members
genotypes based on N and M gene nucleotide sequences, respectively. The numbers over the
branches indicate the percentage of 10
branch. Strain information and GenBank accession numbers are presented in Materials and
Methods.
168
. Phylogenetic analysis. Phylogenetic analysis was performed using Parsimony (PAUP
with 1000 bootstrap replicates, based on M gene (A) nucleotide sequences
of Paramyxoviridae. (B, C) Phylogenetic analysis of PIV3
genotypes based on N and M gene nucleotide sequences, respectively. The numbers over the
branches indicate the percentage of 1000 bootstrap replicates that support each phylogenetic
branch. Strain information and GenBank accession numbers are presented in Materials and
Phylogenetic analysis was performed using Parsimony (PAUP
s, based on M gene (A) nucleotide sequences
C) Phylogenetic analysis of PIV3
genotypes based on N and M gene nucleotide sequences, respectively. The numbers over the
00 bootstrap replicates that support each phylogenetic
branch. Strain information and GenBank accession numbers are presented in Materials and
(B)
(C)
169
170
Figure 7. Rectal temperature in experimentally inoculated pigs. The rectal temperatures of
Texas81 and ISU92 or mock-inoculated pigs were recorded two times per day during the
experiment and the mean + standard deviation of temperatures for each group at each time point
were plotted.
98
99
100
101
102
103
104
105
1063
:00
pm
7:0
0am
3:0
0p
m
7:0
0am
7:0
0am
3:0
0p
m
7:0
0am
3:0
0p
m
7:0
0am
3:0
0p
m
7:0
0am
3:0
0p
m
7:0
0am
3:0
0p
m
7:0
0am
3:0
0p
m
7:0
0am
3:0
0p
m
7:0
0am
3:0
0p
m
7:0
0am
Day
-2
Day -1 Day
0
Day 1 Day 2 Day 3 Day 4 Day 5 Day 6 Day 7 Day 8 Day
9
Rec
tal
Tem
pera
ture
(°F
)Temperature Record
Control
Texas81
ISU92
171
General Conclusion
In conclusion, the complete genome of Texas81 virus was 15456 nucleotides (nt) and ISU92
was 15480 nt in length consisting of six non-overlapping genes coding for the nucloeo- (N),
phospho- (P), matrix (M), fusion (F), hemagglutinin-neuraminidase (HN) and large
polymerase (L) protein in the order 3'-N-P/C/V-M-F-HN-L-5'. The features related to virus
replication and found to be conserved in most members of Paramyxoviridae were also found
in swine viruses. These include: conserved and complementary 3’ leader and 5’ trailer
regions, trinucleotide intergenic sequences, highly conserved gene start and gene stop signal
sequences. The length of each gene of these two viruses were similar except for the F gene,
in which ISU92 had an additional 24 nt “U” rich 3’ untranslated region (UTR). The P gene of
these viruses were predicted to express P protein from the primary transcript and edit a
portion of its mRNA to encode V and D proteins and the C protein was expected to be
expressed from alternate translation initiation from the P gene as in Respiroviruses. Sequence
specific features related to virus replication and host specific amino acid signatures in N, F,
HN, L proteins indicated that these viruses probably originated from bovine
parainfluenzavirus 3. Phylogenetic analysis based on the individual genes as well as
predicted amino acid sequences suggested that these swine parainfluenzaviruses are novel
members of the genus Respirovirus of the Paramyxovirinae subfamily, genotype A of bovine
parainfluenza virus type 3 and distributed into two subgenotypes of genotype A. The mild
clinical signs and undetectable gross and microscopic lesions observed in sPIV3-infected
pigs indicate the inapparent nature of these viruses in pigs. The mild pathogenicity and
limited replication of sPIV3 in the lungs of pigs can facilitate its development as a mucosal
vaccine vector.