Colorado Commission on Criminal and Juvenile Justice: FY ... · Norm Mueller Criminal Defense Attorney Lenya Robinson Colorado Department of Health Care Policy and Financing ... legalization

colorado commission on criminal & juvenile justice

ANNUAL REPORT 2017

CCJJANNUAL REPORT 2017Report to the Governor, the Speaker of the House of Representatives, the President of the Senate, and the Chief Justice of the Colorado Supreme Court, pursuant to C.R.S. 16-11.3-103(5)

Office of Research and Statistics Kim English, Research Director

Division of Criminal Justice Joe Thome, Director

Department of Public Safety Stan Hilkey, Executive Director

700 Kipling Street, Suite 1000Denver, Colorado 80215T 303-239-4442F 303-239-4491http://www.colorado.gov/ccjj

ii

2017 Annual Report | Colorado Commission on Criminal & Juvenile Justice

iii

CCJJ | 2017 Annual Report

Table of Contents

v Acknowledgements

vii Commission members

ix Task force and committee members

xiii Commissionstaff

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

1 Section 1: Introduction

3 Section 2: Legislative intent and membership

5 Section 3: Activities of the Commission

17 Section 4: Recommendations and outcomes

41 Section 5: Next steps

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

43 Section 6: Appendices

45 Appendix A: Disproportionate minority contact

53 Appendix B: Community Law Enforcement Action Reporting Act

75 Appendix C: Impact of Senate Bill 13-250 / Concerning changes to sentencing of persons convicted of drug crimes

89 Appendix D: Commission Recommendation FY16-RE01

93 Appendix E: Commission Recommendation FY17-RE01

103 Appendix F: Commission Recommendation FY17-RE02

109 Appendix G: Commission Recommendation FY17-RE03

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Tables:

2 Table 1.1: Commission supported bills presented to the 2017 General Assembly

18 Table 4.1: 2017 Legislative Session “Commission Bills”

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Figures:

6 Figure 3.1: Commission, task force and committee organizational chart

iv


v


Acknowledgements

Fiscal Year 2017 marked the Commission’s 10th year of work. Under the leadership of Chair Stan Hilkey and Vice-Chair Doug Wilson, the Commission continueditseffortstostudyandmakerecommen-dations to improve the state’s justice system.

The Commission is grateful for its dedicated task force chairs: Peter Weir, Community Corrections Task Force chair; Jeanne Smith, Data Sharing Task Force chair; Stan Hilkey, Re-entry Task Force Chair; SheriffJoePelle,MentalHealth/JailsTaskForcechair;Robert Werthwein, Juvenile Continuity of Care Task Forcechair;andDougWilson,MandatoryParoleCommittee chair.

The Commission could not complete its work without the dedication of dozens of task force and working group members who volunteer their time to work on topics the Commission has prioritized. The task force members attend at least monthly

meetings and undertake homework assignments inbetweenmeetings,reflectingastrongdedica-tion to improving the administration of justice in Colorado. These professionals invest consider-able time to study and discuss improvements in current processes, and the Commission is grateful for their expertise and commitment to this work. In particular, the Commission is appreciative for the workofMarkEvansfromtheOfficeofthePublicDefender, Patrick Fox from the Department of Human Services, Frank Cornelia from the Colorado Behavioral Health Council, Abigail Tucker from the CommunityReachCenter,andMelissaRobertsfromthe Department of Corrections.

Finally, the Commission is particularly grateful to itsconsultant,RichardStroker.Mr.Strokerhasprovided guidance, perspective, encouragement and clarity to the Commission during Fiscal Year 2017.

vi


vii


Commission members

Stan HilkeyChair Executive DirectorDepartment of Public Safety

Douglas K. WilsonVice Chair State Public Defender

Jennifer BradfordMetropolitanStateUniversityofDenverRepresentative for the Executive Director of the Department of Higher Education

John Cooke State Senator, Senate District 13Representing the State Legislature (R)

Valarie Finks(appointedOctober2016)Victims Representative, 18th Judicial DistrictRepresentingVictims’RightsOrganizations

Kelly Friesen Grand County Juvenile Justice DepartmentRepresenting Juvenile Justice

Charles Garcia At-large

Mike Garcia (appointed July 2016)Director, Division of Probation ServicesRepresenting Colorado State Judicial

Jessica Jones Private Defense AttorneyAt-large

Daniel Kagan (appointed January, 2017) State Senator, Senate District 26Representing the State Legislature (D)

William KilpatrickChief, Golden Police DepartmentRepresenting Chiefs of Police

Evelyn Leslie Colorado School for Family TherapyRepresentingMentalHealthTreatmentProviders

Beth McCann (resigned December 2016)State Representative, House District 8Representing the State Legislature (D)

Joe MoralesChairman, Colorado State Board of ParoleRepresenting the State Board of Parole

Norm MuellerCriminal Defense AttorneyHaddon,Morgan,&Foreman,P.C.

Kate Horn-Murphy (resignedOctober2016)Victims Representative, 17th Judicial DistrictRepresentingVictims’RightsOrganizations

Joe PelleSheriff,BoulderCountyRepresentingColoradoSheriffs

Rick RaemischExecutive DirectorDepartment of Corrections

viii


Rose Rodriquez Community CorrectionsAt-large

Joseph Salazar (appointed January 2017) State Representative, House District 31Representing the State Legislature (D)

Lang Sias State Representative, House District 27Representing the State Legislature (R)

Pat Steadman (resigned December 2016) State Senator, Senate District 31Representing the State Legislature (D)

Scott Turner Deputy, Criminal Justice SectionRepresentingtheAttorneyGeneral’sOffice

Michael Vallejos Chief Judge, 2nd Judicial DistrictRepresenting Colorado State Judicial

David Weaver Douglas County CommissionerRepresenting County Commissioners

Peter A. Weir District Attorney, 1st Judicial DistrictRepresenting District Attorneys

Robert Werthwein Children, Youth and Families, DirectorDepartment of Human Services

Meg Williams Vice-Chair, Juvenile Parole BoardRepresenting the Chair of the Juvenile Parole Board

Dave Young District Attorney, 17th Judicial DistrictRepresenting District Attorneys

Jeanne M. Smith (resigned February, 2017)Director of the Division of Criminal JusticeDepartment of Public Safety Non-Voting Member

Joe Thome(designatedMarch,2017)Director of the Division of Criminal JusticeDepartment of Public Safety Non-Voting Member

ix


Task force and committee members

Community Corrections Task Force

Name Affiliation

Peter Weir, Chair DistrictAttorney’sOffice,1stJudicialDistrictDennisBerry MesaCountyCriminalJusticeSystemJoe Cannata Voices of VictimsShannon Carst Colorado Community Corrections CoalitionJohn Cooke State Senator, Senate District 13 HarrietHall JeffersonCenterforMentalHealthPaulHollenbeck DepartmentofCorrections,OffenderServicesBrian Hulse Intervention Community Corrections Services GregMauro DenverPretrialServicesMikeMcIntosh AdamsCountySheriff’sDepartmentKathrynOtten JeffersonCountyJusticeServicesMelissaRoberts DepartmentofCorrections,AdultParoleRose Rodriguez Independence HouseKevinStrobel PublicDefender’sOfficeGlennTapia DivisionofCriminalJustice,OfficeofCommunityCorrectionsMichaelVallejos ChiefJudge,2ndJudicialDistrictAlexandra Walker Parole Board Dave Weaver Douglas County CommissionerDana Wilkes Division of Probation Services

Data Sharing Task Force

Name Affiliation

Jeanne Smith, Chair Division of Criminal Justice KrisNash StateCourtAdministrator’sOffice,ProbationServicesScottTurner AttorneyGeneral’sOfficeLang Sias State Representative, House District 27 MegWilliams DivisionofCriminalJustice,OfficeofAdultandJuvenileJusticeAssistanceMaureenCain ColoradoCriminalDefenseBar

July 2016 - June 2017

x


Juvenile Continuity of Care Task Force

Name Affiliation

Robert Werthwein, Chair DepartmentofHumanServices,OfficeofChildren,Youth&FamiliesKellyFriesen GrandCountyJuvenileJusticeDepartment&SenateBill94,14thJudicialDistrictMegWilliams DivisionofCriminalJustice,OfficeofAdultandJuvenileJusticeAssistanceBill Kilpatrick Golden Police Department SusanColling StateCourtAdministratorsOffice,ProbationServicesBill Delisio Colorado Judicial Branch, Family Law ProgramsShawn Cohn Denver Juvenile ProbationAnders Jacobson Department of Human Services, Division of Youth CorrectionsMikeTessean JeffersonCountyJuvenileAssessmentCenterSheriDanz OfficeofChild’sRepresentativeAngelaBrant PublicDefender’sOfficeDanMakelky DouglasCountyHumanServicesRebeccaGleason DistrictAttorney’sOffice,18thJudicial

Legislative Committee

Name Affiliation

Stan Hilkey Department of Public SafetyDouglasWilson PublicDefender’sOfficeScottTurner AttorneyGeneral’sOffice,CriminalJusticeSectionNormMueller CriminalDefenseAttorneyJoePelle BoulderCountySheriff’sDepartmentTom Raynes Colorado District Attorneys’ CouncilJeanne Smith Division of Criminal Justice

xi


Mental Health/Point of Contact through Jail Release Task Force

Name Affiliation

Joe Pelle, Chair BoulderCountySheriff’sDepartmentJamison Brown Colorado Jail AssociationJohn Cooke State Senator, Senate District 13Frank Cornelia Colorado Behavioral Healthcare CouncilPatrickFox OfficerofBehavioralHealthCharlieGarcia CCJJAt-LargeMemberTina Gonzales Colorado Health PartnershipsEvelynLeslie MentalHealthTreatmentProviderBethMcCann StateRepresentative,HouseDistrict8MatthewMeyer MentalHealthPartnersJoeMorales ParoleBoardNormMueller CriminalDefenseAttorneyLenya Robinson Colorado Department of Health Care Policy and FinancingCharlesSmith SubstanceAbuseandMentalHealthServicesAdministrationAbigail Tucker Community Reach CentersMichaelVallejos ChiefJudge,2ndJudicialDistrictDave Weaver Douglas County CommissionerDougWilson PublicDefender’sOffice

Pretrial Release Task Force

Name Affiliation

Stan Hilkey, Chair Department of Public SafetyDouglasWilson PublicDefender’sOfficeCharles Garcia CCJJ At Large memberBill Kilpatrick Golden Police Department JenniferBradford MetroStateUniversityValarie Finks Victims Representative, 18th Judicial DistrictMikeGarcia DivisionofProbationServicesJoseph Salazar State Representative, House District 31Lang Sias State Representative, House District 27MaureenCain CriminalDefenseAttorneyBoZeerip DistrictAttorney’sOffice,21stJudicialDistrictCliffordRiedel DistrictAttorney’sOffice,8thJudicialDistrictPatrickMurphy Judge,17thJudicialDistrictGregMauro DenverCommunityCorrectionsSteve Chin Colorado Association of Pretrial Services KirkTaylor PuebloCountySheriff’sOfficeMonicaRotner BoulderCountyCommunityJusticeServices

xii


Re-entry Task Force

Name Affiliation

Stan Hilkey, Chair Department of Public SafetyJenniferBradford MetroStateUniversityofDenverMonicaChambers DepartmentofCorrectionsMarkEvans PublicDefender’sOfficeTom Giacinti Community Corrections RepresentativeReginaHuerter DenverCrimePrevention&ControlCommissionSherriHufford StateCourtAdministrator’sOffice,ProbationServicesJessica Jones Private Defense AttorneyHassan Latif Second Chance CenterAlfredo Pena Parole BoardRick Raemisch Department of CorrectionsMelissaRoberts DepartmentofCorrections,DivisionofParoleRose Rodriguez Community CorrectionsPat Steadman State Senator, Senate District 31DaveYoung DistrictAttorney’sOffice,17thJudicialDistrictAdamZarrin Governor’sOffice

xiii


Commissionstaff

Kim EnglishOfficeofResearchandStatisticsDivision of Criminal Justice

Richard StrokerConsultant

Peg FlickOfficeofResearchandStatisticsDivision of Criminal Justice

Kevin L. FordOfficeofResearchandStatisticsDivision of Criminal Justice

Linda HarrisonOfficeofResearchandStatisticsDivision of Criminal Justice

Gabby ReedExecutiveDirector’sOfficeDepartment of Public Safety

Laurence LuceroOfficeofResearchandStatisticsDivision of Criminal Justice

Germaine MieraOfficeofResearchandStatisticsDivision of Criminal Justice

xiv


Section 1 | Introduction

1

Introduction

This report documents the Commission’s tenth year of activities and accomplishments. It describes the Commission’s activities between July 1, 2016 and June 30, 2017. During Fiscal Year 2017, the Commission’s work focused on the continuity of care for juveniles involved in both the justice and child welfare systems, pretrial release, re-entry, community corrections and issues related to the mental health of individuals from point-of-contact with law enforcement through release from jail. The Commission also explored issues regarding Colorado’s crisis response system, marijuana legalization and the housing crisis faced by justice involved individuals. Commissioners received an in-depth data presentation on the impact of Senate Bill 13-250, a years-long Commission initia-tive that resulted in a new sentencing grid for individuals convicted of drug crimes. Additionally, theCommissionwaskeenlyinterestedinthefind-ings from the Community Law Enforcement Action Reporting Act, or the CLEAR Act, which analyzes deci-sions made at multiple points in the justice system process by race, ethnicity and gender.

After months of study, in Fiscal Year 2017, the Commission approved ten recommendations in the areas of community corrections, re-entry, and crisis services and emergency mental health commitment placement. During the 2017 legislative session, the content of four recommendations became three pieces of legislation and were signed into law by Governor Hickenlooper (see Table 1.1). Legislative reforms are one type of systemic change the Commission promotes. It also recommends changes to operational policy, business practice, and agency philosophy.

This 2017 report is organized as follows: Section 2 provides a summary of the Commission’s mission asreflectedintheenablinglegislation’soriginallegislative intent along with its membership; Section 3 discusses Commission, task force and committee activities from July 2016 through June 2017; Section 4 details the Commission’s recommendations and outcomes, including the recommendations that resulted in 2017 legislation; and Section 5 describes the Commission’s next steps.

1

2


Table 1.1. Commission-supported bills presented to the 2017 General Assembly

Bill number Bill title Status

House Bill 17-1147 Concerningdefiningthepurposesofcommunitycorrectionsprograms.

[Commission Recommendation FY17-CC01 included in this bill]

Signed

House Bill 17-1308 Concerning allowing individualized conditions of parole.

[Commission Recommendation: FY16-RE01 included in this bill]

Signed

Senate Bill 17-207 Concerning strengthening Colorado’s statewide response to behavioral health crises, and, in connection therewith, making an appropriation.

[CommissionRecommendationsFY17-MH01andFY17-MH02includedinthisbill]

Signed

Section 2 | Legislative Intent and Membership

3

Legislative intent and membership

The Commission is comprised of 26 voting members andoneex-officio,non-votingmember.Eighteenmembersareappointedrepresentativesofspecificstakeholdergroups,andeightareidentifiedtoservebasedontheirofficialposition.Termsoftheappointed representatives are variable. For more information please see House Bill 07-1358, which established the Commission, available on the CCJJ website at http://cdpsweb.state.co.us/cccjj/legisla-tion.html.

During Fiscal Year 2017 the Commission welcomed fivenewmembers:ValarieFinksreplacedKateHorn-MurphyastherepresentativeforVictims’

RightsOrganizations,andMikeGarciawasdesig-natedtofillthevacantColoradoStateJudicialposition. Senator Daniel Kagan replaced Senator Pat Steadman and Representative Joe Salazar replaced RepresentativeBethMcCann.TheDirectoroftheDivision of Criminal Justice, Jeanne Smith, retired during Fiscal Year 2017 and her replacement, Joe Thome,filledtheex-officioposition.Additionally,theCommission welcomed Richard Stroker as the new Commissionconsultant.Mr.Strokerreplacedlong-time consultant Paul Herman after he retired at the end of Fiscal Year 2016.

2

http://cdpsweb.state.co.us/cccjj/legislation.html

http://cdpsweb.state.co.us/cccjj/legislation.html

4


Section 3 | Activities of the Commission

5

Activities of the Commission

This section summarizes the activities and accomplish-ments of the Commission in Fiscal Year 2017. The topics covered in this section include the following:

• A report on the work of the Commission’s Task Forces and Committees,

• A summary of the educational presentations made to the Commission regarding local and nationalcriminaljusticeinitiativesandefforts,and

• A description of the planning process undertaken todefinetheworkstrategyfortheCommission’spriority issue areas for calendar year 2017.

Commission task forces and committees1 The Commission’s strategic plan for Fiscal Year 2017 included a focus on the following areas of study:

Continued work on community corrections, data sharing, juvenile continuity of care, mental health from the point of contact through jail release and re-entry. The Commission also established one new task force in the spring of 2017 to address work in the area of pretrial release. To this end, Commission work during Fiscal Year 2017 was undertaken by the following six groups:

• Community Corrections Task Force (Peter Weir, Chair)

• Data Sharing Task Force (Jeanne Smith, Chair)

• Juvenile Continuity of Care Task Force (Robert Werthwein, Chair)

• MentalHealth/PointofContactThroughJailRelease Task Force (Joe Pelle, Chair)

• Pretrial Release Task Force (Stan Hilkey, Chair)

• Re-entry Task Force (Stan Hilkey, Chair)

3

1 Task forces are long term working groups with multiple objectives; Committees are typically short term (usually meeting for less than one year) with focused objectives.

6


Figure3.1reflectstheorganizationandscopeofwork undertaken by the Commission, Task Forces and Committees.

Community Corrections Task Force

Community Corrections in Colorado refers to a system of halfway houses located throughout the state that provide residential and community-based programming to individuals who are being diverted from prison as well as those transitioning from prison back to the community. The Community Corrections Task Force began meeting in April 2013, chaired by Commission member Peter Weir. The following is the Task Force’s statement of the purpose of community corrections:

The purpose of community corrections is to ensure public safety and further the sentencing goals of the State of Colorado. This is accomplished by utilizing community correc-tions boards and the local community to identify appropriate individuals to be placed in the community, implement research-based policies, practices and programs to assist indi-viduals so that they may successfully function in the community.

During Fiscal Year 2017, the Community Corrections Task Force concluded more than three years of work with a focus on recommendations relating to the Intensive Supervision Parole – Inmate Status (ISP-I) population of community corrections residents. An

ISP-I resident is someone who has been released fromaDepartmentofCorrections(DOC)institutionand is either in a community corrections facility or has completed a community corrections program, yethasnotbeenofficiallyreleasedtoparolebythe Parole Board. These individuals are often not paroled due to the severity of their crime rather thantheirrisktoreoffend.Toaddressthisissue,theISP-I Working Group convened and met from April through November 2016, producing three recom-mendations as follows:

• FY17-CC01 called for an update to the statute governing the mission and purpose of Community Corrections, providing legislative guidance for current and future Community Corrections boards, facilities and programs.

• FY17-CC02 outlined a new community corrections re-entry referral process which repealed the statu-torydefinitionofISP-Iandcreatedanewmethodfor release of inmates from the Department of Corrections to community corrections.

• FY17-CC03 outlined a community re-entry process that; established a process of referrals to commu-nity corrections based on explicit criteria, included adefinitionofsuccessfulcompletionofcommu-nitycorrectionsandexpandedtheuseofDOC’sAchievement Earned Time for inmates in commu-nity corrections programs.

Figure 3.1. Commission, task force and committee organizational chart

Colorado Commission on Criminal and Juvenile Justice


Juvenile Continuity of Care

Task Force

Re-EntryTask Force

Legislative Committee

CommunityCorrectionsTask Force

Data SharingTask Force

Mental Health / Jails

Task Force


7

Both the Community Corrections Task Force and the Commission approved all three proposals, however, only one of the recommendations was sponsored as a bill (Recommendation FY17-CC01 which became House Bill 17-1147). Details of all three recom-mendations can be found in Section 4. With the completion and approval of these recommendations the Community Corrections Task Force concluded its work in December 2016.

Data Sharing Task Force

The Data Sharing Task Force was seated in April 2015, chaired by Commissioner Jeanne Smith. The Task Force consisted of six Commission members and one non-Commissioner who was a member of the defense bar. The role of the Task Force was to review data sharing protocols and processes to improveoffendermanagementandservices,andto make recommendations to the Commission. Earlyon,theTaskForceidentifiedthevalueofcreatingacross-agency,web-based,offenderdataportal that would allow authorized users to view integrated criminal justice-related information from multiple sources. To this end, a recommendation was presented to and passed by the Commission to supportastate-ledefforttocreateastrategicplan-ning committee composed of municipal, county, and state representatives with expertise in data systems, governance structures, privacy laws, and relatedissues,andthatitbesupportedbysufficientresources to develop a cross-agency data collection and information sharing system.

In Fiscal Year 2017 the Task Force held four meet-ings to build on the recommendation created in 2016. While the Task Force made positive strides inthisendeavoritalsofacedsignificanthurdles.The focus of the Task Force work was to determine the feasibility of creating a protocol for sharing municipal court data; however it proved to be more complicated than expected to persuade municipal courtofficialstoparticipateinastate-wideeffort.It was also recognized that local jurisdictions were abletomakemoresignificantstridesinthisareaofwork. Given the ongoing hurdles faced by the Task

Force at the state level, it was determined that the Commission would be better served by tracking the effortsofotherentitiesworkingtoimprovedatasharing. With that in mind, Commissioners agreed during the February 2017 retreat that the Task Force had completed its assigned mission and should conclude its work.

Juvenile Continuity of Care Task Force

The Juvenile Continuity of Care Task Force, chaired by Commissioner Robert Werthwein, was seated in June 2016 and charged with improving the case management process for juveniles known as “crossover youth” who are involved in multiple systems (probation, child welfare, Division of Youth Corrections). In Fiscal Year 2017, the Task Force identifiedareasofworkanddefinedthefocusofthetaskforcetobe“theeffectiveuseofinformation,resources and approaches amongst several agen-cies in order to better achieve desired outcome for dual status youth”.

Throughout the course of the year, the Task Force received educational presentations and began to definetheframeworkandtheessentialelementsof an ideal crossover youth model. Two Working Groups were created to explore issues around a youth’s point of entry into the system along with issues pertaining to assessment, case management and available services.

The Working Groups presented three recommenda-tions to the Task Force as follows:

• FY17-JCC01 called for the development of a plan to formally recognize and address the needs of crossover youth, and to require each local Juvenile Services Planning Committee to devise a cross-overplanfortheidentificationandnotificationofcases involving crossover youth.

• FY17-JCC02 authorized the use of existing mari-juana tax revenue (distributed to Senate Bill 1991-94 entities) to allow the funds to be used to support the development and implementation of local crossover youth plans and services.

8


• FY17-JCC03 encouraged the Colorado Department of Human Services’ Division of Child Welfare to promulgate rules that provide guidance on permanency planning to county departments of social/human services under Social Service Rules Volume 7.

The Juvenile Continuity of Care Task Force approved all three recommendations during Fiscal Year 2017; however, the Commission did not approve the three proposals until July 2017 (which falls outside the time period of this report). Therefore, details of all three recommendations will be provided in the Commission’s 2018 report. At the writing of this report, it is anticipated that FY18-JCC01 and FY18-JCC02, which are legislative recommendations, will be carried as bill(s) during the 2018 legisla-tive session. Additionally, with the completion and approval of these recommendations, the Juvenile Continuity of Care Task Force concluded its work in the summer of 2017.

Mental Health/Point of Contact through Jail Release Task Force

ThisTaskForce,alsoknownastheMentalHealth/Jails Task Force, was seated in June 2016 with the charge of exploring ways to divert individuals with mental and behavioral health problems away from the criminal justice system, while recognizing that some individuals with acute mental and/or behav-ioral health problems will need to be incarcerated andsoeffectiveresponseoptionsshouldbeavail-able. Commission member and Boulder County SheriffJoePelleistheChairoftheTaskForce.

During the course of Fiscal Year 2017, the Task Force focuseditseffortsonidentifyingopportunitiestorefer individuals to services early in the (pre-jail and jail) process in order to help avoid criminal justice processing. As part of this work the Task Force studied issues around initial point of contact, decisionmaking,andidentificationofappropriateresponsestoavarietyofdifferentsituations.Thiswork resulted in four recommendations that were presented to the Commission as follows:

• FY17–MH01 recommended strengthening and enhancing existing crisis services and providing resources to expand the system to ensure an appropriate health care response to behavioral health crises across Colorado.

• FY17–MH02 called for changes to the emergency mental health commitment statute removing jails and correctional facilities as a placement option forindividualsonanM1(emergencymentalhealth) hold and allowing intervening profes-sionals to transport individuals to an outpatient facility for evaluation for treatment.

• FY17–MH03calledfortheinclusionofMentalHealth First Aid® Curriculum in Colorado Peace OfficerStandardsandTraining(POST)in-servicetraining.

• FY17–MH04 endorsedtheinclusionofMentalHealth First Aid® Curriculum in Colorado Peace OfficerStandardsandTraining(POST)BasicAcademy.

The Commission approved all four recommenda-tions in January 2017. The proposals also garnered support from other stakeholder groups working on complementaryeffortsincludingColorado’sMentalHealth Hold Task Force and the Equitas Foundation. RecommendationsFY17-MH01andFY17-MH02became Senate Bill 17-207, which passed the legislature and was signed into law by Governor Hickenlooper. Details of all four recommendations can be found in Section 4.

The second area of work for the Task Force is exploring opportunities to divert from jail indi-viduals with mental health needs who have law enforcement contact. The Task Force hopes to have a second set of recommendations on this topic prepared for the Commission by spring 2018.


The Pretrial Release Task Force was seated by the Commission in June 2017 and charged with addressing the following topics: Compliance


9

variation from jurisdiction to jurisdiction under the current pretrial statute; barriers to implementation of the current statute including cost, resources, and cost of pretrial supervision; communication issues between pre-trial services, courts, defense attorneys and prosecutors; training and general awareness of risk assessment tools including a review of the Colorado Pretrial Assessment Tool (CPAT); and an environmental scan of pretrial use in Colorado and around the country.

The Task Force is chaired by Commission Chair Stan Hilkey and at the end of Fiscal Year 2017 the Task Force was in the process of creating a strategic plan toaddressthetargetedtopicareas.Outcomesofthisactivity will be reported in the 2018 annual report.

Re-entry Task Force

The Re-entry Task Force, chaired by Commission Chair Stan Hilkey, was established in April 2015 with an original goal of addressing the following: technical violations and conditions of supervision, collateral consequences of a conviction, and the study of issues pertaining to access of medical and mental healthcareforoffenders.DuringFiscalYear2017,the Task Force concentrated its work in the areas of housing and collateral consequences of conviction, eventually producing seven recommendations for presentation to the Commission, as follows:

• FY17–RE01 updates the orders of collateral relief in statute to: allow eligible individuals to request an order of collateral relief after the time of sentencing; eliminate duplicative statutory language regarding orders of collateral relief; and create an order of collateral relief in the Children’s Code.

• FY17–RE02 calls for the prevention of adverse private employment actions on the basis of non-conviction, sealed, and expunged records.

• FY17–RE03 recommends revising statutory guid-ance on state licensure and employment through a variety of avenues including preventing consid-eration of arrests that did not result in a conviction

and preventing consideration of convictions that have been pardoned, sealed, or expunged, in state licensure and employment decisions.

• FY17–RE04 encourages the promotion of housing opportunities for people with non-conviction, sealed, and expunged records.

• FY17–RE05 provides statutory guidance on public housing decisions.

• FY17–RE06 limits the distribution of records concerning arrests that did not result in charges beingfiled,preservingthepresumptionofinnocence.

• FY17–RE07 recommends continuing or expanding financialsupportofColorado’sadultpretrialdiver-sion programs.

The Commission approved three of these recom-mendations (FY17 – RE01, RE02 and RE03) during the timeframe for this report in June, 2017. The Commission approved three more of these recom-mendations (FY17 – RE04, RE05 and RE07) in August, 2017 (outside the timeframe for this report). At the writing of this report it is anticipated that all six recommendations will be carried as bills during the Fiscal Year 2018 legislative session. Details of the three recommendations approved during Fiscal Year 2017 can be found in Section 4 of this report and details of the remaining recommendations (approved in Fiscal Year 2018) will be outlined in the Fiscal Year 2018 report. Additionally, even though Commissioners did not approve recommendation FY17–RE06, they did request that the Collateral Consequences Working Group of the Re-entry Task Forcepursueeffortstorevisittherecommendationand return to the Commission with a revised recom-mendation. With a majority of the Re-entry Task Force recommendations approved the Re-entry Task Force concluded its work in summer 2017.

10


Educational presentationsThe monthly Commission meetings provide a platform for ongoing education and informa-tion sharing regarding local and national criminal justice issues and trends. During Fiscal Year 2017, experts were requested to present on seven issues discussed below.

Housing issues for justice involved individuals

During the September 2016 Commission meeting, representativesfromthefieldofhousingaddressedCommissioners. Presenters were Annie Bacci from the Corporation for Supportive Housing, and Kristin Toombs and Susan Niner of the Division of HousingintheDepartmentofLocalAffairs(DOLA).The presentations included a broad national over-view of housing challenges for justice involved individuals, followed by a look at state and local issues. Additionally during that meeting, there was an update on housing initiatives underway at the Department of Corrections and an explanation of the housing work taking place in the Re-entry Task Force.

ThepresentationbyMs.BaccifocusedonSupportive Housing for justice-involved populations. She explained that Supportive Housing combines affordablehousingwithneededservices,inthehopes of helping individuals who face complex challenges to live with stability, autonomy and dignity.Oneoftheemergingbestpracticesforjustice-involved individuals regarding housing is the Frequent Users Systems Engagement model or FUSE. FUSE targets the frequent users of the jail system, the homeless system and the behavioral health system. The FUSE model has been shown to increase cost savings for communities and increase system collaboration while promoting quality of lifeandself-sufficiencyamongthosewithhousingchallenges. The program is operating in several cities and counties across the country including locally with Denver’s Pay for Success (PFS) project, commonly referred to as a Social Impact Bond. PFS is based on a performance-based loan from private investors intended to provide up-front capital for

service interventions targeted to the re-entry popu-lation, with the goal of achieving certain outcomes. Onceoutcomesareachievedinacommunity(inthiscase the City and County of Denver), private inves-tors are reimbursed.

Kristin Toombs and Susan Niner outlined the roleoftheColoradoDivisionofHousing(DOH)inaddressinghousingissuesspecifically.Ms.Toombsbegan by explaining that much of the work of DOLAoverlapswiththeworkoftheCorporationforSupportiveHousing.DOHwasoriginallycreatedasawaytoincreaseaffordablehousingthroughoutColorado and the Division helps communities createaffordablehousingprojectsthatalsoincludesupportive services such as rental assistance vouchersandothergapfinancing.

DOHisthelargesthousingauthorityinthestateof Colorado and distributes approximately 6,000 vouchersstatewideeveryyear.Oneofthemainbarriers with many voucher programs is that there simply are not enough vouchers to meet the need, and often people who are justice-involved have significantchallengessecuringhousingbecauseoftheircriminalhistory.Asaresult,DOHisworkingwithhousing providers and landlords to encourage them to change their criminal history background check policies. Recently the U.S. Department of Housing and Urban Development and the Department of Justice released a statement informing housing providers that they cannot operate under an umbrella ban of refusing to serve certain populations (for example, people with criminal histories).

MelissaRoberts,theDirectorofAdultParoleattheDepartmentofCorrections(DOC)providedapresentationonDOC’shousinginitiativesandexplained that the Parole Division has been working diligentlywithDOLAandtheGovernor’sOfficeofHomeless Initiatives to develop relationships with landlords to address housing issues as they relate to individualswithcriminalrecords.TheDOC’sDivisionof Adult Parole wants to better leverage supportive housing vouchers for justice involved individuals, along with developing partnerships with developers.


11

TheDOCisalsoworkingtodeterminethemostappropriate housing model for parolees re-entering the community and is determining how best to leverage funding for more stable housing and successful outcomes. The Department is also updating its case management practices to focus specificallyontrackingwhattype of housing offendersareparticipatingin,alongwithtrackingthefundingsourceforthathousing.DOCalsocreated a Housing and Stabilization Unit which consistsofateamofnineofficers,ateamleaderandasupervisor.Parolealsomovedafieldopera-tionteamofofficersintotheRe-entryCenterattheDenveroffice,resultinginofficersfromtheStabilization Unit working side-by-side with the re-entrystafftobetteraddresstheissuesofhousingingeneral,withaspecificfocusonhighrisk/highneed individuals.

Marijuana legalization in Colorado

In November 2016, Commissioners heard a presen-tationontheearlyfindingsfromananalysisofmarijuana legalization in Colorado. Jack Reed from theOfficeofResearchandStatisticsintheDivisionofCriminalJusticepresentedfindingsfromhisanal-ysis of the impacts of Amendment 64, which allowed for the retail sale and possession of marijuana. Colorado passed medical marijuana legalization in 2000, which was implemented and commercialized in 2009. Recreational marijuana was passed in 2012 and was commercialized in 2014.

Mr.Reedexplainedtheimpactsofmarijuanalegal-ization on three areas: public safety, public health and youth access. Concerning public safety, presen-tation highlights included the following information:

• Legalization has resulted in a 58% reduction in arrests for possession from nearly 13,000 in 2012 to approximately 5,400 in 2015.

• There are geographic variations throughout the state regarding arrest rates but arrests are gener-ally higher in the Denver metro area.

• There has been a decrease in arrests across all races;howeverthedecreasesweresignificantlygreater for Whites than Hispanics or African Americans. Geographically, the disproportionality is occurring across the state.

• The illegal activity that is still occurring in Colorado isnotinsignificantandlargeillegalgrowopera-tions have resulted in the seizure of thousands of pounds of illegal plants.

• In general, the people who are growing large amounts of illegal marijuana in Colorado are not growing it to sell in Colorado. “Colorado mari-juana” carries a certain amount of clout and is highly sought-after in other states where mari-juana is still illegal.

• Fatalities on Colorado roadways involving both cannabinoid positive drivers and fatalities with cannabinoid positive drivers increased by 80% from 2013 to 2015 (note that drivers positive for cannabinoid may also be positive for another drug as this occurs 57% of the time); 20% of fatalities on Colorado roadways in 2015 had some nexus to a driver with cannabis in their system. As a comparison, approximately 25% of fatalities in the same year tested positive for alcohol only.

Concerning public health, presentation highlights included the following information:

• The National Survey on Drug Use and Health shows that in 2014, approximately 31% of young adults (18-25) in Colorado had used marijuana; nationally 19% of young adults had used mari-juana during that same year.

• The biggest jump in usage is among adults 26 and over. In Colorado, in 2014, adult usage was double that of the national average with 12% of adults in Colorado using marijuana versus 6% nationally.

12


• Hospitalization rates involving marijuana as oneofthefirstthreedrugsmentionedatintakeincreased from 2742 in 2000 (prior to legal medical marijuana) to 547 in 2015 (after retail marijuana commercialization).

• From2000to2015therehasalsobeenasignifi-cant increase in marijuana exposure calls to poison control centers across every age group except for 18-24 year olds, with the biggest increase in those 25 years and older.

Concerning youth access to marijuana, presentation highlights included the following information:

• The Healthy Kids Colorado Survey shows that in 2015, 21.2% of high school students reported using marijuana “in the past 30 days.” That rate has remained fairly steady over the past ten years with 22.7% of high school students reporting usage in 2005, and only minor variations between 2005 and 2015.

• However, the same survey shows that usage trendsforalcoholandcigaretteshavebothsignifi-cantly decreased from 2005 to 2015. Alcohol usage decreased from 47% to 30% while cigarette usage decreased 19% to 9%.

• The much smaller National Survey on Drug Use and Health asked youth 12 to 17 years old in Colorado about their marijuana usage “in the past month.” Usage rose from 7.6% in 2006 to 12.6% in 2014. For youth nationwide, usage increased from 6.7% in 2006 to 7.2% during the same year.

• Marijuanaoffensesinschoolsincreasedfrom2012 to 2015. Elementary and secondary schools reportedanincreaseinoffensesfrom1,766in2012to1,809in2015.Offensesatcollegesanduniversities increased from 887 to 1,087 during the same time period.

Mr.ReedconcludedhispresentationbyremindingCommissioners that the full report is available on the Division of Criminal Justice website, http://cdpsdocs.state.co.us/ors/docs/reports/2016-SB13-283-Rpt.pdf

Colorado Crisis Response System

AspartofanongoingefforttoeducateCommissioners on the work of the individual task forces, the December 2016 Commission meeting featured a presentation on Colorado’s Crisis ResponseSystem,whichinfluencedtheworkoftheMentalHealth/PointofContactThroughJailRelease Task Force and the Task Force’s subsequent recommendations. Frank Cornelia from the Colorado BehavioralHealthcareCouncilofferedabriefpresen-tation on Colorado’s Crisis Response System.

Mr.Corneliahighlightedtheservicesandresourcesavailable through the Crisis Response System including the following: crisis walk-in centers and crisis stabilization units, mobile response units and support hotlines. He also outlined the reach and availability of crisis service providers across the state. The presentation concluded with a descrip-tion of what is working well in Colorado, including strengthenedrelationshipswithfirstrespondersand with referral agencies, the increased provision of peer services and reported satisfaction by those peoplereceivingservices.Mr.Corneliaalsooutlinedfuture opportunity areas such as the need for more early diversion opportunities, more co-responder models and increased community-based alterna-tives to jails. The presentation served as a platform and introduction to four recommendations that weresubsequentlypreparedbytheMentalHealth/Jails Task Force that addressed issues of how to strengthen the current system to provide viable solutionsinanumberofdifferentareas.

2 Rateper100,000hospitalizationswithpossiblemarijuanaexposures,diagnoses,orbillingcodesinfirstthreecodes.

http://cdpsdocs.state.co.us/ors/docs/reports/2016-SB13-283-Rpt.pdf




13

Disproportionate Minority Contact (DMC)

During Fiscal Year 2017, Commissioners received a presentation that summarized its work on DMC,includingsevenrecommendations(pleaseseeAppendixA)alongwithfindingsfromtheCommunity Law Enforcement Action Reporting Act, also referred to as the CLEAR Act, the result of Senate Bill 15-185. The CLEAR Act mandates that the Division of Criminal Justice (DCJ) annu-ally analyze and report the distribution of race/ethnicity and gender at multiple decision points in thejusticesystemprocess(arrest,filing,disposi-tion,sentencingandrevocation).InMarch2017,Kim English, Research Director for the Division of Criminal Justice, lead the conversation around both theCommissions’MOR/DMCworkandtheCLEARActfindings.Sheexplainedthat,apartfromtheoriginal seven recommendations, data analyses undertakenbyresearchstafffortheCommission’stask forces include information on race/ethnicity when the data are available. Further, conversations aboutDMC/MORarehadbythefullCommissionand not delegated to a task force or committee. Withthatinmind,Ms.EnglishandSeniorAnalystPegFlickpresentedfindingsfromtheCLEARActreporttoCommissioners.Overall,thestatewideanalysis revealed the following:

• Blacks were more likely than Whites and Hispanics to be arrested,

• Blacks and Hispanics, both juveniles and adults, were less likely than Whites to receive a deferred judgment, and

• Blacks and Hispanics were more likely compared to Whites to receive a prison sentence.

At the conclusion of this presentation, Commissioners requested that the next CLEAR Act analysis be disaggregated by judicial district so that the information could be discussed by local criminal justice practitioners. Please see Appendix B for the CLEAR Act presentation.

Impact of Senate Bill 13-250

In 2013 the Colorado General Assembly passed Senate Bill 13-250 (concerning changes to sentencing of persons convicted of drug crimes) which created anewdrugsentencinggridthatreflectedyearsofCommission work. During the June, 2017 meeting KimEnglishandPegFlickoftheOfficeofResearchand Statistics in the Division of Criminal Justice offeredapresentationtoCommissionersdetailingthe impact of Senate Bill 13-250.

Ms.EnglishexplainedthatSB13-250wastheresultof work by the Drug Policy Task Force from 2009 through 2013. That work began after the Governor and Attorney General requested in 2009 that the Commission investigate if “there (are) evidence-based data to support changes in the length of sentence for those who use controlled substances, and should there be a focus on substituting treatment for punishment?” The Commission recommenda-tion that resulted in Senate Bill 13-250 was based on strong, well-documented evidence about the value of substance abuse treatment, and the resulting legislation included a new sentencing grid fordrugoffensesandthedevelopmentofanewoptionfordrugoffenderstoavoidafelonyconvic-tion (the “wobbler”). The bill instructed the court to exhaust all remedies before sentencing certain drug offenderstotheDepartmentofCorrections.Theanalysis of the impact of SB13-250 found fewer indi-viduals sentenced to the Department of Corrections, shorter sentences to those who were sent to prison, a decrease in felony drug charges and an increase in misdemeanor drug charges. Details of the analysis andfindingscanbefoundinthepresentationinAppendix C.

National Criminal Justice Reform Project

During Fiscal Year 2017, the Commission collabo-ratedwiththeGovernor’sOfficeinajointventuretopursue an opportunity to participate in the National Criminal Justice Reform Project (NCJRP) hosted by the National Governors Association and the National Criminal Justice Association. The goal of the initiative

14


was to assists states with criminal justice reform and long term strategic planning over several years. During the application process, Colorado was chosen as one of 20 states to participate in a two-day forum during which states were evalu-ated to help identify priorities for reform. While Coloradowasnotoneofthefivestatesselectedforthe actual project, the process of convening relevant stakeholders and learning from other states was a valuable educational opportunity for some of the Commission members.

Of the People Campaign

InJune2017,CommissionerJenBradfordfromMetroState University facilitated a presentation by a small group of university students who developed an anti-hateinitiativecalledtheOfthePeopleCampaign.Ms.Bradfordbecameinvolvedwiththestudentproject through the U.S. Department of Homeland Security which encouraged the development of such a student team. The initiative included partici-pation from student groups around the country and the world, all of which were asked to develop anti-hate campaigns. The students explained that their campaign promotes community driven, proac-tive, positive and inclusive responses to acts of hate via anti-diversity or anti-government groups. Commissioners participated in a robust conversation following the presentation and with their expertise wereabletoofferthestudentssometipsandideasto assist in the development of their program.

Commission retreat and work plan through Fiscal Year 2018In February 2017, the Commission held its annual retreat with the plan of revisiting Commission operational practices, reviewing the Commission’s 2016 goals and status of those goals, and identi-fying Commission goals and desired outcomes for the remainder of 2017 into Fiscal Year 2018. During these discussions Commissioners reviewed their past accomplishment and activities, and brain-stormed future work areas.

At the conclusion of the retreat, Commissioners produced a strategic plan for future work. That strategy included the following work plans for each of the Commission’s task forces and committees:

• Data Sharing Task Force: At the retreat it was determined that the Data Sharing Task Force had accomplished as much as possible in its work to determine the feasibility of creating a statewide data sharing portal for municipal court data. The Commission agreed the work of the Task Force would be suspended to allow a focus on other priorities.

• Re-entry Task Force: The Commission agreed thatthisgroupwouldfinalizeitsworkoncollat-eral consequences and that the Task Force would discontinue its work in the summer of 2017 to also allow for a focus on other Commission priorities.

• Juvenile Continuity of Care Task Force: Commissioners applauded Task Force members for their ongoing work regarding dual-status youth. It was determined that the Task Force wouldfinalizerecommendationsregardingthedevelopment of a model to identify and manage cases involving dual-status youth by the summer of 2017 and complete its work by fall 2017.

• Mental Health/Point of Contact through Jail Release Task Force: Commissioners acknowl-edged the productive and ongoing work by this Task Force in the areas of early diversion, the management of acutely ill inmates in local jails, and the competency system in Colorado. Commissioners encouraged the group to continue its work through Fiscal Year 2018.

During the retreat, one new area of study was iden-tifiedforattentioninthecomingyearasfollows:

• Pretrial Release Task Force: Commissioners called for the development of a task force to study and make recommendations on a variety of pretrial release issues including the following: Compliance with the 2013 bail/bond statute, training and


15

general awareness of risk tools, the validity and review of the Colorado Pretrial Assessment Tool (CPAT), and an environmental scan of pretrial use in Colorado and around the country.

SummaryThis section reviewed the work of the Commission and its task forces, committees and working groups from July 2016 through June 2017. The Commission continued the work of previously established task

forces and committees (Community Corrections, DataSharing,JuvenileContinuityofCare,MentalHealth/Jails and Re-entry) and created one new area of work with the Pretrial Release Task Force. The Commissionbenefittedfromvariousinformationalpresentations, and it approved 10 recommenda-tions in Fiscal Year 2017. Additional information regarding Fiscal Year 2017 recommendations and subsequent 2017 legislation is available in Section 4.

16


Section 4 | Recommendations and Outcomes

17

Recommendations and outcomes

This section presents the ten recommenda-tions approved by the Commission in Fiscal Year 2017, plus one that was approved in June 2016 (FY16–RE01) that did not become legislation until Fiscal Year 2017. Not all of the Commission’s recommendations are legislative in nature, and recommendations that do become bills are not always signed into law. However, the following table presents the bills that began as Commission recom-mendations, passed during the 2017 legislative session and were signed by the Governor.3

Recommendations produced by three task forces are presented in this section in the following order: CommunityCorrections,Re-entryandMentalHealth/Point of Contact through Jail Release. Please note

that one Re-entry Task Force recommendation (FY16-RE01) was originally approved in June 2016 and is documented in the Commission’s Fiscal Year 2016 report. The recommendation is included again in this report because it became a bill and was signed into law during Fiscal Year 2017. In this same vein, three Re-entry recommendations are included here that were approved during Fiscal Year 2017, although they will likely go through the 2018 legislative process.

The recommendations reported below include the original text approved by the Commission. However, in instances where recommendations were drafted into legislation and passed into law, the language may havebeenmodifiedtobetterreflectstatutoryintent.

3 The full text of each bill may be found on the Commission’s website at www.colorado.gov/ccjjdir/L/Legislation.html.

4

http://www.colorado.gov/ccjjdir/L/Legislation.html

18


Please note the following formatting guides:

• Numbering of recommendations in this report is standardized.Thenotationwillincludethefiscalyear of the recommendation (for example, “FY17”), letters indicating the task force from which the recommendation originated (e.g., Community Corrections Task Force by a “CC”, or Re-entry by an “RE”), and a sequence number.

• Some recommendations may appear to have been skipped or missing, but this is not the case. If a recommendation was numbered and presented to the Commission, but not approved, it is not included in this report.

• Recommendations may include additions to existing statutory or rule language as indicated by CAPITAL letters or deletions that are represented as strikethroughs.

Table 4.1. 2017 Legislative Session “Commission Bills”

Bill number Bill title (and originating Commission recommendation)

House Bill 17-1147 Concerningdefiningthepurposesofcommunitycorrectionsprograms.

• FY17-CC01 Codify the mission and purpose of Community Corrections in language similar to that of Parole as enacted by Senate Bill 16-1215.

House Bill 17-1308 Concerning allowing individualized conditions of parole.

• FY16-RE01 Update the statute governing parole conditions, C.R.S. 17-2-201, to give the parole board and community parole officers discretion to select individualized conditions of parole.

Senate Bill 17-207 Concerning strengthening Colorado’s statewide response to behavioral health crises, and, in connection therewith, making an appropriation.

• FY17-MH01 Position the Colorado Crisis Services System as the comprehensive response to behavioral health emergencies in all Colorado communities by making the following reforms: a) Strengthen and enhance existing crisis services and resources; B) Amend C.R.S. 27-60-103 to clarify the intent of the crisis system; c) Undertake conforming regulatory changes to crisis system contracting; and d) Commit resources to incentivize the development and expansion of the crisis services provider network.

• FY17-MH02 Amend Title 27 of Colorado Revised Statutes (C.R.S), section 65-105, to remove jails and correctional facilities as a placement option for individuals on an M1 (emergency mental health) hold. Introduce language that allows intervening professionals to transport individuals to an outpatient facility for immediate evaluation for treatment based on evidence of need.


19

Community corrections recommendations

FY17-CC01 Purpose of community corrections

Codify the mission and purpose of Community Corrections in language similar to that of Parole as enacted by Senate Bill 16-1215.

Discussion This action will provide legislative guidance for current and future Community Corrections boards and facilities/programs.

Proposed statutory language

The purposes of this article with respect to Community Corrections are to:

a. Further all purposes of sentencing and improve public safety by reducing the incidence of future crime through design and implementation of research-based policies, prac-tices, programs and standards;

b. Prepare,select,andassistpeoplewho,afterservingastatutorilydefinedperiodofincarceration, will be transitioned and returned to the community through supported partnerships with local Community Corrections boards;

c. Set individualized conditions of Community Corrections supervision and to provide servicesandsupporttoassistpeopleincommunitycorrectionsinaddressingidentifiedrisks and needs; and

d. Achieve a successful discharge from Community Corrections supervision through reduction of risks and needs and satisfactory compliance with conditions of placement.

20


FY17-CC02 New Community corrections re-entry referral process

Under this recommendation the following processes and procedures will take place:

1. CrimeofViolence(COV)offenderswillbeeligibleforcommunitycorrectionsreentryplacement upon acceptance by both a community corrections board and a community correctionsprogram,andattheirParoleEligibilityDate(PED).EligibilityforNon-COVoffenderswillremainthesameundercurrentstatute.

2. TheDepartmentofCorrections(DOC)shallprovideacommunityreferralpacketwhichshallinclude,butnotbelimitedto:currentvalidatedactuarialoffenderriskandneedinformation, projected release dates, prior supervision outcomes, institutional conduct, programmingcompleted,verifiedre-entryplan,victimstatementifVictimRightsAct(VRA), individualized recommendations concerning the appropriateness of placement in the community, and the Parole Board Action Sheet.

3. Ifaprogram/boardacceptsaCOVoffender,theoffenderwillbeseenbytheParoleBoard.IftheParoleBoardapprovestheoffenderforthePerformance-basedParoleTrack,theBoardwillsetconditions;theoffenderwillthenbetransferredtotheprogram and will be paroled upon successful completion of the program. If the Parole BoarddoesnotapprovetheoffenderforthePerformance-basedParoleTrack,theoffenderwillnotbetransferredtotheprogram.Non-COVoffenderswhoareacceptedto community corrections will be placed without seeing the parole board and upon successful completion of the program will be paroled. The parole board will set condi-tionsforNon-COVoffendersuponsuccessfulcompletionofcommunitycorrections.

4. In addition to professional judgment and actuarial risk assessment tools, community corrections boards and facilities/programs shall, to the extent possible, utilize a struc-tured, research-based decision making process.

5. RepealtheStatutoryDefinitionofIntensiveSupervisionProgram-Inmate:Torepealtheminimum standards and criteria for the operation of Intensive Supervision Programs, specificallyC.R.S.17-27.5-102Subsections2,3,4.

Discussion The new community reentry process:

• Eliminates the Intensive Supervision Parole – Inmate Status (ISP-I) problem by removing the possibility that an inmate could successfully complete a Community Corrections program and then not be paroled.

• Creates a better process to ensure that those being referred to Community Corrections are appropriate for placement.

• Creates additional incentives to successfully complete Community Corrections programs.

• Creates process efficiencies in the Community Corrections referral process.

• Increases transparency of confinement and reentry to the community for victims.

• Increases inmate incentives to complete institutional rehabilitation and treatment programs.

• Furthers the purposes of Parole and Community Corrections.


21

• The purpose of repealing the statutory definition of Intensive Supervision Program-Inmate is to remove from statute the minimum requirements of ISP and instead allow the DOC more discretion to craft evidence-based program requirements commensurate with recommended policy change. This will facilitate the elimination of the ISP-I population.


C.R.S. 17-27.5-102 (2016)

17-27.5-102.Minimumstandardsandcriteriafortheoperationofintensivesupervisionprograms

(1) The department shall have the power to establish and enforce standards and criteria for administration of intensive supervision programs.

(2)Thestandardsandcriteriashallrequirethatoffendersintheprogramreceiveatleasttheminimum services consistent with public safety, including highly restricted activities, weekly face-to-facecontactbetweentheoffenderandtheprogramstaff,dailytelephonecontactbetweentheoffenderandtheprogramstaff,amonitoredcurfewattheoffender’splaceofresidence at least once a month, employment visitation and monitoring at least twice each month, home visitation, drug and alcohol screening, treatment referrals and monitoring, assuring the payment of restitution, and community service in a manner that shall minimize any risk to the public.

(3)Anoffenderasdefinedinsection17-27-102(6)iseligibleforanintensivesupervisionprogramonlyupontherecommendationofthedepartmentifsuchoffenderhasnotmorethanonehundredeightydaysremaininguntilsuchoffender’sparoleeligibilitydateorupona transfer from a community corrections residential program under article 27 of this title if suchoffenderhasnotmorethanonehundredeightydaysremaininguntilsuchoffender’sparoleeligibilitydateandifthelocalcommunitycorrectionsboardfindsthatthecorrectionalneedsofsuchoffenderwillbebetterservedbysuchsupervision.Thelocalcommunitycorrec-tions board has the authority to accept, reject, or reject after acceptance the participation of anyoffenderineachandeveryintensivesupervisionprogramunderthisarticle.Inselectingoffendersfortransfertoanintensivesupervisionprogram,thedepartmentandthelocalcommunity corrections board shall consider, but shall not be limited to, the following factors:(a)Thefrequency,severity,andrecencyofdisciplinaryactionsagainsttheoffender;(b)Theoffender’sescapehistory,ifany;(c)Whethertheoffenderhasfunctionedatahighlevelofresponsibilityinacommunitycorrections program, if applicable;(d)Whethertheoffenderwillhaveadequatemeansofsupportandsuitablehousinginthecommunity; and(e)Thenatureoftheoffenseforwhichtheoffenderhasbeenincarcerated.

(4)Atleasttwoweekspriortoplacementofanonparoledoffenderinanintensivesuper-visionprogram,theexecutivedirectorshallnotifyorcausetobenotifiedtherespectiveprosecutingattorneyandthelawenforcementagencyoftheaffectedunitoflocalgovern-ment;andheshallhavepreviouslynotifiedtheaffectedcorrectionsboard.

22


FY17-CC03 Establish community re-entry process procedures

The timing of the Community Reentry Process will take place as follows:

Referralcriteria:DOCwilldefine“displayedacceptableinstitutionalbehavior”under C.R.S. 18-1.3.301 (2) (b) as the following:

• Theoffenderhasspentasleast6monthscontinuouslyincarcerateduponadmission,regression or revocation

• Theoffenderhasaclassification/institutionalplacementofmediumorlower

• TheoffenderhasnotreceivedaClassICOPDinthelastyear

• TheoffenderhasnotreceivedaClassIICOPDinthelast6months

Definitionofsuccessfulcommunitycorrectionscompletion:TheDivisionofCriminalJusticeOfficeofCommunityCorrectionsdefinessuccessfulcompletionofaCommunityCorrectionsprogramashavingadvancedthroughLevelFourintheProgressionMatrixorhavingadvancedthroughthefinalphase/levelofaprogram.

Achievement earned time: Inmates are eligible for Achievement Earned Time in accordance withC.R.S.17-22.5-405andDOCAR550-12.DOCwillcommunicatetheAchievementEarnedTime eligibility and process to all programs.

Discussion See discussion section in FY17-CC02.


23

Re-entry recommendations

FY16-RE01 Updatethestatutoryconditionsofparoletoreflectcontemporaryandevidencebased common practices

Update the statute governing parole conditions, C.R.S. 17-2-201, to give the parole board andcommunityparoleofficersdiscretiontoselectindividualizedconditionsofparole.

Discussion In November 2015, the Colorado Commission on Criminal and Juvenile Justice adopted FY16-MP01, a recommendation to amend the statute governing the purposes of parole in Colorado, C.R.S. 17-22.5-102.5. If that recommendation becomes law, the purposes of parole will include “reducing the incidence of technical violations [,]” setting “individualized conditions of parole [,]” and addressing parolees’ “identified risks and needs [.]” This recommendation will build upon, and give substance to, FY16-MP #01.

Colorado’s current parole board statute mandates a list of eleven conditions, many of which have multiple sub-conditions that must be imposed on every Colorado parolee. Those conditions include a mandate that every parolee be tested for drugs and alcohol at specified intervals, not associate with other people who have a criminal record, and remain within a narrowly defined geographic area.

The Re-entry Task Force, the Department of Corrections, and the Parole Board all believe that many of the statutorily mandated conditions of parole are not evidence based when applied to all parolees. Conditions such as a substance testing regimen, association restrictions, and strict geographic boundaries, may be appropriate for some or most parolees. They are not, however, appropriate for all parolees. Imposing unnecessary conditions of parole is a burden on the State’s resources, presents enforcement difficulties,4 and can be detrimental to the recidivism prospects of individual parolees.5

This recommendation will not prohibit the Parole Board or community parole officers from placing any condition on any parolee; it will simply eliminate the requirement that some parole conditions must apply to all parolees. It will thus give the Parole Board and parole officers discre-tion to determine which conditions are appropriate for which parolees, in order to better leverage limited resources and address individual offenders’ criminogenic needs. The recommendation is consistent with, and necessary to give effect to, FY16-MP01.


Please see Appendix D for the full recommendation details.

4 It is wholly impractical, for instance, to expect that parolees in community corrections placements will not associate with other people who have criminal records.

5 RKCGroup&RogerPrzybylski,WhatWorks:EffectiveRecidivismReductionandRisk-FocusedPreventionPrograms30,37(Feb.2008)(report prepared for the Colorado Division of Criminal Justice).

24


FY17-RE01 Allow orders of collateral relief after the time of sentencing

Update orders of collateral relief in statute to:

• Allow eligible individuals to request an order of collateral relief after the time of sentencing,

• Eliminate duplicative statutory language regarding orders of collateral relief; and

• Create an order of collateral relief in the Children’s Code.

Encouragethejudiciarytodevelopamechanismthatwillallowtheidentificationofinstances when orders of collateral relief are requested, granted, or denied.

Discussion The impact of a criminal conviction or adjudication can be far greater than the sentence imposed by the judge. Hundreds of federal, state, and local laws impose additional sanctions and disquali-fications affecting employment, housing, public benefits, and other civil rights and privileges.6 These collateral consequences can be detrimental to individuals’ ability to lead a productive crime-free life,7 and can have a negative impact on society as a whole.8

Similar to many other states,9 Colorado allows judges to issue orders of collateral relief. The orders can relieve eligible individuals from most collateral consequences, when doing so will improve the individual’s likelihood of successful reintegration and is in the public’s interest.10 This mechanism should serve as a valuable tool for allowing society to punish and deter crime, while simultaneously allowing its members to remain productive citizens.11

The current statutory mechanism for orders of collateral relief was enacted in 2013 and has since remained unchanged.12 Although well-intentioned, it has several shortfalls that limit the use and effectiveness of the orders.

First, courts currently can issue orders of collateral relief only at the time an individual is sentenced.13 This can facilitate success for people who are required to serve their sentence in

6 SeeMarkEvans,Colo.StatePublicDefender’sOffice,The Consequences of Conviction: Sanctions Beyond the Sentence Under Colorado Law (2014 ed.), available at http://www.coloradodefenders.us/consequences-of-conviction-2/consequences-of-conviction-2/.

7 Letter from United States Attorney General Eric Holder, Jr., to Colorado Attorney General John Suthers (April 18, 2011); see also John H. Laub&RobertJ.Sampson,Understanding Desistence From Crime,28Crime&Just.1(2001);NationalResearchCouncil,CommitteeonCommunity Supervision and Desistence from Crime, Parole, Desistence from Crime, and Community Integration 23-24 (2008), available at https://cdpsdocs.state.co.us/ccjj/Resources/Ref/NCR2007.pdf; Joy Radice, Administering Justice: Removing Statutory Barriers to Reentry, 83 U. Colo. L. Rev. 715, 719 (2012).

8 The National Employment Law Project, Fact Sheet: Research Supports Fair-Chance Policies (Aug. 2016); Jenny Roberts, Why Misdemeanors Matter: Defining Effective Advocacy in the Lower Criminal Courts,45U.C.DavisL.Rev.277,300-01(2011);JohnSchmitt&KrisWarner,CenterforEcon.&PolicyResearch,Ex-Offenders and the Labor Market (Nov. 2010), available at http://cepr.net/documents/publications/ex-offenders-2010-11.pdf.

9 Conn.Gen.Stat.§54-130e(b);730Ill.Comp.Stat.Ann.5/5-5.5-15;N.Y.Correct.Law§§700to706;N.C.Gen.Stat.§15A-173.2;Ohio.Rev.Code Ann. § 2953.25.

10 §§ 18-1.3-107, 18-1.3-213, 18-1.3-303, C.R.S. 2016.11 MargaretColgateLove,Paying Their Debt to Society: Forgiveness, Redemption, and the Uniform Collateral Consequences of Conviction Act, 54

How. L. J. 753, 760-64 (Spring 2011); Radice, supra note 2, at 727-32. 12 Ch. 289, sec. 11, § 18-1.3-107, 2013 Colo. Sess. Laws 1548; Ch. 289, sec. 12, § 18-1.3-213, 2013 Colo. Sess. Laws 1550; Ch. 289, sec. 13, §

18-1.3-303, 2013 Colo. Sess. Laws 1553.13 §§ 18-1.3-107(1), 18-1.3-213(1), 18-1.3-303(1), C.R.S. 2016.

http://www.coloradodefenders.us/consequences-of-conviction-2/consequences-of-conviction-2/

https://cdpsdocs.state.co.us/ccjj/Resources/Ref/NCR2007.pdf

http://cepr.net/documents/publications/ex-offenders-2010-11.pdf



25

the community. The orders can provide no assistance, however, for people who are attempting to better their lives and move beyond the collateral consequences of a conviction after their sentence has been completed.

Second, the current statutory scheme excludes a successfully completed deferred judgment and sentence (DJS) from the definition of “conviction.”14 Hence, an individual who has successfully completed a DJS is ineligible for an order of collateral relief. A successfully completed DJS can, however, have long lasting collateral consequences in licensure, employment, and other areas.15

Third, orders of collateral relief are currently unavailable for juvenile adjudications. Adjudications can, however, still result in the imposition of collateral consequences.16

Finally, the judiciary does not consistently track when orders of collateral relief are requested or granted.17 This lack of data renders it virtually impossible to determine whether the orders are serving their intended purpose.

Proposed non-statutory and statutory language

See Appendix E for the full recommendation details.

14 §§ 18-1.3-107(8)(c), 18-1.3-213(8)(c), 18-1.3-303(8)(c), C.R.S. 2016.15 See, e.g., § 24-5-101(3)(d), C.R.S. 2016.16 SeeMarkEvans,Colo.StatePublicDefender’sOffice,The Consequences of Adjudication: Sanctions Beyond the Sentence for Juveniles Under

Colorado Law (2014), available at http://www.coloradodefenders.us/consequences-of-conviction-2/consequences-of-juvenile-adjudication/. 17 SherriHufford,ColoradoDivisionofProbationServices,presentationtotheCCJJCollateralConsequencesWorkingGroup(Aug.10,2016).

http://www.coloradodefenders.us/consequences-of-conviction-2/consequences-of-juvenile-adjudication/

26


FY17-RE02 Prevent adverse private employment actions on the basis of non-conviction, sealed, and expunged records

Promote community safety and economic growth by preventing adverse employment action on the basis of arrests that did not result in a conviction, or criminal justice records that have been sealed or expunged.

Discussion Obtaining employment is a lifelong challenge for those with a criminal record,18 and the single biggest hurdle facing individuals returning from incarceration.19 This is of widespread concern, as nearly one in three Americans of working age have some form of criminal record.20 In Colorado alone, over 190,000 people were arrested in 2015.21

The inability of large numbers of people to obtain employment adversely affects the public’s safety and welfare. On an individual level, gainful employment is a key factor that enables people to avoid future arrests and incarceration.22 More broadly, the economy as a whole is negatively impacted by the reduction of employment rates for people with a criminal record.23 Numerous studies have shown that the employment related consequences of a criminal record disparately impact individuals and communities of color.24 It is thus necessary to ensure that Colorado’s record-based restrictions on employment are both fair to individuals and productive to the safety and welfare of society.

Because criminal record exclusions have a disparate impact based on race and national origin, they are regulated under Title VII of the Civil Rights Act of 1964.25 Employers face Title VII liability when their criminal record screening policy or practice disproportionately screens out members

18 The National Employment Law Project, Fact Sheet: Research Supports Fair-Chance Policies (Aug.2016);MaureenCain,PolicyDirector,Colorado Criminal Defense Institute, presentation to the CCJJ Collateral Consequences Working Group (Aug. 24, 2016).

19 The Piton Perspective, Study Portrays Struggles People Face After Prison (Spring 2007); Hassan Latif, Executive Director, Second Chance Center,presentationtotheCCJJCollateralConsequencesWorkingGroup(Aug.10,2016);RichardMorales,DeputyExecutiveDirector,Latino Coalition for Community Leadership, presentation to the CCJJ Collateral Consequences Working Group (Aug. 10, 2016).

20 Bureau of Justice Statistics, U.S. Dep’t of Justice, Survey of State Criminal History Information Systems, 2012 14 table 1 (Jan. 2014), available at https://www.ncjrs.gov/pdffiles1/bjs/grants/244563.pdf;JoCravenMcGinty,How Many Americans Have a Police Record?, The Wall Street Journal, Aug. 7, 2015, https://www.wsj.com/articles/how-many-americans-have-a-police-record-probably-more-than-you-think-1438939802.

21 Colo. Bureau of Investigation, Crime in Colorado 2015, http://crimeinco.cbi.state.co.us/cic2k15/state_totals/statewide_adult_arrests.php (last visited Feb. 1, 2017).

22 Letter from United States Attorney General Eric Holder, Jr., to Colorado Attorney General John Suthers (April 18, 2011); see also John H. Laub&RobertJ.Sampson,Understanding Desistence From Crime,28Crime&Just.1(2001);NationalResearchCouncil,CommitteeonCommunity Supervision and Desistence from Crime, Parole, Desistence from Crime, and Community Integration 23-24 (2008), available at https://cdpsdocs.state.co.us/ccjj/Resources/Ref/NCR2007.pdf; Joy Radice, Administering Justice: Removing Statutory Barriers to Reentry, 83 U. Colo. L. Rev. 715, 719 (2012).

23 Fact Sheet, supra note 1; Jenny Roberts, Why Misdemeanors Matter: Defining Effective Advocacy in the Lower Criminal Courts, 45 U.C. Davis L. Rev.277,300-01(2011);JohnSchmitt&KrisWarner,CenterforEcon.&PolicyResearch,Ex-Offenders and the Labor Market (Nov. 2010), available at http://cepr.net/documents/publications/ex-offenders-2010-11.pdf.

24 E. Ann Carson, Bureau of Justice Statistics, U.S. Dep’t of Justice, Prisoners in 2014 15 (Sept. 2015) (reporting that as of December 31, 2014, black men are imprisoned in state and federal facilities at a rate of 2,724 per 100,000, Hispanic men are imprisoned at a rate of 1,091 per 100,000, and white men are imprisoned at a rate of 465 per 100,000; similar disparities exist for women), available at http://www.bjs.gov/content/pub/pdf/p14.pdf;U.S.EqualOpportunityCommission,Enforcement Guidance on the Consideration of Arrest and Conviction Records in Employment Decisions Under Title VII of the Civil Rights Act of 1964 1 (April 25, 2012), available at https://www.eeoc.gov/laws/guidance/arrest_conviction.cfm.

25 Enforcement Guidance, supra note 7, at 1.

https://www.ncjrs.gov/pdffiles1/bjs/grants/244563.pdf

https://www.wsj.com/articles/how-many-americans-have-a-police-record-probably-more-than-you-think-1438939802


http://crimeinco.cbi.state.co.us/cic2k15/state_totals/statewide_adult_arrests.php



http://www.bjs.gov/content/pub/pdf/p14.pdf


https://www.eeoc.gov/laws/guidance/arrest_conviction.cfm



27

of a protected group, and the employer cannot demonstrate that it is job related for the positions in question and consistent with business necessity.26

Arrests alone are not proof of criminal activity.27 Employment exclusions based solely on an arrest are therefore generally not job related and consistent with business necessity, and can give rise to Title VII liability.28 Policies and practices that impose exclusions based on conviction records must link the specific criminal conduct with the risks inherent in the duties of a particular position.29

Unlike several other states,30 Colorado currently places no restrictions on private employers’ ability to withhold or terminate employment based on an individual’s criminal record. Employers are prohibited from asking individuals to disclose criminal records that have been sealed.31 The law currently has no mechanism, however, for enforcing that prohibition.32


See Appendix F for the full recommendation details.

26 Id. at 9.27 Id. at 12. 28 Id. 29 Id. at 14-16. 30 In Hawaii it is “unlawful discriminatory practice” for an employer to discriminate on the basis of an individual’s “arrest and court record.”

Haw. Rev. Stat. § 378-2(a)(1). Employers may inquire about conviction records, but are generally only permitted to consider convictions withinthelasttenyearsexcludingperiodsofincarceration.Haw.Rev.Stat.§378-2.5(a),-2.5(c).TheStateofMassachusettsprohibitsprivateemployersfrominquiringaboutorbasingemploymentdecisionson:(1)arreststhatdidnotresultinconviction,(2)firstconvictionsforcertainmisdemeanors,and(3)misdemeanorsforwhichtheassociatedperiodofincarcerationendedmorethanfiveyearspriorunlesstheindividualhasbeenconvictedofanotheroffense.Mass.Gen.Lawsch.151B,§4(9).TheStateofNewYorkprohibitsprivate employers from inquiring about, or acting adversely on the basis of: (1) any arrest not then pending where the criminal action wasterminatedinfavoroftheindividual,(2)youthfuloffenderadjudications,and(3)certainsealedrecords.N.Y.Exec.Law§296(16).Itis unfair discrimination to deny or act adversely on employment based on a conviction unless there is a direct relationship between the conviction and the employment. N.Y. Correct. Law § 752. The State of Pennsylvania allows private employers to consider only convictions for felonies and misdemeanors, and requires that the convictions “relate to the applicant’s suitability for employment in the position for which he has applied.” 18 Pa. Cons. Stat. § 9125. The State of Wisconsin generally prohibits private employers from requesting information from applicants about arrest records except as to pending charges. Wis. Stat. § 111.335(1)(a). It also restricts employers’ use of conviction records. Wis. Stat. §§ 111.321, 111.335(1)(c).

31 §§ 24-72-702(1)(f), 24-72-703(4)(d)(I), C.R.S. 2016. 32 Cf. § 24-72-309, C.R.S. 2016 (before Colorado’s record sealing statutes were moved to part 7 of chapter 72 of title 24, it was a

misdemeanor to violate their provisions).

28


FY17-RE03 Revise statutory guidance on state licensure and employment

Promote community safety and economic growth by:

• Preventing consideration of arrests that did not result in a conviction, and convictions that have been pardoned, sealed, or expunged, in state licensure and employment decisions;

• Empowering the Department of Regulatory Agencies to delist certain conditional licenses;

• Collecting data;

• Encouraging the elimination of mandatory collateral consequences;

• Incentivizing opportunity expansion by state contractors; and

• Increasing transparency of agency policies.

Discussion Colorado government regulates the employment of, or directly employs, a substantial portion of the State’s population. The Department of Regulatory Agencies (DORA) alone administers over 50 regulatory programs governing professions, occupations, and businesses comprising over 710,000 individual licensees.33 The state directly employs over 95,000 people,34 and many more are employed by local governments.

A criminal record can adversely impact an individual’s ability to obtain either a license neces-sary to work or direct employment with state or local governments.35 This issue is of widespread concern, as it is estimated that nearly one in three Americans of working age have some form of criminal record.36 In Colorado alone, over 190,000 people were arrested in 201537 and an esti-mated 1.5 million individuals in the U.S. have criminal records.38

The inability of large numbers of people to obtain employment adversely affects the public’s safety and welfare. On an individual level, gainful employment is a key factor that enables people to avoid future arrests and incarceration.39 More broadly, the economy as a whole is negatively impacted by the reduction of employment rates for people with a criminal record.40 Numerous

33 DORA,Department Performance Plan6(Oct.2016),available at https://www.colorado.gov/dora. 34 Colo. Div. of Human Res., FY 2014-15 Workforce Report 3 (2015), available at https://www.colorado.gov/dhr/fy2014-15workforcereport. 35 MarkEvans,Colo.StatePublicDefender’sOffice,The Consequences of Conviction: Sanctions Beyond the Sentence Under Colorado Law 14-15,

51-94 (2014 ed.), available at http://www.coloradodefenders.us/consequences-of-conviction-2/consequences-of-conviction-2/. 36 JoCravenMcGinty,How Many Americans Have a Police Record?, The Wall Street Journal, Aug. 7, 2015, https://www.wsj.com/articles/how-

many-americans-have-a-police-record-probably-more-than-you-think-1438939802. 37 Colo. Bureau of Investigation, Crime in Colorado 2015, http://crimeinco.cbi.state.co.us/cic2k15/state_totals/statewide_adult_arrests.php

(last visited Feb. 2, 2017). 38 Bureau of Justice Statistics, U.S. Department of Justice, Survey of State Criminal History Information Systems, 2012 14 table 1 (Jan. 2014),

available at https://www.ncjrs.gov/pdffiles1/bjs/grants/244563.pdf. 39 Letter from United States Attorney General Eric Holder, Jr., to Colorado Attorney General John Suthers (April 18, 2011); see also John H.

Laub&RobertJ.Sampson,Understanding Desistence From Crime,28Crime&Just.1(2001);NationalResearchCouncil,CommitteeonCommunity Supervision and Desistence from Crime, Parole, Desistence from Crime, and Community Integration 23-24 (2008), available at https://cdpsdocs.state.co.us/ccjj/Resources/Ref/NCR2007.pdf; Joy Radice, Administering Justice: Removing Statutory Barriers to Reentry, 83 U. Colo. L. Rev. 715, 719 (2012).

40 The National Employment Law Project, Fact Sheet: Research Supports Fair-Chance Policies (Aug. 2016); Jenny Roberts, Why Misdemeanors Matter: Defining Effective Advocacy in the Lower Criminal Courts,45U.C.DavisL.Rev.277,300-01(2011);JohnSchmitt&KrisWarner,CenterforEcon.&PolicyResearch,Ex-Offenders and the Labor Market (Nov. 2010), available at http://cepr.net/documents/publications/ex-offenders-2010-11.pdf.

https://www.colorado.gov/dora

https://www.colorado.gov/dhr/fy2014-15workforcereport

http://www.coloradodefenders.us/consequences-of-conviction-2/consequences-of-conviction-2/



http://crimeinco.cbi.state.co.us/cic2k15/state_totals/statewide_adult_arrests.php

https://www.ncjrs.gov/pdffiles1/bjs/grants/244563.pdf





29

studies have shown that the employment related consequences of a criminal record disparately impact communities of color.41 It is thus necessary to ensure that Colorado’s record-based restric-tions on employment and licensing are both fair to individuals and productive to the safety and welfare of society.

When an individual with a criminal record applies for a state job, section 24-5-101, C.R.S. 2016, governs the effect of that record on his or her employment prospects. When an individual with a record applies for a state issued license to engage in most regulated professions, the licensing agency is governed by the same.42

The statute purports to “expand employment opportunities for persons who, notwithstanding that fact of conviction of an offense, have been rehabilitated and are ready to accept the responsibili-ties of a law-abiding and productive member of society.”43 It provides little guidance, however, for the most frequent circumstances in which state agencies must consider a criminal record.

First, the only clear statutory guidance on how a criminal record should be considered does not apply to licensure decisions.44 It applies only to actual employment by the State. The statutory provisions applicable to licensure decisions indicate that a prior conviction should be considered, but do not indicate how.45

Second, the guidance provided for state employment decisions mandates that the same criteria for evaluating convictions which have been pardoned, expunged, or sealed applies to those that have not.46 This defeats the express goal of a pardon,47 and the implicit goals underlying the statu-tory scheme for expunging, sealing, or dismissing conviction records.48 It also makes no mention of orders of collateral relief, which can be issued by courts to relieve eligible individuals of state imposed collateral consequences.49

41 E. Ann Carson, Bureau of Justice Statistics, U.S. Department of Justice, Prisoners in 2014 15 (Sept. 2015) (reporting that as of December 31, 2014, black men are imprisoned in state and federal facilities at a rate of 2,724 per 100,000, Hispanic men are imprisoned at a rate of 1,091 per 100,000, and white men are imprisoned at a rate of 465 per 100,000; similar disparities exist for women), available at http://www.bjs.gov/content/pub/pdf/p14.pdf;U.S.EqualOpportunityCommission,Enforcement Guidance on the Consideration of Arrest and Conviction Records in Employment Decisions Under Title VII of the Civil Rights Act of 1964 1 (April 25, 2012), available at https://www.eeoc.gov/laws/guidance/arrest_conviction.cfm.

42 “[I]f a licensing entity in title 10 or 12, C.R.S., determines that an applicant for licensure has a criminal record, the licensing entity is governed by section 24-5-101 for purposes of granting or denying licensure or placing any conditions on licensure.” § 24-34-102(8.7), C.R.S. 2016.

43 § 24-5-101(2), C.R.S. 2016. 44 § 24-5-101(3), -101(4), C.R.S. 2016.45 § 24-5-101(1), -101(2), C.R.S. 2016.46 § 24-5-101(3)(d), -101(4), C.R.S. 2016.47 “A pardon issued by the governor shall waive all collateral consequences associated with each conviction for which the person received a

pardon unless the pardon limits the scope of the pardon regarding collateral consequences.” § 16-17-103, C.R.S. 2016.48 State and local government agencies are generally forbidden from asking applicants to disclose information in records that were sealed

due to non-prosecution, dismissal, or acquittal. § 24-72-702(1)(a), -702(1)(f), C.R.S. 2016. State and local government agencies are also generally forbidden from asking applicants to disclose information in sealed records relating to certain controlled substance, petty offense,andmunicipaloffenseconvictions.§24-72-703(4)(d)(I),C.R.S.2016.Withtheexceptionofcertaincontrolledsubstanceandhumantraffickingrelatedoffenses,thesealingofarecordreflectsthatajudgehasalreadydeterminedthattheharmtotheindividual’sprivacyoutweighs the public’s interest in the availability of the record. §§ 24-72-702(1)(b)(II)(B), -704(1)(c), -705, -706, -708(3), C.R.S. 2016.

49 See§§18-1.3-107,18-1.3-213,18-1.3-303,C.R.S.2016.TheStateofNewYorkhaslongissuedcertificatessimilartoColorado’sordersofcollateralrelief.There,however,publicagenciesandprivateemployersarerequiredtogiveconsiderationtosuchcertificates.N.Y.Correct.Law§753(2).Otherstateshavesimilarmechanisms.See Conn. Gen. Stat. § 54-130e(b); 730 Ill. Comp. Stat. Ann. 5/5-5.5-15; N.C. Gen.Stat.§15A-173.2;Ohio.Rev.CodeAnn.§2953.25.





30


Third, the scant existing guidance for licensure decisions applies only when a state or local agency is required to make a finding that the applicant “is a person of good moral character as a condition to the issuance thereof …”50 Most of the statutes governing state licensure decisions do not require an evaluation of whether a person is of “good moral character.” They simply allow adverse licensure action to be taken on the basis of a prior offense.

Finally, the guidance for both employment and licensure applies only to discretionary agency decisions. It does not apply if there is a specific statutory prohibition that prevents an individual from obtaining employment or licensure.51

Information obtained from DORA indicates that its various regulatory programs do not have a widespread practice of denying licensure based on a past criminal history. Those programs will, however, regularly issue licenses on a conditional or probationary status based on such a history. This results in a record of the individual’s criminal history being publicly accessible through DORA’s website. DORA does not have the power to ever remove public access to that information.

Proposed non-statutory language

Please see Appendix G for the full recommendation details.

50 § 24-5-101(2), C.R.S. 2016. 51 §§ 24-5-101(3)(a), 24-34-102(8.7), C.R.S. 2016.


31

Mental health/point of contact through jail release recommendations

FY17-MH01 Strengthen a community-based crisis response

Position the Colorado Crisis Services System as the comprehensive response to behav-ioral health emergencies in all Colorado communities by making the following reforms: a) Strengthen and enhance existing crisis services and resources; b) Amend C.R.S. 27-60-103 to clarify the intent of the crisis system; c) Undertake conforming regulatory changes to crisis system contracting; and d) Commit resources to incentivize the development and expansion of the crisis services provider network.

• Strengthen and enhance existing crisis services and provide resources to expand the system to ensure an appropriate health care response to behavioral health crises across Colorado.

• Amend statute (§27-60-103, C.R.S, enacted by SB13-266) to clarify the intent of the crisis system and formally introduce the responsibilities of being the preferred response to behavioral health crises across the state, and for engaging in community partnerships that facilitate such a response.

• Crisis System contracting and regulatory reform should specify the operational compo-nents necessary to achieve these responsibilities. View Appendix A below.

• The general assembly should commit resources to incentivize the development and expansion of an adequate crisis services provider network. View Appendix B below.

Discussion Colorado’s Crisis System was developed to create an appropriate response to behavioral health crises and thereby reduce utilization of the criminal justice system and emergency departments to house or treat individuals with mental illness. To ensure that this system is effective in achieving its intended purpose, resources must be dedicated to cross-system collaboration as well as inde-pendent expansion. By taking steps to strengthen and enhance the Crisis System, Colorado will ensure that peace officers and other first responders are equipped with a variety of options when encountering behavioral health crises in the community. Enhancing this system will ensure that Colorado citizens who experience mental health crises are cared for by healthcare professionals, in turn relieving the criminal justice system.

32


Appendix A

To ensure operational functionality of the crisis system in this proposed role, the following should be pursued in contracting and regulation.

Decriminalization of mental illness in all crisis regions

• Minimumof1.0FTEJusticeLiaison/CommunityCoordinatorpercontractor(4.0FTEtotalinthe state) to oversee the contractors’ engagement initiatives with key community partners, (criminal justice agencies, emergency departments (EDs), hospitals, primary care facilities, etc.)

• Tobefullyeffective,acommunityresourceteamshouldbeconsidered,toincludethe following positions:

» Director/ProgramOversight» Marketing/CommunityRelations» Training Director» Peer Specialist Program Director

• Formalize relationships with all law-enforcement departments in region and continue pursuit of collaborative community programming.

• Abilitytointerveneinbehavioralhealthcrisesinthecommunityassoonastheyareidentifiedto prevent a criminalized experience and/or the potential for a criminalization trajectory.

• Buildcloserelationshipswithfirstresponders/dispatchcenterstofacilitatethis.

ManagementofM1holdsinallColoradocommunities

• SpecifythatallWalk-in-CentersarepreparedtotakeindividualsonM1holdsandare27-65 designated. Formalize partnerships to prioritize caring for high-acuity individuals in the least restrictive environment and without the use of law enforcement.

• Ensure all crisis services facilities, regardless of facility licensure, are able to adequately careforindividualsonanM1hold.Initiativesshouldfocusonappropriatestaffratios,trainingofstaff,andadequatereformtoincreasesecurity.

• Introduce a CSU facility licensure category and standardize expectations/involvement.

• Introduce regulations that formalize the expectation that rural crisis facilities engage with24/7facilitiesintheirregion(includingbutnotlimitedtoruralhospitals,EMS,medical labs, emergency clinics, primary care facilities, etc.) to form facility placement agreements and other local arrangements.

• Regulations must be bi-directional to ensure engagement by both entities who are entering into agreements.

• Create a state-wide 27-65 web-based portal for data submission to support designated facilities by decreasing administrative workload and increasing capacity.

• Seek guidance from the 27-65 Board that allows providers to utilize telehealth for crisis services including emergency assessment and evaluation for treatment.


33

Appendix B

To ensure an adequate crisis response network in all Colorado communities, the following should be prioritized for additional funding.

• Expand existing facilities and operations to reach 24/7 capacity in all counties

• MobileResponseUnits–24/7capacity.» Fiscalsupports&incentives(bothtothecrisiscontractorandcommu-

nity partners) to purchase, install, and use of tele-health for mobile crisis evaluations in partnership settings (e.g. hospitals, health clinics, law enforcement facilities, and other crisis service locations.)

• Walk-in-Centers – 24/7 ability to manage high-acuity encounters.» Fiscalsupports&incentives(bothtothecrisiscontractorandcommunity

partners) to purchase, install, and use of tele-health for walk-in crisis evaluations in partnership settings.

» Expand crisis services network in each crisis region by incentivizing the partnering with or designating of 24/7 and tele-health capable walk-in-centers at existing facilities in rural communities:

• Allow crisis contractors to subcontract with rural providers.» Target areas: Western Slope, NE region, SE region

• Potential subcontracted providers may include:» Existing Crisis Contractor facilities that are not currently

crisisservices(i.e.ATU,outpatientoffices)» OtherCMHCoutpatientfacilities/clinics» SUD treatment facilities » LawenforcementsubstationwithCMHCorcrisisstaff

conducting services via tele-health» Otherprimarycarefacilities

• Incentivize local partnerships between law enforcement, behavioral health, and other firstresponders.

• Fund new and existing joint programs that match community need and density usingtheBureauofJusticeAssistance’sPoliceMentalHealthCoordinationToolkit(https://pmhctoolkit.bja.gov/), state (e.g., EDGE, CRT) and national models.

» Embedcrisisclinicians/consultantsinfirstresponsesystems(lawenforce-ment ride-along, dispatch centers, etc.)

• Provide resources to support crisis contractors’ employee (minimum 1 FTE) community coordinator to facilitate relationship building and program oversight.

• Develop and install additional tele-suites (equipment, training, other supports) to ensure 24/7 crisis tele-assessment capacity in every county. Funding to promote joint-utilization between systems (criminal justice agencies, hospitals, etc.)

• Provide the crisis system with the capacity to install, market, and provide technical assistance for this capacity.

https://pmhctoolkit.bja.gov/

34


• Createastate-levelcoordinatorposition(e.g.,OfficeofIT–State Telehealth Coordinator) to oversee piloting, utilization, and outcomes.

• Support crisis contractors to expand mobile capacity in rural areas as appropriate.

• Allow for crisis clinicians to respond to more incidents independently or jointly withfirstresponders.

• These teams should have a primary role in outreach, dispatch, community-coordi-nation, etc. to match the rural communities’ needs.

• Develop, as needed, data collection and outcome evaluation systems.

• Analysis to focus on clinical outcomes, cross-systemic cost-avoidance, best-prac-tice development, contract compliance, etc.

• Explore development of new crisis facilities and services to ensure adequate capacity in all regions of Colorado.

• Increase ATU, CSU, WIC, respite capacity where need is determined.

• Expand resources for peer services and explore increasing the scope of work for peers.


35

FY17-MH02 Changes to the emergency mental health commitment statute

Amend Title 27 of Colorado Revised Statutes (C.R.S), section 65-105, to remove jails and correctionalfacilitiesasaplacementoptionforindividualsonanM1(emergencymentalhealth) hold. Introduce language that allows intervening professionals to transport indi-viduals to an outpatient facility for immediate evaluation for treatment based on evidence of need.

Discussion Colorado is one of only eight states in the nation that allows for individuals experiencing a mental health crisis to be held in a jail or correctional facility without charges. In order to ensure indi-vidual dignity and quality healthcare are provided, this practice must cease immediately. The evaluation and treatment of individuals experiencing behavioral health crises should be entrusted to healthcare providers and whenever possible individuals experiencing mental health crises should be shepherded into a health care system instead of a criminal justice system.

Therefore, language should be added in C.R.S. 27-65-105 that creates an opportunity for imme-diate evaluation for treatment at an outpatient facility. Allowing providers at outpatient facilities to conduct evaluations (face-to-face or via telehealth) reduces the burden on peace officers to assess for and initiate M-1 holds. By transferring individuals experiencing mental health crises into healthcare systems immediately, Colorado will reduce the burden on criminal justice systems at every intercept.


C.R.S. 27-65-105. Emergency procedure

(1) Emergency procedure may be invoked under either one of the following two conditions:

(a)(I) When any person appears to have a mental illness and, as a result of such mental illness, appears to be an imminent danger to others or to himself or herself or appears to be gravelydisabled,thenapersonspecifiedinsubparagraph(III) of this paragraph (a), each of whom is referred to in this section as the “intervening professional”, upon probable cause and with such assistance as may be required, may take the person into custody, or cause the person to be taken into custody, and placed in a facility designated or approved by the executive director for a seventy-two-hour treatment and evaluation.

(II)WHENANYPERSONAPPEARSTOHAVEAMENTALILLNESSAND,ASARESULTOFSUCHMENTALILLNESSISINNEEDOFIMMEDIATEEVALUATIONFORTREATMENTINORDERTOPREVENTPHYSICALANDPSYCHIATRICHARMTOHIMSELF,HERSELFOROTHERS,THENAPERSONSPECIFIEDINSUBPARAGRAPH(III)OFTHISPARAGRAPH(a),EACHOFWHOMISREFERREDTOINTHISSECTIONASTHE“INTERVENINGPROFESSIONAL”,UPONPROBABLECAUSEANDWITHSUCHASSISTANCEASMAYBEREQUIRED,MAYIMMEDIATELYTRANSPORTSUCHPERSONTOANOUTPATIENTMENTALHEALTHFACILITYDESIGNATEDORAPPROVEDBYTHEEXECUTIVEDIRECTORFORASEVENTY-TWOHOURTREATMENTANDEVALUATION.

36


(III) Thefollowingpersonsmayeffectaseventy-two-hourholdasprovidedinsubparagraph(I) AND (II) of this paragraph (a):

(A)Acertifiedpeaceofficer;

(B) A professional person;

(C)Aregisteredprofessionalnurseasdefinedinsection12-38-103(11),C.R.S.,whobyreasonof postgraduate education and additional nursing preparation has gained knowledge, judg-ment, and skill in psychiatric or mental health nursing;

(D) A licensed marriage and family therapist, licensed professional counselor, or addiction counselor licensed under part 5, 6, or 8 of article 43 of title 12, C.R.S., who by reason of post-graduate education and additional preparation has gained knowledge, judgment, and skill in psychiatric or clinical mental health therapy, forensic psychotherapy, or the evaluation of mental disorders; or

(E) A licensed clinical social worker licensed under the provisions of part 4 of article 43 of title 12, C.R.S.

(b)Uponanaffidavitsworntooraffirmedbeforeajudgethatrelatessufficientfactstoestablish that a person appears to have a mental illness and, as a result of the mental illness, appears to be an imminent danger to others or to himself or herself or appears to begravelydisabled,thecourtmayorderthepersondescribedintheaffidavittobetakeninto custody and placed in a facility designated or approved by the executive director for a seventy-two-hour treatment and evaluation. Whenever in this article a facility is to be designated or approved by the executive director, hospitals, if available, shall be approved or designated in each county before other facilities are approved or designated. Whenever in this article a facility is to be designated or approved by the executive director as a facility for a stated purpose and the facility to be designated or approved is a private facility, the consent of the private facility to the enforcement of standards set by the executive director shall be a prerequisite to the designation or approval.

(c)UPONANAFFIDAVITSWORNTOORAFFIRMEDBEFOREAJUDGETHATRELATESSUFFICIENTFACTSTOESTABLISHTHATAPERSONAPPEARSTOHAVEAMENTALILLNESSAND,ASARESULTOFTHEMENTALILLNESS,ISINNEEDOFIMMEDIATEEVALUATIONFORTREATMENTINORDERTOPREVENTPHYSICALANDPSYCHIATRICHARM,THECOURTMAYORDERTHEPERSONDESCRIBEDINTHEAFFIDAVITTOBETRANSPORTEDTOANOUTPATIENTMENTALHEALTHFACILITYDESIGNATEDORAPPROVEDBYTHEEXECUTIVEDIRECTORFORASEVENTY-TWOHOURTREATMENTANDEVALUATION.

(2) (a) When a person is taken into custody pursuant to subsection (1) of this section, such personshallnotbedetainedinajail,lockup,orotherplaceusedfortheconfinementofpersonschargedwithorconvictedofpenaloffenses.; except that such place may be used ifnoothersuitableplaceofconfinementfortreatmentandevaluationisreadilyavailable.Insuch situation the person shall be detained separately from those persons charged with or convictedofpenaloffensesandshallbeheldforaperiodnottoexceedtwenty-fourhours,excluding Saturdays, Sundays, and holidays, after which time he or she shall be transferred


37

to a facility designated or approved by the executive director for a seventy-two-hour treat-mentandevaluation.Ifthepersonbeingdetainedisajuvenile,asdefinedinsection 19-1-103 (68), C.R.S., the juvenile shall be placed in a setting that is nonsecure and physi-callysegregatedbysightandsoundfromtheadultoffenders.Whenapersonistakenintocustodyandconfinedpursuanttothissubsection(2),suchpersonshallbeexaminedatleasteverytwelvehoursbyacertifiedpeaceofficer,nurse,orphysicianorbyanappropriatestaffprofessional of the nearest designated or approved mental health treatment facility to deter-mine if the person is receiving appropriate care consistent with his or her mental condition.

(b)Asherifforpolicechiefwhoviolatestheprovisionsofparagraph(a)ofthissubsection(2),relatedtodetainingjuvenilesmaybesubjecttoacivilfineofnomorethanonethousanddollars.Thedecisiontofineshallbebasedonpriorviolationsoftheprovisionsofparagraph(a)ofthissubsection(2)bythesherifforpolicechiefandthewillingnessofthesherifforpolicechief to address the violations in order to comply with paragraph (a) of this subsection (2).

(3) Such facility shall require an application in writing, stating the circumstances under which the person’s condition was called to the attention of the intervening professional and furtherstatingsufficientfacts,obtainedfromthepersonalobservationsoftheinterveningprofessional or obtained from others whom he or she reasonably believes to be reliable, to establish that the person has a mental illness and, as a result of the mental illness, is an imminent danger to others or to himself or herself, orisgravelydisabled,ORINNEEDOFIMMEDIATEEVALUATIONFORTREATMENT.Theapplicationshallindicatewhenthepersonwas taken into custody and who brought the person’s condition to the attention of the intervening professional. A copy of the application shall be furnished to the person being evaluated, and the application shall be retained in accordance with the provisions of section 27-65-121(4).

(4) If the seventy-two-hour treatment and evaluation facility admits the person, it may detain him or her for evaluation and treatment for a period not to exceed seventy-two hours, excluding Saturdays, Sundays, and holidays if evaluation and treatment services are not available on those days. For the purposes of this subsection (4), evaluation and treatment services are not deemed to be available merely because a professional person is on call during weekends or holidays. If, in the opinion of the professional person in charge of the evaluation, the person can be properly cared for without being detained, he or she shall be provided services on a voluntary basis.

(5) Each person admitted to a seventy-two-hour treatment and evaluation facility under the provisions of this article shall receive an evaluation as soon as possible after he or she is admitted and shall receive such treatment and care as his or her condition requires for the full period that he or she is held. The person shall be released before seventy-two hours have elapsed if, in the opinion of the professional person in charge of the evaluation, the person no longer requires evaluation or treatment. Persons who have been detained for seventy-two-hour evaluation and treatment shall be released, referred for further care and treatmentonavoluntarybasis,orcertifiedfortreatmentpursuanttosection27-65-107.

38


FY17-MH03 IncludeMentalHealthFirstAid®curriculumforpeaceofficerin-servicetraining through POST

OfficialsfromtheColoradoPeaceOfficerStandardsandTraining(POST)willworkwithstafffromtheColoradoBehavioralHealthcareCouncil(CBHC)toreviewandincludeMentalHealth First Aid®trainingthroughPOSTforthepurposeoftrainingupto200officerspermonth on this topic with training beginning in the spring of 2017.

Discussion Working with members of the Mental Health/Jail Task Force, POST has tentatively committed to providing approximately $40,000 to fund classes in ten law enforcement training regions. Training will apply toward continuing education requirements for certified officers. If possible, training will apply toward requirements that mandate officers to take classes in de-escalation techniques. POST will find host agencies and pay for the attendance of certified officers. The program will be marketed to the state sheriffs’ and chiefs’ associations.


39

FY17-MH04 Include Mental Health First Aid® curriculum in the POST basic academy

OfficialsfromtheColoradoPeaceOfficerStandardsandTraining(POST)willworkwithstafffromtheColoradoBehavioralHealthcareCouncil(CBHC)toreviewtheMentalHealthFirstAid®curriculum,andmodifywhenpossible,forinclusioninthePOSTbasicacademystan-dard curriculum.

Discussion POST officials report that approximately 4,500 law enforcement officials in Colorado have received Crisis Intervention Team (CIT) training, a 40-hour training that includes information on signs and symptoms of mental illnesses, mental health treatment, co-occurring disorders, legal issues and de-escalation techniques. However, many law enforcement agencies, particularly smaller agen-cies, cannot send staff to participate in a week-long CIT training. Mental Health First Aid® (MHFA) is an eight hour training focused on risk factors and warning signs for mental health and addic-tion concerns, and strategies to help individuals in both crisis and non-crisis situations. Under the umbrella of the Commission’s Mental Health/Jail Task Force, POST officials met with Task Force members and together the group developed the concepts described here regarding integrating MHFA training into the POST curriculum. CBHC may be able to assist with funding through grants and fund matching. The course is expected to be available in the spring of 2017.

40


Section 5 | Next Steps

41

Next steps

Task forces and committeesAt the close of Fiscal Year 2017 the Commission continued to support the ongoing work of the following task forces:

• Re-entry Task Force (Stan Hilkey, Chair)

• MentalHealth/PointofContactthroughJailRelease Task Force (Joe Pelle, Chair)

• Juvenile Continuity of Care Task Force (Robert Werthwein, Chair)

• Pretrial Release Task Force (Stan Hilkey, Chair)

As this report goes to press, recommendations are being prepared for presentation to the Commission by the Re-entry and Juvenile Continuity of Care Task Forces, which are both expected to complete

their scope of work and conclude by fall 2017. The Commission looks forward to supporting the work of the remaining two task forces through Fiscal Year 2018 and plans to launch two new task forces during that same time period.

SummaryThe Commission will continue to meet on the second Friday of the month, and information about the meetings, documents from those meetings, and information about the work of the task forces and committees can be found on the Commission’s web site at www.colorado.gov/ccjj. The Commission expects to present its next written annual report in the fall of 2018.

5

http://www.colorado.gov/ccjj

42


CCJJ | Appendices

43

Appendices

Appendices table of contents 45 Appendix A: Disproportionate minority contact 53 Appendix B: Community Law Enforcement Action Reporting Act 75 Appendix C: Impact of Senate Bill 13-250 / Concerning changes to sentencing of persons convicted of drug crimes 89 Appendix D: Commission Recommendation FY16-RE01 93 Appendix E: Commission Recommendation FY17-RE01 103 Appendix F: Commission Recommendation FY17-RE02 109 Appendix G: Commission Recommendation FY17-RE03

6

44


CCJJ | Appendices

45

Appendix A: Disproportionate minority contact

46


CCJJ | Appendices

47

HistoryandOverviewofCCJJMinorityOver-Representa7onEffortsandAccomplishments

GermaineMiera,DCJColoradoCommissiononCriminalandJuvenileJus7ce

March10,2017

Background:CCJJ&MOREfforts2008

HouseBill08-1119:TheGeneralAssemblydirectstheCommissiontostudythereduc<onofdispari<eswithinthecriminaljus<cesystem

• DOC/Proba<oncompiledareportonbehalfofCCJJin2010• SummarizedtheliteratureonMORinthe2010CCJJAnnualReport

2011– FourmonthsofMORstudybytheCommission(March–June)– Sevenpolicyandlegisla<verecommenda<onsapprovedinJune2011

– MORCommiPeecreatedSeptember2011– Tostudyandfurtherdevelopthesevenrecommenda<ons

– MORCommiPeeconvenedOctober2011

3/10/2017 2of12

48


Background:CCJJ&MOREfforts2011-2015

MORCommiPeemeetstostudyandfurtherdevelopthesevenrecommenda<ons

March2015– Ac<onstepsaccomplishedon6of7recommenda<ons

– Significantbarriersiden<fiedonRecommenda<on#3(Raceandethnicitydatacollec<on)

3/10/2017 3of12

HistoryofMORRecommenda7onsRecommenda7on#1(Policy)Requirecomprehensiveculturalcompetencytrainingforalljus<ceagenciesandforalltreatmentandserviceorganiza<onsusedbyjus<cesystemagencies.Ac<on:Completed• TheMORCommiPeesupportedDenver’sCrimePreven<onand

ControlCommission(CPCC)initsefforttocreateaCulturalResponsivityToolkitthatcouldbeusedbystateandlocalagencies.

• Thetoolkitwaspresentedtocommissionerstwiceoveratwoyearperiodforfeedbackandedits.

• ThetoolkitandcurriculumarecurrentlyavailableforusebyColoradoagencies.

3/10/2017 4of12

CCJJ | Appendices

49

HistoryofMORRecommenda7onsRecommenda7on#2(Policy)Alljus<ceagenciesshouldtracktheracialandethnicdiversityoftheirstaff.Everyorganiza<onshouldac<velyrecruitminoritycandidatesforbothjobopportuni<esandasmembersofboardsandcommissions.

Ac<on:Recommenda<ononly• Itisdifficulttoknowwhichagenciesareac<velyrecrui<ng

minoritycandidatesasthereisnocentralclearinghouseforsuchinforma<on.

• Limi<ngrecruitmenttoColoradoresidents,asisrequiredbyStateofColorado,narrowsthepoolofallapplicantsandpar<cularlyimpactsthediversityofpoten<alemployees.

3/10/2017 5of12

HistoryofMORRecommenda7onsRecommenda7on#2(cont’d)(Policy)Alljus<ceagenciesshouldtracktheracialandethnicdiversityoftheirstaff.Everyorganiza<onshouldac<velyrecruitminoritycandidatesforbothjobopportuni<esandasmembersofboardsandcommissions.

Ac<on:Recommenda<ononly• Regardingrecruitment,theMORSubcommiPeebelievesthatPOST(Peace

OfficerStandardsandTraining)mayprovideanopportunitytobegintheprocessfordefiningabaselinemeasureofraceandethnicityregardingcurrenthiringprac<cesacrossthestateforpeaceofficers.POSTcurrentlytracksavarietyofinforma<onandtheSubcommiPeerecommendsthatPOSTincludefieldsforraceandethnicitydatacollec<oninordertobegintrackingthesedemographicsforallpeaceofficers.

• Second,stateandlocalagenciesthatemploypeaceofficersshould(ataminimum)collecttheirjurisdic<on-specificdatathroughPOSTandmakethatinforma<onavailabletothepubliceitherviathewebsiteoruponrequest.

3/10/2017 6of12

50


HistoryofMORRecommenda7onsRecommenda7on#3(Agencypolicy/administra<verule/legisla<on)Stateandlocaljus<ceagenciesshouldcollectraceandethnicityinforma<ononthepopula<onstheyserve.Ac<on:Recommenda<ononly• Inanefforttolearnmoreaboutcurrentprac<cesregardingraceand

ethnicitydatacollec<on,theMORCommiPeecreatedanddistributedadatacapacitysurveyin2013

• 78stateandlocaljus<ceagenciesresponded• Resultsshowedthatalloftherepor<ngagenciescollectracedata,

however,determina<onofthatdatavarieswidelyandisnotalwaysmandatory

• Ethnicitydatacollec<onisvariedandsporadic• TheCommiPeecoordinatedan8-agencypanelpresenta<onforthe

CCJJtooutlinebarriersandissues

3/10/2017 7of12

Recommenda7on#3(cont’d)(Agencypolicy/administra<verule/legisla<on)

Stateandlocaljus<ceagenciesshouldcollectraceandethnicityinforma<ononthepopula<onstheyserve.

March2015• 8agencypanelpresenta<ontoCCJJonRaceandEthnicitydata

collec<onprac<cesandbarriers

Panelpresenta7onpar7cipants

PointofContact JudicialCourts

Booking Proba7on

CBI/NIBRS DepartmentofCorrec7ons

DistrictAYorney’sOffices Parole

3/10/2017 8of12

HistoryofMORRecommenda7ons

CCJJ | Appendices

51

Recommenda7on#4(Legisla<ve)Developamechanismthatrequiresaspecificreviewofproposedjus<celegisla<ontodeterminewhetherthelegisla<onwillhaveanadverseimpactonminorityover-representa<on.SomestatesrefertothisasaMinorityImpactStatement.

Ac<on:Completed• MinorityImpactStatementlegisla<onestablishedthroughSenateBill

13-229

3/10/2017 9of12


Recommenda7on#5(Commission)TheCommissionshoulddevelopandmaintainadispropor<onateminorityrepresenta<onwebsitetopromoterecogni<onandunderstandingofthisproblem.Thesiteshouldhavelocal,stateandna<onaldataandlinktoeduca<onalresources.

Ac<on:Completed• TheCCJJcreatedandmaintainsaDispropor<onateMinorityContact

pageonitswebsitewhichprovidesdataandreflectstheongoingworkoftheMORCommiPee.Thisinforma<oncanbefoundatwww.colorado.gov/ccjj

3/10/2017 10of12


52


Recommenda7on#6(Commission)Toserveasamodelforitsexpecta<onsofcriminaljus<ceagencies,theCommissionshoulddevelopandimplementaCommission-specificmentoringprogramforminorityjuvenilesandyoungadultswhoareinterestedinworkinginthecriminaljus<cesystem.

Ac<on:Completed• Thisendeavorisaccomplishedbycommissionersonanindividual

basesandthroughtheCCJJMORwebsite

3/10/2017 11of12


Recommenda7on#7(Commission)TheCommission’sSentencing,Drug,andJuvenileTaskForcesshallreviewrecommenda<onstoensurethoseproposalsdonothaveanega<veimpactonminorityoverrepresenta<on.

Ac<on:Completed

• WhenfeasibleCommissionrecommenda<onsareanalyzedbyCCJJresearchstaffforminorityimpact.

3/10/2017 12of12


CCJJ | Appendices

53

Appendix B: Community Law Enforcement Action Reporting Act

54


CCJJ | Appendices

55

Overview:CY2015C.L.E.A.R.ActReportCommunityLawEnforcementAc>onRepor>ngAct

PursuanttoSenateBill2015-185

Kim,English,DCJColoradoCommissiononCriminalandJuvenileJus>ce

March10,2017

Presenta>onoutline

• BackgroundCLEARAct

• Findings:race/ethnicity• Adultdistrictcourt(violentoffenses)• Juveniledistrictcourt

• DatadashboarddemonstraCon

• SuggesConsforreformfrom• President’sTaskForceon21stCenturyPolicing• BrennanCenterforJusCce

2of403/10/2017Overview:CY2015CLEARActReport

56


Background

In2015,theGeneralAssemblypassedSenateBill185,theCommunityLawEnforcementAc>onRepor>ngAct,ortheCLEARAct,mandaCngthattheDivisionofCriminalJusCce(DCJ)annuallyanalyzeandreportdatafrom:

• lawenforcementagencies• theJudicialDepartment• theadultparoleboard

toreflectdecisionsmadeatmul>plepointsinthejus>cesystemprocess.

TheCLEARActrequiresthatthedatabeanalyzedbyrace/ethnicityandgender.

LinkstotheFullreportandinteracCveDashboardmaybefoundat:

colorado.gov/dcj-ors/ors-SB185

Thispresenta>onreflectsinforma>onforcalendaryear2015.


Concurrentcases/criminalhistory

Arrest Courtfiling Caseoutcome Ini>alsentence


CCJJ | Appendices

57

2015ARRESTDATA

Thearrestdatawerereducedto17categoriesofoffenses(frommorethan40;seeAppendixA)thatcanbeviewedontheinteracCvedatadashboardand,forthesummaryreport,furthercollapsedintofourcategoriesof

DrugsOtherPropertyViolent

ArrestscancontainmulCplecharges.Thearrestchargepresentedhererepresentsthemostseriouschargeonthearrestasselectedbythelawenforcementofficer.


2015COURTDATA

ThemostseriousfilingorconvicConchargewascollapsedinto24offensecategoriesfrommorethan1500criminalstatutes.

Thesewerefurthercollapsedintofourcategoriesforthesummaryreport

DrugOtherPropertyViolent

Notethatalloffensecategoriesincludeabempts,solicitaCons,andconspiracies.


58



Race/ethnicityAdult%

Juvenile%

Total%

Black 3.9 5.0 4.2

Hispanic 19.1 32.4 22.2

Other 4.4 5.0 4.5

White 72.6 57.6 69.1

Total 100.0% 100.0% 100.0%

Race/ethnicityofColoradopopula>on,2015

DataSource:ColoradoDepartmentofLocalAffairs,OfficeoftheStateDemographer.


CCJJ | Appendices

59

Race/ethnicity % N

Black 12.4% 27,567

Hispanic 23.3% 51,904

Other 2.6% 5,723

White 61.8% 137,896

Total 100.0% 223,090Datasource:ColoradoBureauofInvesCgaCon,NaConalIncidentBasedReporCngSystem(NIBRS)data.

• Blacksrepresented4.2%ofthestatepopulaConin2015,butaccountedfor12.4%ofarrests/summonses

• Morelikelytobearrestedforrobbery,aggassault,andhomicide

9of40

Arrest/summonsbyrace/ethnicity2015

3/10/2017Overview:CY2015CLEARActReport

2015COURTDATA

TheJudicialDepartmentsystema4callycollectsinforma4ononracebutnotethnicity.

ThismeansthatmanyHispanicdefendantsareclassifiedasWhite,andtheHispanicclassifica4onunderrepresentsthenumberofHispanicsinvolvedincourtcases.

Consequently,therace/ethnicitydesigna4onforallthecourtdecisionpointsmustbeinterpretedwithcau4on.


60


Court % NCounty* 53% 55,819Drugs 4% 2,509Other 31% 17,430Property 19% 10,613Violent 45% 25,267AdultDistrict 39% 41,191Drugs 24% 9,850Other 22% 9,227Property 32% 13,036Violent 22% 9,078Juvenile 8% 8,146Drugs 7% 564Other 18% 1,434Property 43% 3,499Violent 33% 2,649Total 100% 105,156

Courtofcasefiling,bymostseriousfilingcharge

DataSource:DataextractedfromtheColoradoJudicialBranch'sinformaConmanagementsystem(ICON)viatheColoradoJusCceAnalyCcsSupportSystem(CJASS)andanalyzedbytheDivisionofCriminalJusCce.Notethesefiguresrepresentcases,notindividuals.*ExcludesDenverCountyCourtcases.

3/10/2017 11of40Overview:CY2015CLEARActReport

Race/ethnicity % NBlack 10.5% 10,046Hispanic 6.1% 6,398Other 2.9% 3,100White 81.5% 85,612Total 101% 105,156

Overallcourtfilingsbyrace/ethnicity,2015(County,district,juvenilecourtscombined)

DataSource:DataextractedfromtheColoradoJudicialBranch'sinformaConmanagementsystem(ICON)viatheColoradoJusCceAnalyCcsSupportSystem(CJASS)andanalyzedbytheDivisionofCriminalJusCce.Notethesefiguresrepresentcases,notindividuals.ExcludesDenverCountyCourtcases.

• Blacksrepresented4.2%ofthestatepopulaConin2015

• Injuvenilecourt,Blacksrepresented16%ofcasesfiled,comparedto5%ofBlackjuvenilesinthepopulaCon


CCJJ | Appendices

61

Regardingcaseoutcome…..

• Allchargesdismissed• Allchargesnotguilty/acquibed• Convictedascharged• Convictedofothercrime• Dismissed/notguilty• Notyetresolved

….therewerefewdifferencesacrossrace/ethnicityacrossthethreecourttypes


Ini>alSentenceBlack(n=)

Hispanic(n=)

Other(n=)

White(n=)

% % % %CommunityCorrec>onsCommunityServiceCreditforTimeServed

DeferredJudgmentDeptofCorrec>onsDivisionofYouthCorrec>onsFinesJail

Proba>on/IntensiveSupervisionUnsupervisedProba>onYouthfulOffenderSystem

Total

Ini>alSentenceforAdultDistrictCourt,byrace/ethnicity*(N=31,981)

DataSource:DataextractedfromtheColoradoJudicialBranch'sinformaConmanagementsystem(ICON)viatheColoradoJusCceAnalyCcsSupportSystem(CJASS)andanalyzedbytheDivisionofCriminalJusCce.Notethesefiguresrepresentcases,notindividuals.

Adult/DistrictCourt/AllOffenses


62


Ini>alSentenceBlack

(n=3,654)Hispanic(n=2,119)

Other(n=774)

White(n=25,434)

% % % %CommunityCorrec>ons 4.8% 3.4% 3.0% 5.3%CommunityService 0.1% 0.1% 0.5% 0.3%CreditforTimeServed 0.6% 0.2% 0.6% 0.7%

DeferredJudgment 9.0% 10.8% 13.0% 10.7%DeptofCorrec>ons 24.9% 16.9% 19.6% 17.7%DivisionofYouthCorrec>ons 0.0% 0.0% 0.0% <1%Fines 1.3% 0.7% 1.4% 1.4%Jail 8.3% 7.5% 7.1% 8.0%

Proba>on/IntensiveSupervision 47.1% 58.0% 50.8% 52.3%

UnsupervisedProba>on 3.6% 2.0% 3.2% 3.4%YouthfulOffenderSystem 0.4% 0.2% 0.6% 0.2%

Total 100.0% 100.0% 100.0% 100.0%DataSource:DataextractedfromtheColoradoJudicialBranch'sinformaConmanagementsystem(ICON)viatheColoradoJusCceAnalyCcsSupportSystem(CJASS)andanalyzedbytheDivisionofCriminalJusCce.Notethesefiguresrepresentcases,notindividuals.

Blacksaccountedfor20.9%ofiniCalsentencesinDistrictCourtin2015

15of40

Ini>alSentenceforAdultDistrictCourt,byrace/ethnicity*(N=31,981)

Adult/DistrictCourt/AllOffenses


Ini>alSentenceBlack(n=950)

Hispanic(n=486)

Other(n=234)

White(n=5168)

% % % %CommunityCorrec>ons 4.0% 2.3% 1.3% 3.7%CommunityService 0.0% 0.0% 0.0% 0.1%CreditforTimeServed 0.3% 0.2% 0.4% 0.4%

DeferredJudgment 6.8% 10.1% 11.1% 11.1%DeptofCorrec>ons 32.2% 21.4% 23.9% 21.7%Fines 0.3% 0.8% 0.4% 0.7%Jail 7.5% 9.3% 6.0% 7.8%


UnsupervisedProba>on 3.1% 1.0% 3.0% 2.7%YouthfulOffenderSystem 0.7% 0.8% 2.1% 0.7%

Total 100.0% 100.0% 100.0% 100.0%

Ini>alSentenceforViolentasmostseriousconvic>onchargeinAdultDistrictCourt,byrace/ethnicity*(N=6,838)


Adults/DistrictCourt/ViolentOffenses

27%ofiniCalsentencesforBlacksinvolvedaviolentcrimecomparedto22%overall


CCJJ | Appendices

63

Manyfactorscaninfluencethecaseoutcomedecision

• Concurrentcases*

• Priorcases(criminalhistory)**

*In201518%ofcountycourtcases,35%ofdistrictcourtcases,and36%ofjuvenilecourtcaseshadother,concurrentcasesmenConedinminuteordersorsentencingnotes

**In201572%ofdistrictcourtcaseshadpriorcases,and42%ofjuvenilecourtcaseshadpriorcases


Black Hispanic Other White

Countofconcurrentcases % N % N % N % N

None 66.5% 632 73.5% 357 72.2% 169 73.5% 3,800CommunityCorrec>ons 2.5% 16 2.5% 9 1.8% 3 3.3% 127CommunityService 0.0% 0 0.0% 0 0.0% 0 0.1% 5CreditforTimeServed 0.3% 2 0.3% 1 0.6% 1 0.5% 19

Deferred 8.2% 52 12.3% 44 12.4% 21 13.2% 503

DOC 26.1% 165 17.6% 63 21.3% 36 18.9% 717Fines 0.5% 3 1.1% 4 0.6% 1 0.8% 30Jail 6.6% 42 6.4% 23 4.7% 8 6.4% 244

Proba>on/IntensiveSupervision 51.7% 327 58.3% 208 53.8% 91 53.1% 2,018

UnsupervisedProba>on 3.5% 22 0.8% 3 4.1% 7 3.2% 121YouthfulOffenderSystem 0.5% 3 0.6% 2 0.6% 1 0.4% 16

Ini>alSentenceforViolentasmostseriouschargeinAdultDistrictCourt,byconcurrentcasesandrace/ethnicity*(N=6,838)

Adults/DistrictCourt/Violent/NOCONCURRENTCases

33.5%ofBlackshadconcurrentcasescomparedtoabout27%overall.



64


Ini>alSentenceforViolentasmostseriouschargeinAdultDistrictCourt,byconcurrentcasesandrace/ethnicity*(N=6,838)

Adults/DistrictCourt/Violent/1-2CONCURRENTCases



#concurrentcases % N % N % N % N

1-2 27.1% 257 22.0% 107 24.8% 58 22.0% 1,139

CommunityCorrec>ons 6.6% 17 1.9% 2 0.0% 0 4.5% 51CreditforTimeServed 0.4% 1 0.0% 0 0.0% 0 0.1% 1

Deferred 4.3% 11 3.7% 4 8.6% 5 5.8% 66

DOC 43.6% 112 29.9% 32 31.0% 18 26.5% 302DivisionofYouthCorrec>ons 0.0% 0 0.0% 0 0.0% 0 0.1% 1Fines 0.0% 0 0.0% 0 0.0% 0 0.5% 6Jail 7.8% 20 17.8% 19 10.3% 6 11.0% 125

Proba>on/IntensiveSupervision

33.9% 87 44.9% 48 46.6% 27 48.6% 554

UnsupervisedProba>on 2.3% 6 0.9% 1 0.0% 0 1.4% 16

YouthfulOffenderSystem 1.2% 3 0.9% 1 3.4% 2 1.5% 17



#ofpriorcases % N % N % N % N

None 23.4% 222 31.9% 155 41.0% 96 29.9% 1,543

CommunityCorrec>ons 2.7% 6 1.3% 2 1.0% 1 1.6% 24

CommunityService 0.0% 0 0.0% 0 0.0% 0 0.3% 4

CreditforTimeServed 0.5% 1 0.0% 0 0.0% 0 0.2% 3

Deferred 13.5% 30 14.2% 22 16.7% 16 21.1% 326

DOC 17.6% 39 17.4% 27 18.8% 18 15.2% 235

Fines 0.0% 0 1.3% 2 1.0% 1 0.5% 8

Jail 2.7% 6 1.9% 3 5.2% 5 2.9% 44Proba>on/IntensiveSupervision 59.0% 131 62.6% 97 53.1% 51 54.5% 841



Ini>alSentenceforViolentasmostseriouschargeinAdultDistrictCourt,bypriorcasesandrace/ethnicity*(N=6,838)

Adults/DistrictCourt/Violent/NOPRIORCases

73.6%ofBlackshadpriorcasescomparedtoabout70%overall



CCJJ | Appendices

65

Ini>alSentenceforViolentasmostseriouschargeinAdultDistrictCourt,bypriorcasesandrace/ethnicity*(N=6,838)


1-4PriorCases 37.3% 354 34.0% 165 32.1% 75 36.7% 1,897CommunityCorrec>ons 4.5% 16 3.0% 5 1.3% 1 3.5% 67CommunityService 0.0% 0 0.0% 0 0.0% 0 0.1% 1CreditforTimeServed 0.6% 2 0.0% 0 0.0% 0 0.3% 5

Deferred 7.6% 27 13.9% 23 9.3% 7 10.6% 201DOC 29.1% 103 16.4% 27 20.0% 15 16.9% 320DivisionofYouthCorrec>ons 0.0% 0 0.0% 0 0.0% 0 0.1% 1Fines 0.8% 3 1.2% 2 0.0% 0 0.8% 16Jail 6.2% 22 6.1% 10 6.7% 5 6.2% 118

Proba>on/IntensiveSupervision 48.3% 171 57.0% 94 61.3% 46 57.8% 1,096

UnsupervisedProba>on 2.3% 8 2.4% 4 1.3% 1 2.7% 52YouthfulOffenderSystem 0.6% 2 0.0% 0 0.0% 0 1.1% 20


Adults/DistrictCourt/Violent/1-4PRIORCases


Ini>alSentence Black Hispanic Other White

N 825 550 132 6,566CommunityCorrec>ons 5.0% 3.3% 1.5% 4.7%CommunityService 0.1% 0.0% 1.5% 0.4%CreditforTimeServed 1.0% 0.0% 0.0% 0.8%

DeferredJudgment 3.9% 5.6% 6.1% 6.5%DeptofCorrec>ons 15.0% 17.6% 13.6% 10.4%Fines 1.3% 0.4% 1.5% 1.3%

Jail 9.7% 5.1% 7.6% 7.2%Proba>on/IntensiveSupervision 61.5% 66.5% 66.7% 66.2%UnsupervisedProba>on 2.5% 1.3% 1.5% 2.5%YouthfulOffenderSystem 0.0% 0.2% 0.0% 0.0%

Total 100.0% 100.0% 100.0% 100.0%

Ini>alSentenceforDrugsasmostseriousconvic>onchargeinAdultDistrictCourt,byrace/ethnicity(N=8,073)


Adult/DistrictCourt/Drugs


66




DeferredJudgment 7.9% 10.2% 13.8% 8.5%DeptofCorrec>ons 38.2% 23.3% 25.3% 29.2%Fines 2.1% 1.3% 1.7% 2.4%Jail 11.4% 9.5% 8.6% 11.1%

Proba>on/IntensiveSupervision 32.4% 48.8% 42.0% 38.8%UnsupervisedProba>on 3.2% 2.6% 2.9% 3.7%YouthfulOffenderSystem 0.4% 0.0% 0.0% 0.0%Total 100.0% 100.0% 100.0% 100.0%

Ini>alSentenceforOtherasmostseriousconvic>onchargeinAdultDistrictCourt,byrace/ethnicity(N=6,292)


Adult/DistrictCourt/Other


Black(n=774)

Hispanic(n=654)

Other(n=219)

White(n=3,691)

Ini>alSentence % % % %CommunityCorrec>ons 0.0% 0.0% 0.5% 0.0%CommunityService 0.4% 0.9% 0.9% 0.7%CreditforTimeServed 0.0% 0.2% 0.0% 0.1%

DeferredJudg. 16.0% 25.8% 40.2% 38.7%DeptofCorrec>ons+ 0.1% 0.0% 0.0% 0.0%

DivisionofYouthCorrec>ons 13.4% 9.6% 8.7% 9.2%Fines 1.9% 2.1% 3.2% 2.9%Jail 2.6% 2.8% 1.8% 1.1%JuvenileDeten>on 1.3% 0.6% 1.8% 1.4%

Proba>on/IntensiveSupervision 63.2% 56.9% 42.0% 44.9%UnsupervisedProba>on 0.9% 0.8% 0.9% 1.0%YouthfulOffenderSystem 0.1% 0.3% 0.0% 0.0%

Total 100.0% 100.0% 100.0% 100.0%

Ini>alSentenceforJuvenileCourtbyrace/ethnicity*(N=5,338)


+Felonymenacingwithaweapon.Offenderwas18onfilingdate.

Juvenile/DistrictCourt/AllOffenses


CCJJ | Appendices

67



DeferredJudgment 14.8% 24.3% 45.1% 42.1%DeptofCorrec>ons+ 0.4% 0.0% 0.0% 0.0%

DYC 16.0% 13.2% 12.7% 10.4%Fines 1.6% 0.5% 1.4% 1.0%Jail 1.2% 1.6% 0.0% 0.6%JuvenileDeten>on 0.4% 0.5% 1.4% 0.8%

Proba>on/IntensiveSupervision 65.2% 58.7% 39.4% 44.1%UnsupervisedProba>on 0.0% 0.0% 0.0% 0.4%YouthfulOffenderSystem 0.4% 1.1% 0.0% 0.1%

Total 100.0% 100.0% 100.0% 100.0%

Ini>alSentenceforViolentasmostseriousconvic>onchargeinJuvenileCourt,byrace/ethnicity*(N=1,635)

Juvenile/DistrictCourt/ViolentOffenses

DataSource:DataextractedfromtheColoradoJudicialBranch'sinformaConmanagementsystem(ICON)viatheColoradoJusCceAnalyCcsSupportSystem(CJASS)andanalyzedbytheDivisionofCriminalJusCce.Notethesefiguresrepresentcases,notindividuals.+Felonymenacingwithaweapon.Offenderwas18onfilingdate.



N 45 42 16 282

CommunityService 2.2% 0.0% 0.0% 0.0%

DeferredJudgment 15.6% 38.1% 56.3% 41.8%DYC 13.3% 2.4% 0.0% 4.3%Fines 4.4% 4.8% 6.3% 8.9%

Jail 2.2% 4.8% 0.0% 2.1%

JuvenileDeten>on 0.0% 2.4% 0.0% 1.8%


UnsupervisedProba>on 2.2% 0.0% 0.0% 1.4%

Total 100.0% 100.0% 100.0% 100.0%

Ini>alSentenceforDrugsasmostseriousconvic>onchargeinJuvenileCourt,byrace/ethnicity*(N=385)


Juvenile/DistrictCourt/DrugOffenses


68



N 341 315 98 1,605CommunityService 0.6% 1.0% 2.0% 0.9%CreditforTimeServed 0.0% 0.0% 0.0% 0.1%

DeferredJudgment 17.9% 25.7% 36.7% 37.7%DivisionofYouthCorrec>ons 8.5% 9.5% 7.1% 8.7%Fines 2.1% 2.2% 3.1% 2.4%Jail 3.8% 3.8% 4.1% 1.1%JuvenileDeten>on 0.9% 0.6% 3.1% 1.3%

Proba>on/IntensiveSupervision 65.7% 55.9% 42.9% 46.5%UnsupervisedProba>on 0.6% 1.3% 1.0% 1.4%Total 100.0% 100.0% 100.0% 100.0%

Ini>alSentenceforPropertyasmostseriousconvic>onchargeinJuvenileCourt,byrace/ethnicity*(N=2,359)


Juvenile/DistrictCourt/PropertyOffenses



N 132 108 34 685CommunityCorrec>ons 0.0% 0.0% 2.9% 0.0%

CommunityService 0.0% 2.8% 0.0% 1.5%

CreditforTimeServed 0.0% 0.9% 0.0% 0.0%

DeferredJudgment 13.6% 24.1% 32.4% 34.2%DYC 21.2% 6.5% 8.8% 10.5%Fines 1.5% 3.7% 5.9% 4.5%

Jail 2.3% 0.9% 0.0% 1.6%

JuvenileDeten>on 4.5% 0.0% 0.0% 2.5%

Proba>on/IntensiveSupervision 53.8% 60.2% 47.1% 44.4%UnsupervisedProba>on 3.0% 0.9% 2.9% 0.9%

Total 100.0% 100.0% 100.0% 100.0%

Ini>alSentenceforOtherasmostseriousconvic>onchargeinJuvenileCourt,byrace/ethnicity*(N=959)


Juvenile/DistrictCourt/OtherOffenses


CCJJ | Appendices

69


#Concurrentcases % N % N % N % N

None 53.5% 414 72.5% 474 67.1% 147 63.0% 2,325

CommunityCorrec>ons 0.0% 0 0.0% 0 0.0% 0 0.0% 1



Deferred 22.0% 91 30.4% 144 52.4% 77 47.5% 1,105DeptofCorrec>ons 0.2% 1 0.0% 0 0.0% 0 0.0% 0

DYC 5.8% 24 5.1% 24 3.4% 5 4.3% 99

Fines 3.1% 13 2.1% 10 3.4% 5 3.5% 81

Jail 1.7% 7 1.9% 9 2.0% 3 1.0% 23

JuvenileDeten>on 1.2% 5 0.6% 3 1.4% 2 1.4% 33

Proba>on/IntensiveSupervision 63.8% 264 57.6% 273 35.4% 52 40.1% 932



Ini>alSentenceinJuvenileCourt,byconcurrentcasesandrace/ethnicity*(N=5,338)

Juvenile/DistrictCourt/Alloffenses/NOCONCURRENTCases


46.5%ofBlackyouthhadconcurrentcasescomparedtoabout35%overall



1-2concurrentcases 34.8% 269 21.1% 138 25.6% 56 29.1% 1,074


Deferred 8.9% 24 17.4% 24 14.3% 8 25.9% 278

DYC 20.4% 55 12.3% 17 12.5% 7 12.6% 135

Fines 0.7% 2 2.2% 3 3.6% 2 2.1% 23

Jail 3.3% 9 5.1% 7 1.8% 1 1.5% 16





Ini>alSentenceinJuvenileCourt,byconcurrentcasesandrace/ethnicity*(N=5,338)

Juvenile/DistrictCourt/Alloffenses/1-2CONCURRENTCases



70



#ofpriorcases % N % N % N % N

None 28.9% 224 43.0% 281 47.0% 103 41.3% 1,526CommunityService 0.4% 1 2.1% 6 1.0% 1 0.5% 8CreditforTimeServed 0.0% 0 0.0% 0 0.0% 0 0.1% 2

Deferred 30.4% 68 43.8% 123 60.2% 62 59.3% 905

DYC 2.2% 5 1.8% 5 1.0% 1 1.4% 21Fines 2.7% 6 1.8% 5 1.9% 2 3.0% 46Jail 2.7% 6 0.0% 0 1.0% 1 0.4% 6JuvenileDeten>on 2.2% 5 0.4% 1 1.9% 2 1.4% 21



Ini>alSentenceinJuvenileCourt,bypriorcasesandrace/ethnicity(N=5,338)

Juvenile/DistrictCourt/Alloffenses/NOPRIORCases


About71%ofBlackyouthhadpriorcasescomparedtoabout58%overall



1-2PriorCases 34.8% 269 31.8% 208 32.9% 72 33.8% 1,246



Deferred 15.2% 41 17.3% 36 33.3% 24 34.8% 434

DYC 7.4% 20 7.7% 16 5.6% 4 5.9% 74Fines 1.5% 4 2.9% 6 6.9% 5 2.5% 31

Jail 3.0% 8 2.4% 5 2.8% 2 1.4% 17





Ini>alSentenceinJuvenileCourt,bypriorcasesandrace/ethnicity(N=5,338)

Juvenile/DistrictCourt/Alloffenses/1-2PRIORCases



CCJJ | Appendices

71

Summary• Blacksmorelikelytogetarrested

• Blackslesslikelytogetdeferredjudgments

• Blacksmorelikelytoreceivesentencetoconfinement

• Thelast2bulletsapplyevenwhenholdingconstantthenumberofconcurrentcasesandpriorcasehistory


WebsitedemonstraCon

34of40

colorado.gov/dcj-ors/ors-SB185


72


FromthePresident’sTaskForceon21stCenturyPolicing

Lawenforcementagenciesshould…

• Embraceaguardianmindset,promoCngthedignityofallindividualsandprotecCngeveryone’sConsCtuConalrights(ProceduralJusCce)

• Considerthecollateraldamageofanygivensafetystrategyonpublictrust

• Strivetocreateadiverseworkforce

• InfusecommunitypolicingandproblemsolvingprinciplesthroughouttheorganizaConalstructure

• WorkwithschoolstodevelopalternaCvestosuspension/expulsion

• Ensuretrainingoccursthroughoutanofficer’scareerwithproceduraljusCceatthecenter/lessonstoimprovesocialinteracCons/lessonsonaddicCon/lessonsonrecognizingandconfronCngimplicitbias


FromtheBrennanCenterforJusCce

Reducingracial/ethnicdispari2esinjails(2015)RoundtableparCcipantsincludedCommissionerRaemisch

1. Focusonlowleveloffenses• Oncestopped,Blacksmorelikelytobearrested

• ExploratoryanalysisbyDCJfoundBlacksweremorelikelytoreceiveacourtfilingfollowingarrestcomparedtoWhitesandHispanics

• 2014studybyNaConalBureauofEconomicResearchfoundchargesmorelikelytobefiledfollowingarrestcomparedtopreviousdecades

• Expandpre-arrestdiversionprograms

• Expandpre-chargeandpretrialdiversionprograms


CCJJ | Appendices

73

2. Focusonunnecessaryuseofpretrialdeten>on

• ResearchshowslengthofpretrialdetenConislinkedtolongerpost-sentenceconfinementinjailandprison

• Blacksmorelikelytobeconfinedpre-trial• Leadstolossofjob,housing,healthcare

• Useriskassessmenttools• Expandpretrialservicesprograms• Divertlow-leveloffenders• Eliminatemoney-basedpretrialsystems


Reducingracial/ethnicdispari2esinjails(2015)


3.Considertheaggressivecollec>onofcriminaljus>cedebt

• RacialdispariCesarereinforcedbysocioeconomicinequality

• Assessindividuals’abili2estopay

4.Everyonewhoexercisesdiscre>on:Undergotrainingtoiden>fyandconfrontimplicitracial/ethnicbias




74


Officialsinlocaljurisdic>onscancreateacross-agencyTaskForcetoreduceracialdispari>es

1. IdenCfydrivers;pinpointwheredispariCesaremostpervasive.2. SpecifygoalsandmeasuresofsuccessforthejurisdicCon3. Requiretrainingforallsystemactorstoovercomeimplicitracialbias;for

anyonewhoexercisesdiscreCon4. EncourageprosecutorstoprioriCzeseriousandviolentoffenses;don’t

conflate“success”withnumberofprosecuConsorconvicCons5. IncreaseindigentrepresentaConinmisdemeanorcaseswhenjailCmeis

anavailablepunishment6. Provide“benchcards”tojudgestocombatimplicitbiasandunnecessary

useofjail




Thankyouforyouramen>ontoday


CCJJ | Appendices

75

Appendix C: Impact of Senate Bill 13-250 / Concerning changes to sentencing of persons convicted of drug crimes

76


CCJJ | Appendices

77

Thestudyoftheimpactofcertaindrugsentencingreforms,pursuanttoSenateBill2013-250

PegFlick,SeniorAnalystKimEnglish,ResearchDirectorDivisionofCriminalJusIceDepartmentofPublicSafety

PresentedtotheCommissiononJune9,2017

AnalysisofSenateBill13-250

• Overview– BackgroundofCommissionworkondrugpolicy

– OverviewofSenateBill13-250(creatednewdrugsentencinggrid)

– Studyapproach– Studyfindings

6/9/2017 2

78



• S.B.13-250History– DrugPolicyTaskForceworkedfromAugust2009toOctober2013

– Membership…

6/9/2017 3

AnalysisofSenateBill13-250GraysonRobinson,ChairArapahoeCountySheriff

DeanConder,ViceChair,JuvenileParoleBoardBillKilpatrickChief,GoldenPoliceDepartmentDonQuickDistrictA\orney,17thJudicialDistrictReoLeslie,Jr.ColoradoSchoolforFamilyTherapyReginaHuerter,DenverCrimePrevenIonandControlCommissionGregLong,DeputyDistrictA\orney,2ndJudicialDistrictMaureenCain,ColoradoCriminalDefenseBarCarmelitaMuniz,ColoradoAssociaIonofAlcoholandDrugServiceProvidersBrianConnors,PublicDefender’sOfficeKathleenMcGuire,PublicDefender’sOfficeTomRaynesA\orney,General’sOfficeMilesMadorin,DeputyDistrictA\orney,1stJudicialDistrictNancyFeldman,DepartmentofPublicSafetyDoyleForrestal,ColoradoBehavioralHealthCareCouncilChrisIeDonner,ColoradoCriminalJusIceReformCoaliIonEvieHudak,StateSenator,District19PatSteadman,StateSenator,District31PaulThompson,Peer1,AddicIonResearchandTreatmentServicesDanRubinstein,DeputyDistrictA\orney,21stJudicialDistrictMarkHurlbert,DistrictA\orney,5thJudicialDistrictJimWelton,DepartmentofCorrecIonsSeanMcAllister,CriminalDefenseA\orneyShaneBahr,ColoradoJudicialBranch

DrugPolicyTaskForceMembership

6/9/2017 4

CCJJ | Appendices

79


• S.B.13-250HistoryInMay2009,theGovernorandA\orneyGeneralrequestedthattheCommissioninvesIgateif

“there[are]evidence-baseddatatosupportchangesinthelengthofsentenceforthosewhousecontrolledsubstances,andshouldtherebeafocusonsubs:tu:ngtreatmentforpunishment?”

6/9/2017 5


• S.B.13-250History

--SenateBill09-286modifiedtheduIesoftheCommissionandmandatedthestudyof,amongotherthings,Title18drugcrimesandsentences“andwhethertochangethosesentences”andmandatedareportbyNov.30,2009. --Inthe2009report,“DrugPolicyTaskForcedeterminedthataprimaryomissionfromcurrentlawisameansofassuringpromptandeffecIvetreatmentofdrugoffenders.”(p.17) --andalso:“…anysignificantdeparturefromcurrentlawrequiresthatresourcesforthetreatmentmodelbeinplacebeforechangingtoanewapproach.”(p.18)

6/9/2017 6

80



• S.B.13-250History--SenateBill09-286mandatedthestudyofdrugsentencesandaNov.2009report

TheNovember2009report,itslengthyaddendum,andthe2009,2010,2011,and2012*annualCommissionreportscontaindozensofdrugpolicy,philosophy,andsentencingrecommendaIonsthatemphasizetheneedfortreatmenttoreducerecidivismincludingthis:

TheCommissionrecommendsthattheColoradoGeneralAssemblyseektoimprovepublicsafety,reducerecidivism,andpromotesubstanceabusetreatmentbyimplemen:ngasystemofevidence-basedsentencingprac:cesandcommunity-basedinterven:onsthat...willcombineaccountability,riskandneedsassessments,criminalpenal:es,andappropriatetreatmentforindividualswhoareaddictedtosubstancesandconvictedofcriminaloffenses.

*The2012reportdetailstherecommendaIonsthatledtoSB13-250.6/9/2017 7



ThissystemwilldifferenIateamongthefollowingtypesofindividuals:

(a) adefendantwhoisanillegaldruguserbutisnotaddictedorinvolvedinothercriminalacIvity;

(b) adefendantwhoisaddictedbutisnototherwiseengagedinothercriminalacIvity;

(c) adefendantwhoisaddictedandengagedinnonviolentcrimetosupporttheiraddicIon;

(d) adefendantwhoisaddictedandengagedinviolentcrime;and

(e) adefendantwhoisengagedindrugtraffickingormanufactureforprofitwhoisnotaddictedtoillegaldrugs.

6/9/2017 8

CCJJ | Appendices

81

Increasetreatmentavailabilitypriortorestructuringdruglaws(2009)

• IncreaseinPersistentDrunkDriverSurcharge($550,000/year)(HB10-1347)• Drugoffendersurchargeassesseddoubled(HB10-1352)• $1,545,409forcommunitycorrecIonstreatmentbeds(HB10-1360)

• $2,057,225servicesforparolees(HB10-1360)• First$2Minmedicalmarijuanasales/usetaxfundsubstanceabusetreatmentprograms(HB10-1284)

DRUGLAWREFORMS2009/2012

6/9/2017 9


Withastrong,well-documented,empirically-basedphilosophicalstatementaboutthevalueofsubstanceabusetreatment,theCommission’sworkresultedin

• Theexpansionoftreatmentservicesinthecommunity,and

• SenateBill13-250

• whichincludedamandatetoDCJtostudytheimpactofcertainaspectsofthedruglawmodificaIons


hFps://cdpsdocs.state.co.us/ors/docs/reports/2017_SB250-Rpt.pdf


6/9/2017 10

82



• S.B.13-250Highlights– Createdanewsentencinggridfordrugoffenses– CreatedanewopIonfordrugoffenderstoavoidafelonyconvicIon(“Wobbler”)

– InstructedthecourttoexhaustallremediesbeforesentencingcertaindrugoffenderstotheDepartmentofCorrecIons

6/9/2017 111


• StudyMethodology– Comparesentencesinthe3yearspriortoSB13-250tothe3yearspost-SB13-250.

– Casesinthepre-SB13-250periodhadtoalleventsoccurringinthe3yearperiod:• Offensewascommi\ed• Casewasfiled• Offenderconvictedandsentenced

– Exactmatchbetweenpre-andpost-SB13-250statutesnotalwayspossible

6/9/2017 122

CCJJ | Appendices

83


• Newsentencinggridfordrugoffenders– Fivefelonyclassescollapsedtofour– ExceptforthehighestclassDF1,sentencelengthsinthepresumpIverangeareallshorter

6/9/2017 133


Pre-SB13-250 Post-SB13-250Felonies DrugFelonies

Aggravated/MiUgated Aggravated

Min Max Min Max Min Max Min Max DF1 8 32 F2 8 24 4 48 F3 4 12 2 24 DF2 4 8 8 16F4 2 6 1 12 DF3 2 4 4 6F5 1 3 0.5 6F6 1 1.5 0.5 3 DF4 0.5 1 1 2

6/9/2017 144

84



• Newsentencinggridfordrugoffenders– AverageDOCsentencelengthforDF3toDF1convicIons5.8yearsvs7.1yearsforcomparableconvicIonsintheprior3years

– AveragesentencelengthforDF4convicIonswas1.1yearsvs2.5yearsforcomparableconvicIonsintheprior3years

6/9/2017 155


• NewsentencingopIontoavoidafelonyconvicIon(“Wobbler”)– UponsuccessfulcompleIonofsentencetothecommunitytheDF4convicIonisvacatedandamisdemeanorconvicIon(DM1)isentered.

6/9/2017 166

CCJJ | Appendices

85


• NewsentencingopIontoavoidafelonyconvicIon(“Wobbler”)– AlternaIveforoffenderswhodon’tqualifyfordiversionordeferredsentence

– Musthaveonlyminimalcriminalhistory– Availabletothosebeingsentencedtoaplacementinthecommunity

– AvailableonfourDF4offenses

6/9/2017 177


• NewsentencingopIontoavoidafelonyconvicIon(“Wobbler”)– AttheImeofthereport160casessuccessfullycompletedsentenceandhadfelonyconvicIonreplacedwithmisdemeanorconvicIon

– Incomparison*tothepre-SB13-250periodtheuseofdeferredjudgmentsanddiversiondeclinedfrom35%to20%ofconvicIons.• HoweverthewobblerprovisionenabledanaddiIonal73%ofcasesinthepost-S.B.13-250periodtopotenIallyhavethefelonyconvicIonreducedtoamisdemeanor,providedtheymetquanItylimitsandsuccessfullycompletedthesentencetothecommunity.

*Criminalhistorywaswobbler-eligible

6/9/2017 188

86



• ExhausIonofRemediesforDF4ConvicIons– InstructsthecourttoexhaustallremediesbeforesentencinganoffendertotheDOC:• TakingintoconsideraIonthefactsofthecase,• Consideringthedefendant’swillingnesstoparIcipateintreatment,

• FindingthatallothersancIonshavebeentriedandfailed,

• FindingthatothersancIonsareunlikelytowork,• FindingthatothersancIonspresentanunacceptablerisktopublicsafety.

6/9/2017 199


• ExhausIonofRemediesforDF4ConvicIons– SentencestoDOCforDF4convicIonsdeclinedfrom18%to14%inthepost-SB13-250period

– ButsentencestoDOCforDF1throughDF3levelconvicIonsalsodeclinedinthepost-SB13-250periodfrom42%to38%.

6/9/2017 20

CCJJ | Appendices

87


FullreportisontheCCJJwebsite

h\ps://cdpsdocs.state.co.us/ors/docs/reports/2017_SB250-Rpt.pdf

6/9/2017 221

88


CCJJ | Appendices

89

Appendix D: Commission Recommendation FY16-RE01

90


CCJJ | Appendices

91

!"#$%&&'()*+,$ -./.01-2$1"34$56-7.$!"#$%&'()*++(#,$-"*#&.'(/(#-(,&-*&-0(&

)*%*'$,*&)*++"//"*#&*#&)'"+"#$%&$#,&123(#"%(&12/-")(&1456&789&:87;&

&5289/-.$:;8<$$=&+%>*$>?*$3>%>@>('A$7(B+C>C(B#$(D$E%'(F*$>($-*DF*G>$7(B>*H&('%'A$%B+$.)C+*BG*$

I%#*+$7(HH(B$E'%G>CG*#$

!<7;='(>87&&&&&&&&&&&)?@?ABC?&)?DDEFFE?5&?5&)AEDE5B@&B5C&14G65E@6&14FHEI6&&&&&&&&&&&&&&1456&789&:87;&&&&&& .BJ6&8&?K&8&

&&-*G(HH*B+%>C(B$5289/-.$:;8$2LCBH6&HM6&FHBH4H6&J?G6A5E5J&LBA?@6&I?5CEHE?5F9&)N'N/N&7O=:=:879&H?&JEG6&HM6&LBA?@6&P?BAC&B5C&I?DD45EHQ&LBA?@6&?KKEI6AF&CEFIA6HE?5&H?&F6@6IH&E5CEGEC4B@ER6C&I?5CEHE?5F&?K&LBA?@6N&&&&&JC#G@##C(B$"5&#?G6DP6A&:87S9&HM6&)?@?ABC?&)?DDEFFE?5&?5&)AEDE5B@&B5C&14G65E@6&14FHEI6&BC?LH6C&!<7;=+.&>87&T!"#$%&'$(#')&*+,%&'%-&'.%$%/%0+1'2/+"03&3'04'2$+05&'%0')&45&6%'70(%&8"0+$+1'$(#'70880('9:,#&(6&;<$3&#'2+$6%,6&3U&H?&BD65C&HM6&FHBH4H6&J?G6A5E5J&HM6&L4AL?F6F&?K&LBA?@6&E5&)?@?ABC?&TF66&)N'N/N9&V7O=::NS=78:NSUN&&WEHM&HM6&FEJ5E5J&?K&0?4F6&XE@@&:87;=7:7S9&HM6&L4AL?F6F&?K&LBA?@6&E5I@4C6&YA6C4IE5J&HM6&E5IEC65I6&?K&H6IM5EIB@&GE?@BHE?5FZ9[\&F6HHE5J&YE5CEGEC4B@ER6C&I?5CEHE?5F&?K&LBA?@6Z9[\&B5C&BCCA6FFE5J&LBA?@66F]&YEC65HEKE6C&AEF^F&B5C&566CFZN[\&&-MEF&A6I?DD65CBHE?5&_E@@&P4E@C&4L?59&B5C&JEG6&F4PFHB5I6&H?9&!<7;=+.&>87N&&&&&)?@?ABC?]F&I4AA65H&LBA?@6&P?BAC&FHBH4H6&DB5CBH6F&B&@EFH&?K&6@6G65&I?5CEHE?5F9&DB5Q&?K&_MEIM&MBG6&D4@HEL@6&F4P=I?5CEHE?5F&HMBH&D4FH&P6&EDL?F6C&?5&6G6AQ&)?@?ABC?&LBA?@66N&&-M?F6&I?5CEHE?5F&E5I@4C6&B&DB5CBH6&HMBH&6G6AQ&LBA?@66&P6&H6FH6C&K?A&CA4JF&B5C&B@I?M?@&BH&FL6IEKE6C&E5H6AGB@F9&5?H&BFF?IEBH6&_EHM&?HM6A&L6?L@6&_M?&MBG6&B&IAEDE5B@&A6I?AC9&B5C&A6DBE5&_EHME5&B&5BAA?_@Q&C6KE56C&J6?JABLMEI&BA6BN&&-M6&'6=65HAQ&-BF^&!?AI69&HM6&,6LBAHD65H&?K&)?AA6IHE?5F9&B5C&HM6&.BA?@6&X?BAC&B@@&P6@E6G6&HMBH&DB5Q&?K&HM6&FHBH4H?AE@Q&DB5CBH6C&I?5CEHE?5F&?K&LBA?@6&BA6&5?H&6GEC65I6&PBF6C&_M65&BLL@E6C&H?&B@@&LBA?@66FN&&)?5CEHE?5F&F4IM&BF&B&F4PFHB5I6&H6FHE5J&A6JED659&BFF?IEBHE?5&A6FHAEIHE?5F9&B5C&FHAEIH&J6?JABLMEI&P?45CBAE6F9&DBQ&P6&BLLA?LAEBH6&K?A&F?D6&?A&D?FH&LBA?@66FN&&-M6Q&BA6&5?H9&M?_6G6A9&BLLA?LAEBH6&K?A&B@@&LBA?@66FN&&"DL?FE5J&4556I6FFBAQ&I?5CEHE?5F&?K&LBA?@6&EF&B&P4AC65&?5&HM6&/HBH6]F&A6F?4AI6F9&LA6F65HF&65K?AI6D65H&CEKKEI4@HE6F97&B5C&IB5&P6&C6HAED65HB@&H?&HM6&A6IECEGEFD&LA?FL6IHF&?K&E5CEGEC4B@&LBA?@66FN:&&&&-MEF&A6I?DD65CBHE?5&_E@@&5?H&LA?MEPEH&HM6&.BA?@6&X?BAC&?A&I?DD45EHQ&LBA?@6&?KKEI6AF&KA?D&L@BIE5J&B5Q&I?5CEHE?5&?5&B5Q&LBA?@66`&EH&_E@@&FEDL@Q&6@EDE5BH6&HM6&A6a4EA6D65H&HMBH&F?D6&LBA?@6&I?5CEHE?5F&D4FH&BLL@Q&H?&B@@&LBA?@66FN&&"H&_E@@&HM4F&JEG6&HM6&.BA?@6&X?BAC&B5C&LBA?@6&?KKEI6AF&CEFIA6HE?5&H?&C6H6ADE56&_MEIM&I?5CEHE?5F&BA6&BLLA?LAEBH6&K?A&_MEIM&LBA?@66F9&E5&?AC6A&H?&P6HH6A&@6G6ABJ6&@EDEH6C&A6F?4AI6F&B5C&BCCA6FF&E5CEGEC4B@&?KK65C6AF]&IAEDE5?J65EI&566CFN&&&& 1 It is wholly impractical, for instance, to expect that parolees in community corrections placements will not associate with other people who have criminal records. 2 RKC Group & Roger Przybylski, What Works: Effective Recidivism Reduction and Risk-Focused Prevention Programs 30, 37 (Feb. 2008) (report prepared for the Colorado Division of Criminal Justice).

92


!"#$%&&'()*+,$ -./.01-2$1"34$56-7.$!"#$%&'()*++(#,$-"*#&.'(/(#-(,&-*&-0(&

)*%*'$,*&)*++"//"*#&*#&)'"+"#$%&$#,&123(#"%(&12/-")(&1456&789&:87;&

&5289/-.$:;8<$$=&+%>*$>?*$3>%>@>('A$7(B+C>C(B#$(D$E%'(F*$>($-*DF*G>$7(B>*H&('%'A$%B+$.)C+*BG*$

I%#*+$7(HH(B$E'%G>CG*#$

!<7;='(>87&&&&&&&&&&&)?@?ABC?&)?DDEFFE?5&?5&)AEDE5B@&B5C&14G65E@6&14FHEI6&&&&&&&&&&&&&&1456&789&:87;&&&&&& .BJ6&K&?K&K&

&E'(&(#*+$3>%>@>('A$L%BM@%M*&&=>&5&%,0(3'$+&',(#,6$%&#'?1'3%+,@&%-+0/A-3'$(#'$##,%,0(3'$+&',(#,6$%&#',('!"#$BC&&&V7O=:=:87N&/HBH6&P?BAC&?K&LBA?@6==C6KE5EHE?5F&&7O=:=:87TSUTIUT"UN&$F&B&I?5CEHE?5&?K&6G6AQ&LBA?@69&HM6&P?BAC&FMB@@&?AC6A&HMBH&HM6&?KK65C6A&DB^6&A6FHEH4HE?5&H?&HM6&GEIHED&?A&GEIHEDF&?K&MEF&?A&M6A&I?5C4IH&CD$N&-M6&BD?45H&?K&F4IM&A6FHEH4HE?5&?%#$N**B$('+*'*+&FMB@@&P6&C6H6ADE56C&PQ&HM6&I?4AH&L4AF4B5H&H?&BAHEI@6&7bNS&?K&HEH@6&7;9&)N'N/N&-M6&P?BAC&FMB@@&KEc&HM6&DB556A&B5C&HED6&?K&LBQD65H&?K&A6FHEH4HE?5&BF&B&I?5CEHE?5&?K&LBA?@6N&/4IM&?AC6A&FMB@@&A6a4EA6&HM6&?KK65C6A&H?&DB^6&A6FHEH4HE?5&_EHME5&HM6&L6AE?C&?K&HED6&HMBH&HM6&?KK65C6A&EF&?5&LBA?@6&BF&FL6IEKE6C&PQ&HM6&P?BACN&"5&HM6&6G65H&HMBH&HM6&C6K65CB5H&C?6F&5?H&DB^6&K4@@&A6FHEH4HE?5&PQ&HM6&CBH6&FL6IEKE6C&PQ&HM6&P?BAC9&HM6&A6FHEH4HE?5&DBQ&P6&I?@@6IH6C&BF&LA?GEC6C&K?A&E5&BAHEI@6&7bNS&?K&HEH@6&7;9&)N'N/N&&7O=:=:87TSUTKUT"UTXUN&-MBH&HM6&LBA?@66&FMB@@&6FHBP@EFM&B&A6FEC65I6&?K&A6I?AC&B5C&FMB@@&5?H&IMB5J6&EH&_EHM?4H&&'C('$B(>CDCG%>C(B&HM6&^5?_@6CJ6&B5C&I?5F65H&?K&MEF&?A&M6A&I?DD45EHQ&LBA?@6&?KKEI6A&B5C&HMBH&HM6&LBA?@66&FMB@@&5?H&@6BG6&HM6&BA6B&?A&HM6&FHBH6&_EHM?4H&HM6&L6ADEFFE?5&?K&MEF&?A&M6A&I?DD45EHQ&LBA?@6&?KKEI6A`&&7O=:=:87TSUTKUT"UT,UN&-MBH&HM6&LBA?@66&FMB@@&DB^6&A6L?AHF&BF&CEA6IH6C&PQ&MEF&?A&M6A&I?DD45EHQ&LBA?@6&?KKEI6A9&L6ADEH&A6FEC65HEB@&GEFEHF&PQ&HM6&I?DD45EHQ&LBA?@6&?KKEI6A9&F4PDEH&H?&4AE5B@QFEF&?A&?HM6A&CA4J&H6FHF9&B5C&B@@?_&HM6&I?DD45EHQ&LBA?@6&?KKEI6A&H?&DB^6&F6BAIM6F&?K&MEF&?A&M6A&L6AF?59&A6FEC65I69&?A&G6MEI@6`&&7O=:=:87TSUTKUT"U&T!U&-MBH&HM6&LBA?@66&FMB@@&5?H&BFF?IEBH6&_EHM&B5Q&?HM6A&L6AF?5&?5&LBA?@69&?5&LA?PBHE?59&?A&_EHM&B&IAEDE5B@&A6I?AC&?A&_EHM&B5Q&E5DBH6&?K&B&I?AA6IHE?5B@&KBIE@EHQ&_EHM?4H&HM6&L6ADEFFE?5&?K&MEF&?A&M6A&I?DD45EHQ&LBA?@6&?KKEI6A`&D)&;$5"-$?&%,E&'FG;H;HIF=JC=4C=KC=LC'%-+0/A-'=MC'%0'FG;H;HIF=JC=4C=KC'=NC'%-+0/A-'=IC'O'&7O=:=:87TSNSUTBUN&$F&B&I?5CEHE?5&?K&LBA?@69&HM6&P?BAC&H%A&FMB@@&A6a4EA6&6G6AQ&LBA?@66&BH&HM6&LBA?@66]F&?_5&6cL65F6&H?&F4PDEH&H?&AB5C?D&IM6DEIB@&H6FHE5J&?K&B&PE?@?JEIB@&F4PFHB5I6&FBDL@6&KA?D&HM6&LBA?@66&H?&C6H6ADE56&HM6&LA6F65I6&?K&CA4JF&?A&B@I?M?@N&/4IM&H6FHE5J&FMB@@&HB^6&L@BI6&BF&K?@@?_Fd&&T"U&"DD6CEBH6@Q&4L?5&HM6&LBA?@66]F&A6@6BF6&KA?D&E5IBAI6ABHE?5&E5&?AC6A&H?&6FHBP@EFM&B&PBF6@E56&FBDL@6`&&T""U&WEHME5&HM6&KEAFH&HMEAHQ&CBQF&KA?D&HM6&CBH6&?K&LBA?@6`&&T"""U&*5&?A&BKH6A&FEcHQ=?56&CBQF&P4H&5?H&@BH6A&HMB5&FEc&D?5HMF&KA?D&HM6&CBH6&?K&LBA?@6`&B5C&&T"3U&$554B@@Q&?5&?A&BKH6A&?56&Q6BA&KA?D&HM6&CBH6&?K&LBA?@6&K?A&HM6&C4ABHE?5&?K&LBA?@6N&&7O=:=:87TSNSUTIUT"UN&OD$G?*HCG%F$>*#>CBM$C#$'*P@C'*+$%#$%$G(B+C>C(B$(D$&%'(F*Q$>?*$-M6&I?DD45EHQ&LBA?@6&?KKEI6A&FMB@@&P6&A6FL?5FEP@6&K?A&BIa4EAE5J&BH&AB5C?D9&P4H&_EHME5&HM6&HED6&A6a4EA6D65HF&?K&LBABJABLM&TBU&?K&HMEF&F4PF6IHE?5&TSNSU9&B&PE?@?JEIB@&F4PFHB5I6&FBDL@6&KA?D&B&LBA?@66N&&7O=:=:87TSNSUT6U&!?A&HM6&L4AL?F6F&?K&F6IHE?5&7O=:=78e9&B&LBA?@66&_M?&A6K4F6F&H?&F4PDEH&H?&IM6DEIB@&H6FHE5J&?K&B&FBDL@6&?K&MEF&?A&M6A&PE?@?JEIB@&F4PFHB5I6&L4AF4B5H&H?&HM6&A6a4EA6D65HF&?K&HMEF&F4PF6IHE?5&TSNSU&EF&C66D6C&H?&MBG6&H6FH6C&L?FEHEG6&K?A&HM6&LA6F65I6&?K&CA4JFN&D)&;$5"-$?&%,E&'FG;H;HIF=JBJC=4C'$(#'=AC'%0'FG;H;HIF=JBJC=&C''$(#'=4C'O'&

CCJJ | Appendices

93

Appendix E: Commission Recommendation FY17-RE01

94


CCJJ | Appendices

95

!"#$"%%&'()*+$ !"#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECDF01BC$$$$$$$$$$$2'G'&H*'$2'IIJ##J'>$'>$2&JIJ>HG$H>*$:=()>JG)$:=#KJL)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$$$$ 7HM)$.$'N$/$

+'./$"#!01.2!!(3345!,67869!4:!-433;<86;3!"83=8:!;:<86!<>8!<=?8!4:!98@<8@A=@B2!!!"8A4??8@7;<=4@!+'./$"#!01.!;%*HK)$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$J>$#KHK=K)$K'O$F$"GG'P$)GJMJQG)$J>*J(J*=HG#$K'$&)R=)#K$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$HNK)&$KS)$KJI)$'N$#)>K)>LJ>M@$$F$1GJIJ>HK)$*=%GJLHKJ()$#KHK=K'&T$GH>M=HM)$&)MH&*J>M$'&*)&#$'N$L'GGHK)&HG$&)GJ)NU$H>*$$F$2&)HK)$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$J>$KS)$2SJG*&)>V#$2'*)W$

1>L'=&HM)$KS)$X=*JLJH&T$K'$*)()G'%$H$I)LSH>J#I$KSHK$PJGG$HGG'P$KS)$J*)>KJNJLHKJ'>$'N$J>#KH>L)#$PS)>$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$H&)$&)R=)#K)*@$M&H>K)*@$'&$*)>J)*W$!C=9AD99=4@!6S)$JI%HLK$'N$H$L&JIJ>HG$L'>(JLKJ'>$'&$H*X=*JLHKJ'>$LH>$Q)$NH&$M&)HK)&$KSH>$KS)$#)>K)>L)$JI%'#)*$QT$KS)$X=*M)W$$9=>*&)*#$'N$N)*)&HG@$#KHK)@$H>*$G'LHG$GHP#$JI%'#)$H**JKJ'>HG$#H>LKJ'>#$H>*$*J#R=HGJNJLHKJ'>#$HNN)LKJ>M$)I%G'TI)>K@$S'=#J>M@$%=QGJL$Q)>)NJK#@$H>*$'KS)&$LJ(JG$&JMSK#$H>*$%&J(JG)M)#WC$$6S)#)$L'GGHK)&HG$L'>#)R=)>L)#$LH>$Q)$*)K&JI)>KHG$K'$J>*J(J*=HG#V$HQJGJKT$K'$G)H*$H$%&'*=LKJ()$L&JI)FN&))$GJN)@A$H>*$LH>$SH()$H$>)MHKJ()$JI%HLK$'>$#'LJ)KT$H#$H$PS'G)WY$$8JIJGH&$K'$IH>T$'KS)&$#KHK)#@Z$2'G'&H*'$HGG'P#$X=*M)#$K'$J##=)$'&*)&#$'N$L'GGHK)&HG$&)GJ)NW$$6S)$'&*)&#$LH>$&)GJ)()$)GJMJQG)$J>*J(J*=HG#$N&'I$I'#K$L'GGHK)&HG$L'>#)R=)>L)#@$PS)>$*'J>M$#'$PJGG$JI%&'()$KS)$J>*J(J*=HGV#$GJ[)GJS''*$'N$#=LL)##N=G$&)J>K)M&HKJ'>$H>*$J#$J>$KS)$%=QGJLV#$J>K)&)#KW\$$6SJ#$I)LSH>J#I$#S'=G*$#)&()$H#$H$(HG=HQG)$K''G$N'&$HGG'PJ>M$#'LJ)KT$K'$%=>J#S$H>*$*)K)&$L&JI)@$PSJG)$#JI=GKH>)'=#GT$HGG'PJ>M$JK#$I)IQ)&#$K'$&)IHJ>$%&'*=LKJ()$LJKJ])>#W^$$$$6S)$L=&&)>K$#KHK=K'&T$I)LSH>J#I$N'&$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$PH#$)>HLK)*$J>$ABCY$H>*$SH#$#J>L)$&)IHJ>)*$=>LSH>M)*WD$$"GKS'=MS$P)GGFJ>K)>KJ'>)*@$JK$SH#$#)()&HG$#S'&KNHGG#$KSHK$GJIJK$KS)$=#)$H>*$)NN)LKJ()>)##$'N$KS)$'&*)&#W$$

C$!""$4H&[$1(H>#@$2'G'W$8KHK)$7=QGJL$5)N)>*)&V#$3NNJL)@$#$"%&'()"*+"(,")%'-%&'(./,0/'(1%!2(,0/'()%3"4'(5%0$"%!"(0"(,"%6(5"7%&'8'725'%92:$_ABCZ$)*W`@$2.2/82;8"%20$L'G'&H*'*)N)>*)&#W=#aL'>#)R=)>L)#F'NFL'>(JLKJ'>FAaL'>#)R=)>L)#F'NFL'>(JLKJ'>FAaW$A$/)KK)&$N&'I$;>JK)*$8KHK)#$"KK'&>)T$b)>)&HG$1&JL$9'G*)&@$:&W@$K'$2'G'&H*'$"KK'&>)T$b)>)&HG$:'S>$8=KS)&#$_"%&JG$Cc@$ABCCÙ$)""%28)'$:W9W$/H=Q$d$0W:W$8HI%#'>$_ABBC`W$;>*)&#KH>*J>M$*)#J#K)>L)$N&'I$L&JI)@%&7/<"%2(5%=+)0/,">%?@ABC>%BDEF$_*'JO$CBWCBcâ^\AABcÙ$.HKJ'>HG$0)#)H&LS$2'=>LJG$_ABBc`@$G27'8">%H")/)0"(,"%-7'<%&7/<">%2(5%&'<<+(/04%I(0"J720/'(@$2'IIJKK))$'>$2'II=>JKT$8=%)&(J#J'>$H>*$5)#J#K)>L)$N&'I$2&JI)$_#))$%%W$AYFAZ$HK$L*%#*'L#W#KHK)WL'W=#aLLXXa0)#'=&L)#a0)Na.20ABBDW%*NÙ$H>*$:W$0H*JL)$_ABCA`@$"*IJ>J#K)&J>M$X=#KJL)O$0)I'(J>M$#KHK=K'&T$QH&&J)&#$K'$&))>K&T@$6(/."7)/04%'-%&'8'725'%92:%K"./":>%cY_Y`@$DC\FDD?$_#))$%W$DC?$HK$L'G'&H*'W)*=aGHPa#JK)#a*)NH=GKaNJG)#a<'GWcYWYW%*N$`W$$$Y$"W$2S&J#KIH>$d$4W.W$0'*&JM=)]$_ABC^@$"=M=#K`W$L2,0%!$""01%K")"27,$%!+MM'70)%L2/7D&$2(,"%G'8/,/")W$6S)$.HKVG$1I%VK$/HP$7&'X)LK$_HK$>)G%W'&MaL'>K)>Ka=%G'H*#a,HJ&F2SH>L)FeH>FKS)Fe'fF0)#)H&LSW%*NÙ$:W$0'Q)&K#$_ABCC`@$gST$IJ#*)I)H>'&#$IHKK)&O$5)NJ>J>M$)NN)LKJ()$H*('LHLT$J>$KS)$G'P)&$L&JIJ>HG$L'=&K#@$6N&N%H2./)%92:%K"./":@$OP_A`@$ADDFYDA$_#))$%%W$YBBFYBC$HK$GHP&)(J)PWGHPW=L*H(J#W)*=aJ##=)#aZ\aAa"&KJLG)#aZ\FAh:)>>Th0'Q)&K#W%*NÙ$:W$8LSIJKK$d$iW$gH&>)&$_ABCB`@$QRDS--"(5"7)%2(5%0$"%92;'7%T27U"0>$2)>K)&$N'&$1L'>W$d$7'GJLT$0)#)H&LS$_HK$L)%&W>)Ka*'L=I)>K#a%=QGJLHKJ'>#a)fF'NN)>*)&#FABCBFCCW%*N`W$Z$2'>>W$b)>W$8KHKW$j$\ZFCYB)_QÙ$DYB$-GGW$2'I%W$8KHKW$">>W$\a\F\W\FC\U$.WEW$2'&&)LKW$/HP$jj$DBB$K'$DBÛ$.W2W$b)>W$8KHKW$j$C\"FCDYWAU$3SJ'W$0)(W$2'*)$">>W$j$A?\YWA\W$$$\$jj$CcFCWYFCBD@$CcFCWYFACY@$CcFCWYFYBY@$2W0W8W$ABC^W$^$4W$2W$/'()$_ABCC@$8%&J>M`@$7HTJ>M$KS)J&$*)QK$K'$#'LJ)KTO$,'&MJ()>)##@$&)*)I%KJ'>@$H>*$KS)$;>JN'&I$2'GGHK)&HG$2'>#)R=)>L)#$'N$2'>(JLKJ'>$"LK@$V':275%92:%='+7(28@$PO_Y`@$D\YFD?Y$_#))$%W$D^BFD^Z@$HK$GHPWS'PH&*W)*=a#JK)#a*)NH=GKaNJG)#a&)GHK)*F*'P>G'H*#aS'Ph\ZhYW%*Nk%HM)lA^CÙ$0H*JL)@$)+M72$>'K)$A@$HK$%%W$DADFDYAW$$$D$2SW$Ac?@$#)LW$CC@$j$CcFCWYFCBD@$ABCY$2'G'W$8)##W$/HP#$C\ZcU$2SW$Ac?@$#)LW$CA@$j$CcFCWYFACY@$ABCY$2'G'W$8)##W$/HP#$C\\BU$2SW$Ac?@$#)LW$CY@$j$CcFCWYFYBY@$ABCY$2'G'W$8)##W$/HP#$C\\YW$

96


!"#$"%%&'()*+$ !"#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECDF01BC$$$$$$$$$$$2'G'&H*'$2'IIJ##J'>$'>$2&JIJ>HG$H>*$:=()>JG)$:=#KJL)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$$$$ 7HM)$E$'N$/$

,J&#K@$L'=&K#$L=&&)>KGT$LH>$J##=)$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$'>GT$HK$KS)$KJI)$H>$J>*J(J*=HG$J#$#)>K)>L)*Wc$$6SJ#$LH>$NHLJGJKHK)$#=LL)##$N'&$%)'%G)$PS'$H&)$&)R=J&)*$K'$#)&()$KS)J&$#)>K)>L)$J>$KS)$L'II=>JKTW$$6S)$'&*)&#$LH>$%&'(J*)$>'$H##J#KH>L)@$S'P)()&@$N'&$%)'%G)$PS'$H&)$HKK)I%KJ>M$K'$Q)KK)&$KS)J&$GJ()#$H>*$I'()$Q)T'>*$KS)$L'GGHK)&HG$L'>#)R=)>L)#$'N$H$L'>(JLKJ'>$HNK)&$KS)J&$#)>K)>L)$SH#$Q))>$L'I%G)K)*W$$8)L'>*@$KS)$L=&&)>K$#KHK=K'&T$#LS)I)$)fLG=*)#$H$#=LL)##N=GGT$L'I%G)K)*$*)N)&&)*$X=*MI)>K$H>*$#)>K)>L)$_5:8`$N&'I$KS)$*)NJ>JKJ'>$'N$mL'>(JLKJ'>Wn?$$9)>L)@$H>$J>*J(J*=HG$PS'$SH#$#=LL)##N=GGT$L'I%G)K)*$H$5:8$J#$J>)GJMJQG)$N'&$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)NW$$"$#=LL)##N=GGT$L'I%G)K)*$5:8$LH>@$S'P)()&@$SH()$G'>M$GH#KJ>M$L'GGHK)&HG$L'>#)R=)>L)#$J>$GJL)>#=&)@$)I%G'TI)>K@$H>*$'KS)&$H&)H#WCB$$6SJ&*@$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$H&)$L=&&)>KGT$=>H(HJGHQG)$N'&$X=()>JG)$H*X=*JLHKJ'>#W$$"*X=*JLHKJ'>#$LH>@$S'P)()&@$#KJGG$&)#=GK$J>$KS)$JI%'#JKJ'>$'N$L'GGHK)&HG$L'>#)R=)>L)#WCC$$,J>HGGT@$KS)$X=*JLJH&T$*')#$>'K$L'>#J#K)>KGT$K&HL[$PS)>$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$H&)$&)R=)#K)*$'&$M&H>K)*WCA$$6SJ#$GHL[$'N$*HKH$&)>*)&#$JK$(J&K=HGGT$JI%'##JQG)$K'$*)K)&IJ>)$PS)KS)&$KS)$'&*)&#$H&)$#)&(J>M$KS)J&$J>K)>*)*$%=&%'#)W$$$$&>=9!68A4??8@7;<=4@!=@A3D789!4@8!@4@$9<;<D<46F!838?8@<G!!.2!!&6;AH!467869!4:!A433;<86;3!683=8:2$$6S)&)$J#$L=&&)>KGT$#%H&#)$*HKH$'>$PS)>$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$H&)$&)R=)#K)*@$M&H>K)*@$'&$*)>J)*W$$gSJG)$H$L'*)$L=&&)>KGT$)fJ#K#$J>$KS)$X=*JLJH&TV#$LH#)$IH>HM)I)>K$#T#K)I$K'$LH%K=&)$PS)>$'&*)&#$H&)$M&H>K)*$_23/0`@$KSJ#$L'*)$J#$>'K$&)GJHQGT$=#)*$N'&$JK#$J>K)>*)*$%=&%'#)W$$"**JKJ'>HGGT@$H%%GJLHKJ'>#$N'&$L'GGHK)&HG$&)GJ)N$H&)$LH%K=&)*$=#J>M$KS)$M)>)&JL$I'KJ'>$'&$%)KJKJ'>$L'*)#W$$-N$>'$&)GJ)N$J#$M&H>K)*@$KSJ#$J#$LH%K=&)*$'>GT$J>$H$IJ>=K)$'&*)&W$$-K$J#$KS=#$*JNNJL=GK$K'$I)H#=&)$S'P$'NK)>$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$H&)$Q)J>M$=#)*$H>*$KS)$#L'%)$'N$KS)J&$)NN)LKJ()>)##W$$22::$&)L'II)>*#$KSHK$KS)$X=*JLJH&T$*)()G'%$H$I)LSH>J#I$KSHK$PJGG$HGG'P$JK$K'$)H#JGT$J*)>KJNT$PS)>$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$H&)$&)R=)#K)*@$M&H>K)*@$'&$*)>J)*W$$&>=9!68A4??8@7;<=4@!=@A3D789!<>688!9<;<D<46F!838?8@<9!I783=@8;<87!J8345KG!!.2!!(?8@7!98A<=4@!.L$.2M$.1/2!E2!!#3=?=@;<8!7DN3=A;<=O8!9<;<D<892!M2!!#9<;J3=9>!;@!8PD=O;38@<!?8A>;@=9?!;9!98A<=4@!.Q$E$QE/!4:!<>8!->=3768@R9!-4782!!!!

c$jj$CcFCWYFCBD_C`@$CcFCWYFACY_C`@$CcFCWYFYBY_C`@$2W0W8W$ABC^W$?$jj$CcFCWYFCBD_c`_L`@$CcFCWYFACY_c`_L`@$CcFCWYFYBY_c`_L`@$2W0W8W$ABC^W$CB$!"">%"NJN@$j$AZF\FCBC_Y`_*`@$2W0W8W$ABC^W$CC$!""$4H&[$1(H>#@$2'G'W$8KHK)$7=QGJL$5)N)>*)&V#$3NNJL)@$#$"%&'()"*+"(,")%'-%W5X+5/,20/'(1%!2(,0/'()%3"4'(5%0$"%!"(0"(,"%-'7%=+."(/8")%6(5"7%&'8'725'%92:$_ABCZ`@$2.2/82;8"%20$L'G'&H*'*)N)>*)&#W=#aL'>#)R=)>L)#F'NFL'>(JLKJ'>FAaL'>#)R=)>L)#F'NFX=()>JG)FH*X=*JLHKJ'>aW$$CA$8S)&&J$9=NN'&*@$2'G'&H*'$5J(J#J'>$'N$7&'QHKJ'>$8)&(JL)#@$%&)#)>KHKJ'>$K'$KS)$22::$2'GGHK)&HG$2'>#)R=)>L)#$g'&[J>M$b&'=%$_"=MW$CB@$ABC^`W$

CCJJ | Appendices

97

!"#$"%%&'()*+$ !"#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECDF01BC$$$$$$$$$$$2'G'&H*'$2'IIJ##J'>$'>$2&JIJ>HG$H>*$:=()>JG)$:=#KJL)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$$$$ 7HM)$M$'N$/$

S64N4987!)<;<D<46F!T;@BD;B8!!6S)#)$LSH>M)#$P'=G*$HGG'P$L'=&K#$K'$M&H>K$'&*)&#$'N$L'GGHK)&HG$&)GJ)N$HNK)&$KS)$KJI)$'N$#)>K)>LJ>M@$PS)>$*'J>M$#'$P'=G*$JI%&'()$H>$J>*J(J*=HGV#$GJ[)GJS''*$'N$#=LL)##N=GGT$&)J>K)M&HKJ>M$J>K'$#'LJ)KT$H>*$J#$J>$KS)$%=QGJLV#$J>K)&)#KW$$6S)T$P'=G*$HGG'P$#JIJGH&$'&*)&#$N'&$%)'%G)$H*X=*JLHK)*$N'&$H$X=()>JG)$'NN)>#)W$$6S)$LSH>M)#$P'=G*$>'K$HGK)&$L=&&)>KGTF)fJ#KJ>M$)GJMJQJGJKT$)fLG=#J'>#$QH#)*$'>$H>$J>*J(J*=HGV#$KT%)$'N$'NN)>#)@$*'$>'K$)f%H>*$KS)$KT%)#$'N$L'>#)R=)>L)#$K'$PSJLS$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$LH>$H%%GT@$H>*$*'$>'K$LSH>M)$KS)$#KH>*H&*$N'&$M&H>KJ>M$&)GJ)NW$$6S)T$#JI%GT$IH[)$KSJ#$K''G$H(HJGHQG)$K'$)GJMJQG)$J>*J(J*=HG#$PS'@$HNK)&$KS)$KJI)$'N$#)>K)>LJ>M@$H&)$HKK)I%KJ>M$K'$'QKHJ>$KS)$X'Q#@$S'=#J>M@$'&$Q)>)NJK#$KS)T$>))*$K'$Q)$%&'*=LKJ()$I)IQ)&#$'N$#'LJ)KTW$$$$.2!!(?8@7!98A<=4@!.L$.2M$.1/!;9!:4334592!$

_C`$"K$KS)$KJI)$H$*)N)>*H>K$)>K)&#$J>K'$(!)#%&#%-#!,"!(&!(%'!&UV#!&W#"#(+&#"$H>$HGK)&>HKJ()$K'$#)>K)>LJ>M$J>$KSJ#$%H&K$C@$=%'>$KS)$&)R=)#K$'N$KS)$*)N)>*H>K$'&$=%'>$KS)$L'=&Ko#$'P>$I'KJ'>@$H$L'=&K$IHT$)>K)&$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$U%!&W#!-"UVU%(T!-()#$N'&$KS)$%=&%'#)$'N$%&)#)&(J>M$'&$)>SH>LJ>M$KS)$*)N)>*H>Ko#$)I%G'TI)>K$'&$)I%G'TI)>K$%&'#%)LK#$H>*$K'$JI%&'()$KS)$*)N)>*H>Ko#$GJ[)GJS''*$'N$#=LL)##$J>$KS)$-,VVX%U&'W$HGK)&>HKJ()$K'$#)>K)>LJ>M$%&'M&HIW$$_A`$(NN3=A;<=4@!A4@<8@<92$_H`$">$H%%GJLHKJ'>$N'&$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$I=#K$LJK)$KS)$M&'=>*#$N'&$M&H>KJ>M$KS)$&)GJ)N@$KS)$KT%)$'N$&)GJ)N$#'=MSK@$H>*$KS)$#%)LJNJL$L'GGHK)&HG$L'>#)R=)>L)$N&'I$PSJLS$KS)$H%%GJLH>K$J#$#))[J>M$&)GJ)N$H>*$I=#K$J>LG=*)$H$L'%T$'N$H$&)L)>K$2'G'&H*'$Q=&)H=$'N$J>()#KJMHKJ'>$NJ>M)&%&J>KFQH#)*$L&JIJ>HG$SJ#K'&T$&)L'&*#$LS)L[W$6S)$#KHK)$L'=&K$H*IJ>J#K&HK'&$IHT$%&'*=L)$H>$H%%GJLHKJ'>$N'&I$KSHK$H>$H%%GJLH>K$IHT$#=QIJK$J>$H%%GJLHKJ'>W$_Q`$6S)$H%%GJLH>K$#SHGG$%&'(J*)$H$L'%T$'N$KS)$H%%GJLHKJ'>$K'$KS)$*J#K&JLK$HKK'&>)T$H>*$K'$KS)$&)M=GHK'&T$'&$GJL)>#J>M$Q'*T$KSHK$SH#$X=&J#*JLKJ'>$'()&$KS)$L'GGHK)&HG$L'>#)R=)>L)$N&'I$PSJLS$KS)$H%%GJLH>K$J#$#))[J>M$&)GJ)N@$JN$H>T@$QT$L)&KJNJ)*$IHJG$'&$%)&#'>HG$#)&(JL)$PJKSJ>$K)>$*HT#$HNK)&$NJGJ>M$KS)$H%%GJLHKJ'>$PJKS$KS)$L'=&KW$I-K!(%'!(SSTU-(&U,%!+UT#C!(+&#"!(!)#%&#%-#!W()!Y##%!UVS,)#C!)W(TT!U%-TXC#!(!-,S'!,+!(!"#-#%&!-,T,"(C,!YX"#(X!,+!U%Z#)&U[(&U,%!+U%[#"S"U%&$Y()#C!-"UVU%(T!WU)&,"'!"#-,"C)!-W#-*\!&W#!+UTU%[!+##!"#]XU"#C!Y'!T(^\!(%C!(%!(CCU&U,%(T!+UTU%[!+##!,+!_U%)#"&!(V,X%&`!C,TT(")!&,!-,Z#"!&W#!(-&X(T!-,)&)!"#T(&#C!&,!&W#!(SSTU-(&U,%2!+UTU%[!+##)!("#!)XYa#-&!&,!^(UZ#"!XS,%!(!+U%CU%[!&W(&!&W#!(SSTU-(%&!U)!U%CU[#%&2!$_Y`$">$'&*)&$'N$L'GGHK)&HG$&)GJ)N$IHT$&)GJ)()$H$*)N)>*H>K$'N$H>T$L'GGHK)&HG$L'>#)R=)>L)#$'N$KS)$L'>(JLKJ'>@$PS)KS)&$J>$S'=#J>M$'&$)I%G'TI)>K$QH&&J)&#$'&$H>T$'KS)&$#H>LKJ'>$'&$*J#R=HGJNJLHKJ'>$KSHK$KS)$L'=&K$#SHGG$#%)LJNT@$J>LG=*J>M$Q=K$>'K$GJIJK)*$K'$#KHK=K'&T@$&)M=GHK'&T@$'&$'KS)&$L'GGHK)&HG$L'>#)R=)>L)#$KSHK$KS)$L'=&K$IHT$#))$NJK$K'$&)GJ)()$KSHK$PJGG$H##J#K$KS)$*)N)>*H>K$J>$"#U%&#["(&U%[!U%&,!&W#!-,VVX%U&'W$#=LL)##N=GGT$L'I%G)KJ>M$%&'QHKJ'>$'&$H$L'II=>JKT$L'&&)LKJ'>#$#)>K)>L)W$$

98


!"#$"%%&'()*+$ !"#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECDF01BC$$$$$$$$$$$2'G'&H*'$2'IIJ##J'>$'>$2&JIJ>HG$H>*$:=()>JG)$:=#KJL)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$$$$ 7HM)$b$'N$/$

_Z`_H`$.'KPJKS#KH>*J>M$H>T$'KS)&$%&'(J#J'>$'N$GHP@$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$LH>>'K$&)GJ)()$H>T$L'GGHK)&HG$L'>#)R=)>L)#$JI%'#)*$QT$GHP$N'&$GJL)>#=&)$QT$KS)$*)%H&KI)>K$'N$)*=LHKJ'>$'&$H>T$L'GGHK)&HG$L'>#)R=)>L)#$JI%'#)*$QT$GHP$N'&$)I%G'TI)>K$PJKS$KS)$X=*JLJHG$Q&H>LS@$KS)$*)%H&KI)>K$'N$L'&&)LKJ'>#@$*J(J#J'>$'N$T'=KS$L'&&)LKJ'>#$J>$KS)$*)%H&KI)>K$'N$S=IH>$#)&(JL)#@$'&$H>T$'KS)&$GHP$)>N'&L)I)>K$HM)>LT$J>$KS)$#KHK)$'N$2'G'&H*'W$_Q`$"$L'=&K$#SHGG$>'K$J##=)$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$JN$KS)$*)N)>*H>KO$_-`$9H#$Q))>$L'>(JLK)*$'N$H$N)G'>T$KSHK$J>LG=*)*$H>$)G)I)>K$KSHK$&)R=J&)#$H$(JLKJI$K'$#=NN)&$%)&IH>)>K$*J#HQJGJKTU$_--`$9H#$Q))>$L'>(JLK)*$'N$H$L&JI)$'N$(J'G)>L)$H#$*)#L&JQ)*$J>$#)LKJ'>$CcFCWYFZBÛ$'&$_---`$-#$&)R=J&)*$K'$&)MJ#K)&$H#$H$#)f$'NN)>*)&$%=&#=H>K$K'$#)LKJ'>$C^FAAFCBY@$2W0W8W$$_\`$W8;6=@B2$_H`$6S)$L'=&K$IHT$L'>*=LK$H$S)H&J>M$,%!(%'!V(&&#"!"#T#Z(%&!&,!&W#!["(%&U%[!,"!C#%'U%[!,+!&W#!(SSTU-(&U,%$'&$J>LG=*)$H$S)H&J>M$'>$KS)$IHKK)&$HK$KS)$*)N)>*H>Ko#$#)>K)>LJ>M$S)H&J>M\$'>$KS)$H%%GJLHKJ'>$'&$'>$H>T$IHKK)&$&)G)(H>K$K'$KS)$M&H>KJ>M$'&$*)>TJ>M$'N$KS)$H%%GJLHKJ'>$H>*$IHT$KH[)$K)#KJI'>T$=>*)&$'HKSW$_Q`$6S)$L'=&K$IHT$S)H&$K)#KJI'>T$N&'I$(JLKJI#$'&$H>T$%&'%'>)>K$'&$'%%'>)>K$'N$KS)$H%%GJLHKJ'>$H>*$IHT$S)H&$H&M=I)>K$N&'I$KS)$%)KJKJ'>)&$H>*$KS)$*J#K&JLK$HKK'&>)TW$$_^`$)<;@7;67!:46!B6;@<=@B!683=8:2$_H`$"$L'=&K$IHT$J##=)$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$JN$KS)$L'=&K$NJ>*#$KSHKO$_-`$6S)$'&*)&$'N$L'GGHK)&HG$&)GJ)N$J#$L'>#J#K)>K$PJKS$KS)$H%%GJLH>Ko#$&)SHQJGJKHKJ'>U$H>*$_--`$b&H>KJ>M$KS)$H%%GJLHKJ'>$P'=G*$JI%&'()$KS)$H%%GJLH>Ko#$GJ[)GJS''*$'N$#=LL)##$J>$&)J>K)M&HKJ>M$J>K'$#'LJ)KT$H>*$J#$J>$KS)$%=QGJLo#$J>K)&)#KW$_Q`$6S)$L'=&K$KSHK$%&)(J'=#GT$J##=)*$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N@$'>$JK#$'P>$I'KJ'>$'&$)JKS)&$QT$LH=#)$#S'P>$QT$KS)$*J#K&JLK$HKK'&>)T$'&$'>$M&'=>*#$'NN)&)*$QT$KS)$H%%GJLH>K@$IHT$HK$H>T$KJI)$J##=)$H$#=Q#)R=)>K$X=*MI)>K$K'$)>GH&M)@$GJIJK@$'&$LJ&L=I#L&JQ)$KS)$&)GJ)N$%&)(J'=#GT$M&H>K)*W$_L`$;%'>$KS)$I'KJ'>$'N$KS)$*J#K&JLK$HKK'&>)T$'&$%&'QHKJ'>$'NNJL)&$'&$=%'>$KS)$L'=&Ko#$'P>$I'KJ'>@$H$L'=&K$IHT$&)('[)$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$=%'>$)(J*)>L)$'N$H$#=Q#)R=)>K$L&JIJ>HG$L'>(JLKJ'>$'&$%&''N$KSHK$KS)$*)N)>*H>K$J#$>'$G'>M)&$)>KJKG)*$K'$&)GJ)NW$">T$QH&#@$%&'SJQJKJ'>#@$#H>LKJ'>#@$H>*$*J#R=HGJNJLHKJ'>#$KS)&)QT$&)GJ)()*$V('$#SHGG$Q)$&)J>#KHK)*$H#$'N$KS)$*HK)$'N$KS)$P&JKK)>$'&*)&$'N$&)('LHKJ'>W$6S)$L'=&K$#SHGG$%&'(J*)$H$L'%T$'N$KS)$'&*)&$'N$&)('LHKJ'>$K'$KS)$S'G*)&$H>*$K'$H>T$&)M=GHK'&T$'&$GJL)>#J>M$)>KJKT$KSHK$KS)$*)N)>*H>K$>'KJL)*$J>$SJ#$'&$S)&$I'KJ'>$N'&$&)GJ)NW$$_D`$-N$KS)$L'=&K$J##=)#$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N@$JK$#SHGG$#)>*$H$L'%T$'N$KS)$'&*)&$'N$L'GGHK)&HG$&)GJ)N$KS&'=MS$KS)$2'G'&H*'$J>K)M&HK)*$L&JIJ>HG$X=#KJL)$J>N'&IHKJ'>$#T#K)I$K'$KS)$2'G'&H*'$Q=&)H=$'N$J>()#KJMHKJ'>@$H>*$KS)$2'G'&H*'$Q=&)H=$'N$J>()#KJMHKJ'>$#SHGG$>'K)$J>$KS)$H%%GJLH>Ko#$&)L'&*$J>$KS)$2'G'&H*'$L&JI)$J>N'&IHKJ'>$L)>K)&$KSHK$KS)$'&*)&$'N$L'GGHK)&HG$&)GJ)N$PH#$J##=)*W$$_c`$C8:=@=<=4@92$"#$=#)*$J>$KSJ#$#)LKJ'>@$=>G)##$KS)$L'>K)fK$'KS)&PJ#)$&)R=J&)#O$_H`$m2'GGHK)&HG$L'>#)R=)>L)n$I)H>#$H$L'GGHK)&HG$#H>LKJ'>$'&$H$*J#R=HGJNJLHKJ'>W$

CCJJ | Appendices

99

!"#$"%%&'()*+$ !"#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECDF01BC$$$$$$$$$$$2'G'&H*'$2'IIJ##J'>$'>$2&JIJ>HG$H>*$:=()>JG)$:=#KJL)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$$$$ 7HM)$c$'N$/$

_Q`$m2'GGHK)&HG$#H>LKJ'>n$I)H>#$H$%)>HGKT@$%&'SJQJKJ'>@$QH&@$'&$*J#H*(H>KHM)@$S'P)()&$*)>'IJ>HK)*@$JI%'#)*$'>$H>$J>*J(J*=HG$H#$H$&)#=GK$'N$KS)$J>*J(J*=HGo#$L'>(JLKJ'>$'N$H>$'NN)>#)@$PSJLS$%)>HGKT@$%&'SJQJKJ'>@$QH&@$'&$*J#H*(H>KHM)$H%%GJ)#$QT$'%)&HKJ'>$'N$GHP$&)MH&*G)##$'N$PS)KS)&$KS)$%)>HGKT@$%&'SJQJKJ'>@$QH&@$'&$*J#H*(H>KHM)$J#$J>LG=*)*$J>$KS)$X=*MI)>K$'&$#)>K)>L)W$m2'GGHK)&HG$#H>LKJ'>n$*')#$>'K$J>LG=*)$JI%&J#'>I)>K@$%&'QHKJ'>@$%H&'G)@$#=%)&(J#)*$&)G)H#)@$N'&N)JK=&)@$&)#KJK=KJ'>@$NJ>)@$H##)##I)>K@$L'#K#$'N$%&'#)L=KJ'>@$'&$H$&)#K&HJ>K$'&$#H>LKJ'>$'>$H>$J>*J(J*=HGo#$*&J(J>M$%&J(JG)M)W$_L`$+,"!SX"S,)#)!,+!&WU)!)#-&U,%\!mA'>(JLKJ'>n$'&$mL'>(JLK)*n$I)H>#$H$()&*JLK$'N$M=JGKT$QT$H$X=*M)$'&$X=&T$'&$H$%G)H$'N$M=JGKT$'&$>'G'$L'>K)>*)&)$KSHK$J#$HLL)%K)*$QT$KS)$L'=&K$'&$H$L'>(JLKJ'>$'N$H$L&JI)$=>*)&$KS)$GHP#$'N$H>T$'KS)&$#KHK)@$KS)$;>JK)*$8KHK)#@$'&$H>T$K)&&JK'&T$#=QX)LK$K'$KS)$X=&J#*JLKJ'>$'N$KS)$;>JK)*$8KHK)#@$PSJLS@$JN$L'IIJKK)*$PJKSJ>$KSJ#$#KHK)@$P'=G*$Q)$H$-"UV#W$N)G'>T$'&$IJ#*)I)H>'&W$m2'>(JLKJ'>n$'&$mL'>(JLK)*n$HG#'$J>LG=*)#$SH(J>M$&)L)J()*$H$*)N)&&)*$X=*MI)>K$H>*$#)>K)>L)W$U$)fL)%K$KSHK$H$%)&#'>$#SHGG$>'K$Q)$*))I)*$K'$SH()$Q))>$L'>(JLK)*$JN$KS)$%)&#'>$SH#$#=LL)##N=GGT$L'I%G)K)*$H$*)N)&&)*$#)>K)>L)W$_*`$m5J#R=HGJNJLHKJ'>n$I)H>#$H$%)>HGKT@$%&'SJQJKJ'>@$QH&@$'&$*J#H*(H>KHM)@$S'P)()&$*)>'IJ>HK)*@$KSHK$H>$H*IJ>J#K&HKJ()$HM)>LT@$M'()&>I)>KHG$'NNJLJHG@$'&$L'=&K$J>$H$LJ(JG$%&'L))*J>M$J#$H=KS'&J])*@$Q=K$>'K$&)R=J&)*@$K'$JI%'#)$'>$H>$J>*J(J*=HG$'>$M&'=>*#$&)GHKJ>M$K'$KS)$J>*J(J*=HGo#$L'>(JLKJ'>$'N$H>$'NN)>#)W$

$E2!!#3=?=@;<8!7DN3=A;<=O8!9<;<D<892!gS)>$KS)$b)>)&HG$"##)IQGT$L&)HK)*$'&*)&#$'N$L'GGHK)&HG$&)GJ)N@$JK$)>HLK)*$#=Q#KH>KJ()GT$*=%GJLHKJ()$#KHK=K)#$J>$%H&K#$C@$A@$H>*$Y$'N$H&KJLG)$CWY$'N$KJKG)$CcW$$7&)#=IHQGT$KS)$G)MJ#GHK=&)V#$J>K)>K$PH#$K'$)>#=&)$KS)$'&*)&#$P)&)$H(HJGHQG)$PS)>$)GJMJQG)$*)N)>*H>K#$P)&)$Q)J>M$#)>K)>L)*$K'$%&'QHKJ'>@$L'II=>JKT$L'&&)LKJ'>#@$'&$H>'KS)&$HGK)&>HKJ()$J>$#)>K)>LJ>MW$$-N$KS)$LSH>M)#$%&'%'#)*$HQ'()$H&)$)>HLK)*$QT$KS)$G)MJ#GHK=&)@$'KS)&PJ#)$)GJMJQG)$*)N)>*H>K#$PJGG$Q)$HQG)$K'$'QKHJ>$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$HNK)&$KS)$JI%'#JKJ'>$'N$H>T$KT%)$'N$#)>K)>L)W$$22::$&)L'II)>*#$KS)$&)%)HG$'N$#)LKJ'>#$CcFCWYFACY$H>*$CcFCWYFYBY@$Q)LH=#)$KS)#)$*=%GJLHKJ()$%&'(J#J'>#$PJGG$>'$G'>M)&$Q)$>)L)##H&TW$$!$M2!!#9<;J3=9>!;@!8PD=O;38@<!?8A>;@=9?!;9!98A<=4@!.Q$E$QE/!4:!<>8!->=3768@R9!-4782!3&*)&#$'N$L'GGHK)&HG$&)GJ)N$#S'=G*$Q)$H(HJGHQG)$K'$)GJMJQG)$J>*J(J*=HG#$PS'$H&)$#=QX)LK$K'$L'GGHK)&HG$L'>#)R=)>L)#$&)#=GKJ>M$N&'I$H$X=()>JG)$H*X=*JLHKJ'>W$$22::$&)L'II)>*#$)>HLKJ>M$#)LKJ'>$C?FAF?AD$K'$NHLJGJKHK)$KS)J&$H(HJGHQJGJKTW$6S)$%&'%'#)*$K)fK$'N$@85!98A<=4@!.Q$E$QE/$PH#$L&)HK)*$QT$HLL)%KJ>M$HGG$%&'%'#)*$LSH>M)#$K'$#)LKJ'>$CcFCWYFCBD@$KS)>$I'*JNTJ>M$JK$K'$H%%GT$K'$X=()>JG)$H*X=*JLHKJ'>#W$$!$

_C`$"K$KS)$KJI)$H>$J>*J(J*=HG$H*X=*JLHK)*$H#$H$X=()>JG)$)>K)&#$J>K'$H$#)>K)>L)$'&$HK$H>T$KJI)$KS)&)HNK)&@$=%'>$KS)$&)R=)#K$'N$KS)$H*X=*JLHK)*$X=()>JG)$'&$=%'>$KS)$L'=&Ko#$'P>$I'KJ'>@$H$L'=&K$IHT$)>K)&$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$J>$KS)$X=()>JG)$LH#)$N'&$KS)$%=&%'#)$'N$JI%&'(J>M$KS)$H*X=*JLHK)*$X=()>JG)o#$GJ[)GJS''*$'N$#=LL)##$J>$KS)$L'II=>JKTW$$_A`$(NN3=A;<=4@!A4@<8@<92$_H`$">$H%%GJLHKJ'>$N'&$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$I=#K$LJK)$KS)$M&'=>*#$N'&$M&H>KJ>M$KS)$&)GJ)N@$KS)$KT%)$'N$&)GJ)N$#'=MSK@$H>*$KS)$#%)LJNJL$L'GGHK)&HG$L'>#)R=)>L)$N&'I$PSJLS$KS)$H%%GJLH>K$J#$#))[J>M$&)GJ)N$H>*$I=#K$J>LG=*)$H$L'%T$'N$H$&)L)>K$L&JIJ>HG$SJ#K'&T$&)L'&*#$LS)L[W$6S)$#KHK)$L'=&K$H*IJ>J#K&HK'&$IHT$%&'*=L)$H>$H%%GJLHKJ'>$N'&I$KSHK$H>$H%%GJLH>K$IHT$#=QIJK$J>$H%%GJLHKJ'>W$

100


!"#$"%%&'()*+$ !"#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECDF01BC$$$$$$$$$$$2'G'&H*'$2'IIJ##J'>$'>$2&JIJ>HG$H>*$:=()>JG)$:=#KJL)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$$$$ 7HM)$d$'N$/$

_Q`$6S)$H%%GJLH>K$#SHGG$%&'(J*)$H$L'%T$'N$KS)$H%%GJLHKJ'>$K'$KS)$*J#K&JLK$HKK'&>)T$H>*$K'$KS)$&)M=GHK'&T$'&$GJL)>#J>M$Q'*T$KSHK$SH#$X=&J#*JLKJ'>$'()&$KS)$L'GGHK)&HG$L'>#)R=)>L)$N&'I$PSJLS$KS)$H%%GJLH>K$J#$#))[J>M$&)GJ)N@$JN$H>T@$QT$L)&KJNJ)*$IHJG$'&$%)&#'>HG$#)&(JL)$PJKSJ>$K)>$*HT#$HNK)&$NJGJ>M$KS)$H%%GJLHKJ'>$PJKS$KS)$L'=&KW$_L`$">T$H%%GJLHKJ'>$NJG)*$HNK)&$H$#)>K)>L)$SH#$Q))>$JI%'#)*$#SHGG$J>LG=*)$H$L'%T$'N$H$&)L)>K$2'G'&H*'$Q=&)H=$'N$J>()#KJMHKJ'>$NJ>M)&%&J>KFQH#)*$L&JIJ>HG$SJ#K'&T$&)L'&*#$LS)L[@$KS)$NJGJ>M$N))$&)R=J&)*$QT$GHP@$H>*$H>$H**JKJ'>HG$NJGJ>M$N))$'N$!J>#)&K$HI'=>K+$*'GGH&#$K'$L'()&$KS)$HLK=HG$L'#K#$&)GHK)*$K'$KS)$H%%GJLHKJ'>W$,JGJ>M$N))#$H&)$#=QX)LK$K'$PHJ()&$=%'>$H$NJ>*J>M$KSHK$KS)$H%%GJLH>K$J#$J>*JM)>KW$$_Y`$">$'&*)&$'N$L'GGHK)&HG$&)GJ)N$IHT$&)GJ)()$H>$H*X=*JLHK)*$X=()>JG)$'N$H>T$L'GGHK)&HG$L'>#)R=)>L)#$'N$KS)$H*X=*JLHKJ'>@$PS)KS)&$J>$S'=#J>M$'&$)I%G'TI)>K$QH&&J)&#$'&$H>T$'KS)&$#H>LKJ'>$'&$*J#R=HGJNJLHKJ'>$KSHK$KS)$L'=&K$#SHGG$#%)LJNT@$J>LG=*J>M$Q=K$>'K$GJIJK)*$K'$#KHK=K'&T@$&)M=GHK'&T@$'&$'KS)&$L'GGHK)&HG$L'>#)R=)>L)#$KSHK$KS)$L'=&K$IHT$#))$NJK$K'$&)GJ)()$KSHK$PJGG$H##J#K$KS)$H*X=*JLHK)*$X=()>JG)$J>$#=LL)##N=GGT$&)J>K)M&HKJ>M$J>K'$KS)$L'II=>JKTW$$_Z`_H`$.'KPJKS#KH>*J>M$H>T$'KS)&$%&'(J#J'>$'N$GHP@$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$LH>>'K$&)GJ)()$H>T$L'GGHK)&HG$L'>#)R=)>L)#$JI%'#)*$QT$GHP$N'&$GJL)>#=&)$QT$KS)$*)%H&KI)>K$'N$)*=LHKJ'>$'&$H>T$L'GGHK)&HG$L'>#)R=)>L)#$JI%'#)*$QT$GHP$N'&$)I%G'TI)>K$PJKS$KS)$X=*JLJHG$Q&H>LS@$KS)$*)%H&KI)>K$'N$L'&&)LKJ'>#@$*J(J#J'>$'N$T'=KS$L'&&)LKJ'>#$J>$KS)$*)%H&KI)>K$'N$S=IH>$#)&(JL)#@$'&$H>T$'KS)&$GHP$)>N'&L)I)>K$HM)>LT$J>$KS)$#KHK)$'N$2'G'&H*'W$_Q`$"$L'=&K$#SHGG$>'K$J##=)$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$JN$KS)$H*X=*JLHK)*$X=()>JG)O$_-`$9H#$Q))>$H*X=*JLHK)*$N'&$H$N)G'>T$KSHK$J>LG=*)*$H>$)G)I)>K$KSHK$&)R=J&)#$H$(JLKJI$K'$#=NN)&$%)&IH>)>K$*J#HQJGJKTU$_--`$9H#$Q))>$H*X=*JLHK)*$N'&$H$L&JI)$'N$(J'G)>L)$H#$*)#L&JQ)*$J>$#)LKJ'>$CcFCWYFZBÛ$'&$_---`$-#$&)R=J&)*$K'$&)MJ#K)&$H#$H$#)f$'NN)>*)&$%=&#=H>K$K'$#)LKJ'>$C^FAAFCBY@$2W0W8W$$_\`$W8;6=@B2$_H`$6S)$L'=&K$IHT$L'>*=LK$H$S)H&J>M$'>$H>T$IHKK)&$&)G)(H>K$K'$KS)$M&H>KJ>M$'&$*)>TJ>M$'N$KS)$H%%GJLHKJ'>@$'&$J>LG=*)$H$S)H&J>M$'>$KS)$IHKK)&$HK$KS)$X=()>JG)o#$#)>K)>LJ>M$S)H&J>M@$H>*$IHT$KH[)$K)#KJI'>T$=>*)&$'HKSW$_Q`$6S)$L'=&K$IHT$S)H&$K)#KJI'>T$N&'I$(JLKJI#$'&$H>T$%&'%'>)>K$'&$'%%'>)>K$'N$KS)$H%%GJLHKJ'>$H>*$IHT$S)H&$H&M=I)>K$N&'I$KS)$%)KJKJ'>)&$H>*$KS)$*J#K&JLK$HKK'&>)TW$$_^`$)<;@7;67!:46!B6;@<=@B!683=8:2$_H`$"$L'=&K$IHT$J##=)$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$JN$KS)$L'=&K$NJ>*#$KSHKO$_-`$6S)$'&*)&$'N$L'GGHK)&HG$&)GJ)N$J#$L'>#J#K)>K$PJKS$KS)$H%%GJLH>Ko#$&)SHQJGJKHKJ'>U$H>*$_--`$b&H>KJ>M$KS)$H%%GJLHKJ'>$P'=G*$JI%&'()$KS)$H%%GJLH>Ko#$GJ[)GJS''*$'N$#=LL)##$J>$&)J>K)M&HKJ>M$J>K'$#'LJ)KT$H>*$J#$J>$KS)$%=QGJLo#$J>K)&)#KW$_Q`$6S)$L'=&K$KSHK$%&)(J'=#GT$J##=)*$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N@$'>$JK#$'P>$I'KJ'>$'&$)JKS)&$QT$LH=#)$#S'P>$QT$KS)$*J#K&JLK$HKK'&>)T$'&$'>$M&'=>*#$'NN)&)*$QT$KS)$H%%GJLH>K@$IHT$HK$H>T$KJI)$J##=)$H$#=Q#)R=)>K$X=*MI)>K$K'$)>GH&M)@$GJIJK@$'&$LJ&L=I#L&JQ)$KS)$&)GJ)N$%&)(J'=#GT$M&H>K)*W$

CCJJ | Appendices

101

!"#$"%%&'()*+$ !"#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECDF01BC$$$$$$$$$$$2'G'&H*'$2'IIJ##J'>$'>$2&JIJ>HG$H>*$:=()>JG)$:=#KJL)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$$$$ 7HM)$/$'N$/$

_L`$;%'>$KS)$I'KJ'>$'N$KS)$*J#K&JLK$HKK'&>)T$'&$%&'QHKJ'>$'NNJL)&$'&$=%'>$KS)$L'=&Ko#$'P>$I'KJ'>@$H$L'=&K$IHT$&)('[)$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N$=%'>$)(J*)>L)$'N$H$#=Q#)R=)>K$L&JIJ>HG$L'>(JLKJ'>$'&$H*X=*JLHKJ'>$'&$%&''N$KSHK$KS)$H*X=*JLHK)*$X=()>JG)$J#$>'$G'>M)&$)>KJKG)*$K'$&)GJ)NW$">T$QH&#@$%&'SJQJKJ'>#@$#H>LKJ'>#@$H>*$*J#R=HGJNJLHKJ'>#$KS)&)QT$&)GJ)()*$IHT$Q)$&)J>#KHK)*$H#$'N$KS)$*HK)$'N$KS)$P&JKK)>$'&*)&$'N$&)('LHKJ'>W$6S)$L'=&K$#SHGG$%&'(J*)$H$L'%T$'N$KS)$'&*)&$'N$&)('LHKJ'>$K'$KS)$S'G*)&$H>*$K'$H>T$&)M=GHK'&T$'&$GJL)>#J>M$)>KJKT$KSHK$KS)$H*X=*JLHK)*$X=()>JG)$>'KJL)*$J>$SJ#$'&$S)&$I'KJ'>$N'&$&)GJ)NW$$_D`$-N$KS)$L'=&K$J##=)#$H>$'&*)&$'N$L'GGHK)&HG$&)GJ)N@$JK$#SHGG$#)>*$H$L'%T$'N$KS)$'&*)&$'N$L'GGHK)&HG$&)GJ)N$KS&'=MS$KS)$2'G'&H*'$J>K)M&HK)*$L&JIJ>HG$X=#KJL)$J>N'&IHKJ'>$#T#K)I$K'$KS)$2'G'&H*'$Q=&)H=$'N$J>()#KJMHKJ'>@$H>*$KS)$2'G'&H*'$Q=&)H=$'N$J>()#KJMHKJ'>$#SHGG$>'K)$J>$KS)$H%%GJLH>Ko#$&)L'&*$J>$KS)$2'G'&H*'$L&JI)$J>N'&IHKJ'>$L)>K)&$KSHK$KS)$'&*)&$'N$L'GGHK)&HG$&)GJ)N$PH#$J##=)*W$$_c`$C8:=@=<=4@92$"#$=#)*$J>$KSJ#$#)LKJ'>@$=>G)##$KS)$L'>K)fK$'KS)&PJ#)$&)R=J&)#O$_H`$m2'GGHK)&HG$L'>#)R=)>L)n$I)H>#$H$L'GGHK)&HG$#H>LKJ'>$'&$H$*J#R=HGJNJLHKJ'>W$_Q`$m2'GGHK)&HG$#H>LKJ'>n$I)H>#$H$%)>HGKT@$%&'SJQJKJ'>@$QH&@$'&$*J#H*(H>KHM)@$S'P)()&$*)>'IJ>HK)*@$JI%'#)*$'>$H>$J>*J(J*=HG$H#$H$&)#=GK$'N$KS)$J>*J(J*=HGo#$H*X=*JLHKJ'>$N'&$H>$'NN)>#)@$PSJLS$%)>HGKT@$%&'SJQJKJ'>@$QH&@$'&$*J#H*(H>KHM)$H%%GJ)#$QT$'%)&HKJ'>$'N$GHP$&)MH&*G)##$'N$PS)KS)&$KS)$%)>HGKT@$%&'SJQJKJ'>@$QH&@$'&$*J#H*(H>KHM)$J#$J>LG=*)*$J>$KS)$X=*MI)>K$'&$#)>K)>L)W$m2'GGHK)&HG$#H>LKJ'>n$*')#$>'K$J>LG=*)$JI%&J#'>I)>K@$%&'QHKJ'>@$%H&'G)@$#=%)&(J#)*$&)G)H#)@$N'&N)JK=&)@$&)#KJK=KJ'>@$NJ>)@$H##)##I)>K@$L'#K#$'N$%&'#)L=KJ'>@$'&$H$&)#K&HJ>K$'&$#H>LKJ'>$'>$H>$J>*J(J*=HGo#$*&J(J>M$%&J(JG)M)W$_L`$,'&$%=&%'#)#$'N$KSJ#$#)LKJ'>@$mH*X=*JLHKJ'>n$'&$mH*X=*JLHK)*n$I)H>#$H$()&*JLK$'N$M=JGKT$QT$H$X=*M)$'&$X=&T$'&$H$%G)H$'N$M=JGKT$'&$>'G'$L'>K)>*)&)$KSHK$J#$HLL)%K)*$QT$KS)$L'=&K$'&$H>$H*X=*JLHKJ'>$N'&$H$L&JI)$=>*)&$KS)$GHP#$'N$H>T$'KS)&$#KHK)@$KS)$;>JK)*$8KHK)#@$'&$H>T$K)&&JK'&T$#=QX)LK$K'$KS)$X=&J#*JLKJ'>$'N$KS)$;>JK)*$8KHK)#@$PSJLS@$JN$L'IIJKK)*$PJKSJ>$KSJ#$#KHK)@$P'=G*$Q)$H$L&JI)W$m"*X=*JLHKJ'>n$'&$mH*X=*JLHK)*n$HG#'$J>LG=*)#$SH(J>M$&)L)J()*$H$*)N)&&)*$H*X=*JLHKJ'>W$_*`$m5J#R=HGJNJLHKJ'>n$I)H>#$H$%)>HGKT@$%&'SJQJKJ'>@$QH&@$'&$*J#H*(H>KHM)@$S'P)()&$*)>'IJ>HK)*@$KSHK$H>$H*IJ>J#K&HKJ()$HM)>LT@$M'()&>I)>KHG$'NNJLJHG@$'&$L'=&K$J>$H$LJ(JG$%&'L))*J>M$J#$H=KS'&J])*@$Q=K$>'K$&)R=J&)*@$K'$JI%'#)$'>$H>$J>*J(J*=HG$'>$M&'=>*#$&)GHKJ>M$K'$KS)$J>*J(J*=HGo#$H*X=*JLHKJ'>$N'&$H>$'NN)>#)W$

$!

102


CCJJ | Appendices

103

Appendix F: Commission Recommendation FY17-RE02

104


CCJJ | Appendices

105

!"#$"%%&'()*+!! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BA$$$$$$$$$$$2'H'&I*'$2'JJK##K'>$'>$2&KJK>IH$I>*$:=()>KH)$:=#LKM)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$ 7IN)$.$'O$/$

+'.0$"#!1234! 567879:!;<876=7!>6?8;:7!7@>ABC@79:!;D:?B9=!B9!:E7!F;=?=!BG!9B9$DB98?D:?B9H!=7;A7<H!;9<!7I>J9K7<!67DB6<=4!!

!"7DB@@79<;:?B9!+'.0$"#!123!7&'J'L)$M'JJ=>KLP$#IO)LP$I>*$)M'>'JKM$N&'QLR$SP$%&)()>LK>N$I*()&#)$)J%H'PJ)>L$IMLK'>$'>$LR)$SI#K#$'O$I&&)#L#$LRIL$*K*$>'L$&)#=HL$K>$I$M'>(KMLK'>@$'&$M&KJK>IH$T=#LKM)$&)M'&*#$LRIL$RI()$S))>$#)IH)*$'&$)U%=>N)*V$$L?=DJ==?B9!3SLIK>K>N$)J%H'PJ)>L$K#$I$HKO)H'>N$MRIHH)>N)$O'&$LR'#)$QKLR$I$M&KJK>IH$&)M'&*@C$I>*$LR)$#K>NH)$SKNN)#L$R=&*H)$OIMK>N$K>*K(K*=IH#$&)L=&>K>N$O&'J$K>MI&M)&ILK'>VA$$6RK#$K#$'O$QK*)#%&)I*$M'>M)&>@$I#$>)I&HP$'>)$K>$LR&))$"J)&KMI>#$'O$Q'&WK>N$IN)$RI()$#'J)$O'&J$'O$M&KJK>IH$&)M'&*VX$$->$2'H'&I*'$IH'>)@$'()&$C?B@BBB$%)'%H)$Q)&)$I&&)#L)*$K>$ABCYVZ$$6R)$K>ISKHKLP$'O$HI&N)$>=JS)&#$'O$%)'%H)$L'$'SLIK>$)J%H'PJ)>L$I*()&#)HP$IOO)ML#$LR)$%=SHKM[#$#IO)LP$I>*$Q)HOI&)V$$3>$I>$K>*K(K*=IH$H)()H@$NIK>O=H$)J%H'PJ)>L$K#$I$W)P$OIML'&$LRIL$)>ISH)#$%)'%H)$L'$I('K*$O=L=&)$I&&)#L#$I>*$K>MI&M)&ILK'>VY$$4'&)$S&'I*HP@$LR)$)M'>'JP$I#$I$QR'H)$K#$>)NILK()HP$KJ%IML)*$SP$LR)$&)*=MLK'>$'O$)J%H'PJ)>L$&IL)#$O'&$%)'%H)$QKLR$I$M&KJK>IH$&)M'&*V\$$.=J)&'=#$#L=*K)#$RI()$#R'Q>$LRIL$LR)$)J%H'PJ)>L$&)HIL)*$M'>#)]=)>M)#$'O$I$M&KJK>IH$&)M'&*$*K#%I&IL)HP$KJ%IML$K>*K(K*=IH#$I>*$M'JJ=>KLK)#$'O$M'H'&VD$$-L$K#$LR=#$>)M)##I&P$L'$)>#=&)$LRIL$2'H'&I*'[#$&)M'&*GSI#)*$&)#L&KMLK'>#$'>$)J%H'PJ)>L$I&)$S'LR$OIK&$L'$K>*K(K*=IH#$I>*$%&'*=MLK()$L'$LR)$#IO)LP$I>*$Q)HOI&)$'O$#'MK)LPV$$$

C$"V$2R&K#LJI>$^$4V.V$0'*&KN=)_$ÀBC\@$"=N=#La@$!"#$%&'(($)%*(+(",#'%&-../,$+%!"0,12'"3#(%4/50#0(+@$6R)$.IL[H$1J%[L$/IQ$7&'T)ML$ÌL$>)H%V'&NbM'>L)>Lb=%H'I*#b,IK&G2RI>M)GcI>GLR)Gc'UG0)#)I&MRV%*Oad$4I=&))>$2IK>@$7'HKMP$5K&)ML'&@$2'H'&I*'$2&KJK>IH$5)O)>#)$->#LKL=L)@$%&)#)>LILK'>$L'$LR)$22::$2'HHIL)&IH$2'>#)]=)>M)#$e'&WK>N$f&'=%$`"=NV$AZ@$ABC\aV$A$6R)$7KL'>$7)&#%)MLK()$ÀBBD@$8%&K>Na@$&$-67%./,$,"7+%+$,-885(+%.(/.5(%9"#(%"9$(,%.,0+/3$ÌL$M*%#*'M#V#LIL)VM'V=#bMMTTb0)#'=&M)#b0)Ob7KL'>7)&#%)MLK()G8%&ABBDV%*Oad$9I##I>$/ILKO@$1U)M=LK()$5K&)ML'&@$8)M'>*$2RI>M)$2)>L)&@$%&)#)>LILK'>$L'$LR)$22::$2'HHIL)&IH$2'>#)]=)>M)#$e'&WK>N$f&'=%$`"=NV$CB@$ABC\ad$0KMRI&*$4'&IH)#@$5)%=LP$1U)M=LK()$5K&)ML'&@$/ILK>'$2'IHKLK'>$O'&$2'JJ=>KLP$/)I*)&#RK%@$%&)#)>LILK'>$L'$LR)$22::$2'HHIL)&IH$2'>#)]=)>M)#$e'&WK>N$f&'=%$`"=NV$CB@$ABC\aV$$$$$X$c=&)I=$'O$:=#LKM)$8LILK#LKM#$ÀBCZ@$:I>=I&Pa@%&-,:(7%/9%&$"$(%2,0;03"5%<0+$/,7%=39/,;"$0/3%&7+$(;+>%;V8V$5)%LV$'O$:=#LKM)$`#))$6ISH)$C$'>$%V$CZ$IL$RLL%#gbbQQQV>MT&#VN'(b%*OOKH)#CbST#bN&I>L#bAZZY\XV%*Oad$:V2V$4MfK>LP$ÀBCY@$"=NV$Da@$9'Q$4I>P$"J)&KMI>#$9I()$I$7'HKM)$0)M'&*h@$?'(%@"55%&$,(($%A/-,3"5$ÌL$RLL%#gbbQQQVQ#TVM'JbI&LKMH)#bR'QGJI>PGIJ)&KMI>#GRI()GIG%'HKM)G&)M'&*G%&'SISHPGJ'&)GLRI>GP'=GLRK>WGCZXF?X?FBAaV$Z$2'H'V$c=&)I=$'O$->()#LKNILK'>@$2&KJ)$K>$2'H'&I*'$ABCY@$RLL%gbbM&KJ)K>M'VMSKV#LIL)VM'V=#bMKMAWCYb#LIL)iL'LIH#b#LIL)QK*)iI*=HLiI&&)#L#V%R%$`HI#L$(K#KL)*$,)SV$C@$ABCDaV$$Y$/)LL)&$O&'J$;>KL)*$8LIL)#$"LL'&>)P$f)>)&IH$1&KM$9'H*)&@$:&V@$L'$2'H'&I*'$"LL'&>)P$f)>)&IH$:'R>$8=LR)&#$`"%&KH$CF@$ABCCad$+((%"5+/$:V9V$/I=S$^$0V:V$8IJ%#'>$ÀBBCaV$;>*)&#LI>*K>N$*)#K#L)>M)$O&'J$M&KJ)@%2,0;(%"36%A-+$0#(>%BCDEF>%E1GH$`*'Kg$CBVCBF\b\YAABFad$.ILK'>IH$0)#)I&MR$2'=>MKH$ÀBBFa@$4",/5(>%I(+0+$(3#(%9,/;%2,0;(>%"36%2/;;-30$7%=3$(8,"$0/3@$2'JJKLL))$'>$2'JJ=>KLP$8=%)&(K#K'>$I>*$5)#K#L)>M)$O&'J$2&KJ)$`#))$%%V$AXGAZ$IL$M*%#*'M#V#LIL)VM'V=#bMMTTb0)#'=&M)#b0)Ob.20ABBDV%*Oad$I>*$:V$0I*KM)$ÀBCAa@$"*JK>K#L)&K>N$T=#LKM)g$0)J'(K>N$#LIL=L'&P$SI&&K)&#$L'$&))>L&P@$J30:(,+0$7%/9%2/5/,"6/%K"L%*(:0(L>%FX`Xa@$DCYGDD?$`#))$%V$DC?$IL$M'H'&I*'V)*=bHIQb#KL)#b*)OI=HLbOKH)#b<'HVFXVXV%*OaV$\$!"#$%&'(($@$+-.,"$>'L)$Cd$:V$0'S)&L#$ÀBCCa@$eRP$JK#*)J)I>'&#$JILL)&g$5)OK>K>N$)OO)MLK()$I*('MIMP$K>$LR)$H'Q)&$M&KJK>IH$M'=&L#@$JM2M%I":0+%K"L%*(:0(L@$NOÀa@$ADDGXDA$`#))$%%V$XBBGXBC$IL$HIQ&)(K)QVHIQV=M*I(K#V)*=bK##=)#bZYbAb"&LKMH)#bZYGAi:)>>Pi0'S)&L#V%*Oad$:V$8MRJKLL$^$jV$eI&>)&$ÀBCBa@$PQ1R99(36(,+%"36%$'(%K"S/,%T",U($>$2)>L)&$O'&$1M'>V$^$7'HKMP$0)#)I&MR$ÌL$M)%&V>)Lb*'M=J)>L#b%=SHKMILK'>#b)UG'OO)>*)&#GABCBGCCV%*OaV$D$1V$"V$2I&#'>$ÀBCY@$8)%L)JS)&a@$4,0+/3(,+%03%BVEN@$c=&)I=$'O$:=#LKM)$8LILK#LKM#@$;V8V$5)%LV$'O$:=#LKM)$`&)%'&LK>N$'>$%V$CY$LRIL$I#$'O$5)M)JS)&$XC@$ABCZ@$SHIMW$J)>$I&)$KJ%&K#'>)*$K>$#LIL)$I>*$O)*)&IH$OIMKHKLK)#$IL$I$&IL)$'O$A@DAZ$%)&$CBB@BBB@$9K#%I>KM$J)>$I&)$KJ%&K#'>)*$IL$I$&IL)$'O$C@B?C$%)&$CBB@BBB@$I>*$QRKL)$J)>$I&)$KJ%&K#'>)*$IL$I$&IL)$'O$Z\Y$%)&$CBB@BBBd$#KJKHI&$*K#%I&KLK)#$)UK#L$O'&$Q'J)>a$ÌL$RLL%gbbQQQVST#VN'(bM'>L)>Lb%=Sb%*Ob%CZV%*Oad$I>*$;V$8V$1]=IH$3%%'&L=>KLP$2'JJK##K'>$ÀBCA@$"%&KH$AYa@$

106


!"#$"%%&'()*+!! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BA$$$$$$$$$$$2'H'&I*'$2'JJK##K'>$'>$2&KJK>IH$I>*$:=()>KH)$:=#LKM)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$ 7IN)$3$'O$/$

c)MI=#)$M&KJK>IH$&)M'&*$)UMH=#K'>#$RI()$I$*K#%I&IL)$KJ%IML$SI#)*$'>$&IM)$I>*$>ILK'>IH$'&KNK>@$LR)P$I&)$&)N=HIL)*$=>*)&$6KLH)$<--$'O$LR)$2K(KH$0KNRL#$"ML$'O$C?\ZVF$$1J%H'P)&#$OIM)$6KLH)$<--$HKISKHKLP$QR)>$LR)K&$M&KJK>IH$&)M'&*$#M&))>K>N$%'HKMP$'&$%&IMLKM)$*K#%&'%'&LK'>IL)HP$#M&))>#$'=L$J)JS)&#$'O$I$%&'L)ML)*$N&'=%@$I>*$LR)$)J%H'P)&$MI>>'L$*)J'>#L&IL)$LRIL$KL$K#$T'S$&)HIL)*$O'&$LR)$%'#KLK'>#$K>$]=)#LK'>$I>*$M'>#K#L)>L$QKLR$S=#K>)##$>)M)##KLPV?$$$$"&&)#L#$IH'>)$I&)$>'L$%&''O$'O$M&KJK>IH$IMLK(KLPVCB$$1J%H'PJ)>L$)UMH=#K'>#$SI#)*$#'H)HP$'>$I>$I&&)#L$I&)$LR)&)O'&)$N)>)&IHHP$>'L$T'S$&)HIL)*$I>*$M'>#K#L)>L$QKLR$S=#K>)##$>)M)##KLP@$I>*$MI>$NK()$&K#)$L'$6KLH)$<--$HKISKHKLPVCC$$7'HKMK)#$I>*$%&IMLKM)#$LRIL$KJ%'#)$)UMH=#K'>#$SI#)*$'>$M'>(KMLK'>$&)M'&*#$J=#L$HK>W$LR)$#%)MKOKM$M&KJK>IH$M'>*=ML$QKLR$LR)$&K#W#$K>R)&)>L$K>$LR)$*=LK)#$'O$I$%I&LKM=HI&$%'#KLK'>VCA$$$$;>HKW)$#)()&IH$'LR)&$#LIL)#@CX$2'H'&I*'$M=&&)>LHP$%HIM)#$>'$&)#L&KMLK'>#$'>$%&K(IL)$)J%H'P)&#[$ISKHKLP$L'$QKLRR'H*$'&$L)&JK>IL)$)J%H'PJ)>L$SI#)*$'>$I>$K>*K(K*=IH[#$M&KJK>IH$&)M'&*V$$1J%H'P)&#$I&)$%&'RKSKL)*$O&'J$I#WK>N$K>*K(K*=IH#$L'$*K#MH'#)$M&KJK>IH$&)M'&*#$LRIL$RI()$S))>$#)IH)*VCZ$$6R)$HIQ$M=&&)>LHP$RI#$>'$J)MRI>K#J@$R'Q)()&@$O'&$)>O'&MK>N$LRIL$%&'RKSKLK'>VCY$$$!!56B>B=7<!):;:J:B6C!M;9KJ;K7!6RK#$&)M'JJ)>*ILK'>$NK()#$J)I>K>N$L'$2'H'&I*'[#$M=&&)>L$&)M'&*$#)IHK>N$HIQ#@$I>*$I%%HK)#$)UK#LK>N$1132$N=K*I>M)V$$-L$Q'=H*$%&)()>L$%&K(IL)$)J%H'P)&#$O&'J$LIWK>N$I*()&#)$IMLK'>$INIK>#L$I>$K>*K(K*=IH$SI#)*$'>$I&&)#L#$LRIL$*K*$>'L$&)#=HL$K>$M'>(KMLK'>@$#)IH)*$&)M'&*#@$I>*$)U%=>N)*$&)M'&*#V$$;>*)&$IHH$'O$

P39/,#(;(3$%W-06"3#(%/3%$'(%2/3+06(,"$0/3%/9%X,,(+$%"36%2/3:0#$0/3%*(#/,6+%03%P;.5/7;(3$%I(#0+0/3+%J36(,%?0$5(%Y==%/9%$'(%20:05%*08'$+%X#$%/9%EHGN$`#))$k-V$8=JJI&Pl$IL$RLL%#gbbQQQV))'MVN'(bHIQ#bN=K*I>M)bI&&)#LiM'>(KMLK'>VMOJaV$$F$P39/,#(;(3$%W-06"3#(@$+-.,"$>'L)$D@$IL$CV$$?$=6M$IL$?V$CB$=6M$IL$CAV$$CC$=6M$$CA$=6M$IL$CZGC\V$$$CX$->$9IQIKK$KL$K#$k=>HIQO=H$*K#M&KJK>IL'&P$%&IMLKM)l$O'&$I>$)J%H'P)&$L'$*K#M&KJK>IL)$'>$LR)$SI#K#$'O$I>$K>*K(K*=IH[#$kI&&)#L$I>*$M'=&L$&)M'&*Vl$$9IQV$0)(V$8LILV$m$XDFGAÌa`CaV$$1J%H'P)&#$JIP$K>]=K&)$IS'=L$M'>(KMLK'>$&)M'&*#@$S=L$I&)$N)>)&IHHP$'>HP$%)&JKLL)*$L'$M'>#K*)&$M'>(KMLK'>#$QKLRK>$LR)$HI#L$L)>$P)I&#$)UMH=*K>N$%)&K'*#$'O$K>MI&M)&ILK'>V$$9IQV$0)(V$8LILV$m$XDFGAVYÌa@$GAVY`MaV$$6R)$8LIL)$'O$4I##IMR=#)LL#$%&'RKSKL#$%&K(IL)$)J%H'P)&#$O&'J$K>]=K&K>N$IS'=L$'&$SI#K>N$)J%H'PJ)>L$*)MK#K'>#$'>g$`Ca$I&&)#L#$LRIL$*K*$>'L$&)#=HL$K>$M'>(KMLK'>@$Àa$OK&#L$M'>(KMLK'>#$O'&$M)&LIK>$JK#*)J)I>'&#@$I>*$`Xa$JK#*)J)I>'&#$O'&$QRKMR$LR)$I##'MKIL)*$%)&K'*$'O$K>MI&M)&ILK'>$)>*)*$J'&)$LRI>$OK()$P)I&#$%&K'&$=>H)##$LR)$K>*K(K*=IH$RI#$S))>$M'>(KML)*$'O$I>'LR)&$'OO)>#)V$$4I##V$f)>V$/IQ#$MRV$CYCc@$mZ`?aV$$6R)$8LIL)$'O$.)Q$E'&W$%&'RKSKL#$%&K(IL)$)J%H'P)&#$O&'J$K>]=K&K>N$IS'=L@$'&$IMLK>N$I*()&#)HP$'>$LR)$SI#K#$'Og$`Ca$I>P$I&&)#L$>'L$LR)>$%)>*K>N$QR)&)$LR)$M&KJK>IH$IMLK'>$QI#$L)&JK>IL)*$K>$OI('&$'O$LR)$K>*K(K*=IH@$Àa$P'=LRO=H$'OO)>*)&$I*T=*KMILK'>#@$I>*$`Xa$M)&LIK>$#)IH)*$&)M'&*#V$$.VEV$1U)MV$/IQ$m$A?\`C\aV$$-L$K#$=>OIK&$*K#M&KJK>ILK'>$L'$*)>P$'&$IML$I*()&#)HP$'>$)J%H'PJ)>L$SI#)*$'>$I$M'>(KMLK'>$=>H)##$LR)&)$K#$I$*K&)ML$&)HILK'>#RK%$S)LQ))>$LR)$M'>(KMLK'>$I>*$LR)$)J%H'PJ)>LV$$.VEV$2'&&)MLV$/IQ$m$DYAV$$6R)$8LIL)$'O$7)>>#PH(I>KI$IHH'Q#$%&K(IL)$)J%H'P)&#$L'$M'>#K*)&$'>HP$M'>(KMLK'>#$O'&$O)H'>K)#$I>*$JK#*)J)I>'&#@$I>*$&)]=K&)#$LRIL$LR)$M'>(KMLK'>#$k&)HIL)$L'$LR)$I%%HKMI>L[#$#=KLISKHKLP$O'&$)J%H'PJ)>L$K>$LR)$%'#KLK'>$O'&$QRKMR$R)$RI#$I%%HK)*Vl$$CF$7IV$2'>#V$8LILV$m$?CAYV$$6R)$8LIL)$'O$eK#M'>#K>$N)>)&IHHP$%&'RKSKL#$%&K(IL)$)J%H'P)&#$O&'J$&)]=)#LK>N$K>O'&JILK'>$O&'J$I%%HKMI>L#$IS'=L$I&&)#L$&)M'&*#$)UM)%L$I#$L'$%)>*K>N$MRI&N)#V$$eK#V$8LILV$m$CCCVXXY`CaÌaV$$-L$IH#'$&)#L&KML#$)J%H'P)&#[$=#)$'O$M'>(KMLK'>$&)M'&*#V$$eK#V$8LILV$mm$CCCVXAC@$CCCVXXY`Ca`MaV$CZ$mm$AZGDAGDBA`CaÒa@$AZGDAGDBX`Za`*a`-a@$2V0V8V$ABC\V$$$$$$CY$29M$m$AZGDAGXB?@$2V0V8V$ABC\$`S)O'&)$2'H'&I*'[#$&)M'&*$#)IHK>N$#LIL=L)#$Q)&)$J'()*$L'$%I&L$D$'O$MRI%L)&$DA$'O$LKLH)$AZ@$KL$QI#$I$JK#*)J)I>'&$L'$(K'HIL)$LR)K&$%&'(K#K'>#aV$$$

CCJJ | Appendices

107

!"#$"%%&'()*+!! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BA$$$$$$$$$$$2'H'&I*'$2'JJK##K'>$'>$2&KJK>IH$I>*$:=()>KH)$:=#LKM)$$$$$$$$$$$$$$:=>)$?@$ABCD$$$$$$$$ 7IN)$/$'O$/$

LR'#)$MK&M=J#LI>M)#@$)KLR)&$LR)$K>*K(K*=IH$RI#$>'L$S))>$M'>(KML)*$'O$I$M&KJ)@$'&$I$T=*N)$RI#$IH&)I*P$*)L)&JK>)*$LRIL$LR)$&)M'&*$K>$]=)#LK'>$#R'=H*$>'L$S)$I(IKHISH)$L'$LR)$%=SHKMVC\$$$$6R)$%&'%'#)*$%&'(K#K'>#$Q'=H*$S)$)>O'&M)ISH)$SP$LR)$2'H'&I*'$5)%I&LJ)>L$'O$0)N=HIL'&P$"N)>MK)#@$2K(KH$0KNRL#$5K(K#K'>VCD$$6R)$MK(KH$&KNRL#$M'JJK##K'>$M'=H*@$IOL)&$O'HH'QK>N$)UK#LK>N$>'LKM)$I>*$R)I&K>N$%&'M)*=&)#@$K##=)$I$M)I#)$I>*$*)#K#L$'&*)&$KO$KL$O'=>*$I>$)J%H'P)&$QI#$)>NINK>N$K>$%&'RKSKL)*$%&IMLKM)#VCF$$-L$M'=H*$IH#'$'&*)&$&)K>#LIL)J)>L$'&$RK&K>N@$SIMW$'&$O&'>L$%IP@$'&$'LR)&$I%%&'%&KIL)$)]=KLISH)$&)HK)OVC?$$6R)$&)M'JJ)>*ILK'>$Q'=H*$IH#'$IHH'Q$INN&K)()*$K>*K(K*=IH#$L'$K>KLKIL)$I$MK(KH$IMLK'>$#))WK>N$LR)$#IJ)$&)J)*K)#$I>*@$=>*)&$M)&LIK>$MK&M=J#LI>M)#@$M'J%)>#IL'&P$I>*$%=>KLK()$*IJIN)#VAB$$$$$2'>#K#L)>L$QKLR$)UK#LK>N$HIQ@$LRK#$&)M'JJ)>*ILK'>$IKJ#$L'$)>#=&)$&)M'&*GSI#)*$&)#L&KMLK'>#$'>$)J%H'PJ)>L$I&)$S'LR$OIK&$L'$K>*K(K*=IH#$I>*$%&'*=MLK()$L'$LR)$#IO)LP$I>*$Q)HOI&)$'O$2'H'&I*'$#'MK)LPV$$$$ $.4!!(@79<!=7D:?B9!3N$/N$N23!FC!;<<?9K!:E7!GBAABO?9K4!$

`Ca$$-L$#RIHH$S)$I$*K#M&KJK>IL'&P$'&$=>OIK&$)J%H'PJ)>L$%&IMLKM)d$$`Ta$,'&$I>$)J%H'P)&@$)J%H'PJ)>L$IN)>MP@$'&$HIS'&$'&NI>K_ILK'>$L'$JIW)$I>P$K>]=K&P$IS'=L@$'&$L'$IML$I*()&#)HP$L'$I>$K>*K(K*=IH$'>$LR)$SI#K#$'O@$I$&)M'&*$'O$I>P$I&&)#L$'&$MRI&N)$LRIL$*K*$>'L$&)#=HL$K>$I$M'>(KMLK'>$I>*$LR)$M&KJK>IH$MI#)$K#$>'L$IMLK()HP$%)>*K>N@$'&$I>P$M&KJK>IH$T=#LKM)$&)M'&*$LRIL$RI#$S))>$#)IH)*$'&$)U%=>N)*V$$$

C\$eKLR$LR)$)UM)%LK'>$'O$M)&LIK>$M'>L&'HH)*$#=S#LI>M)$I>*$R=JI>$L&IOOKMWK>N$&)HIL)*$'OO)>#)#@$LR)$#)IHK>N$'O$I$&)M'&*$&)OH)ML#$LRIL$I$T=*N)$RI#$IH&)I*P$*)L)&JK>)*$LRIL$LR)$RI&J$L'$LR)$K>*K(K*=IH[#$%&K(IMP$'=LQ)KNR#$LR)$%=SHKM[#$K>L)&)#L$K>$LR)$I(IKHISKHKLP$'O$LR)$&)M'&*V$$mm$AZGDAGDBA`Ca`Sa`--a`ca@$GDBZ`Ca`Ma@$GDBY@$GDB\@$GDBF`Xa@$2V0V8V$ABC\V$CD$m$AZGXZGXB\@$2V0V8V$ABC\V$$$CF$m$AZGXZGXB\`?a@$2V0V8V$ABC\V$C?$m$AZGXZGZBYÀa@$2V0V8V$ABC\V$AB$mm$AZGXZGXB\`CCa@$GXB\`CZa@$GXB\`CYa@$AZGXZGZBY`Xa@$2V0V8V$ABC\V$

108


CCJJ | Appendices

109

Appendix G: Commission Recommendation FY17-RE03

110


CCJJ | Appendices

111

!"#$"%%&'()*+! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BH$$$$$$$$$$$2'I'&J*'$2'KKL##L'>$'>$2&LKL>JI$J>*$:=()>LI)$:=#MLN)$$$$$$$$$$$$$$:=>)$?@$ABCD$ 7JO)$.$'P$.$

+'./$"#!0123!!"45674!7898:8;<=!>:6?9@A4!;@!78984!B6A4@7:<4!9@?!4CDB;=C4@83! ! !!"4A;CC4@?986;@!+'./$"#!012!7&'K'M)$N'KK=>LMQ$#JP)MQ$J>*$)N'>'KLN$O&'RMS$TQU$G$7&)()>ML>O$N'>#L*)&JML'>$'P$J&&)#M#$MSJM$*L*$>'M$&)#=IM$L>$J$N'>(LNML'>@$J>*$N'>(LNML'>#$MSJM$SJ()$T))>$

%J&*'>)*@$#)JI)*@$'&$)V%=>O)*@$L>$#MJM)$ILN)>#=&)$J>*$)K%I'QK)>M$*)NL#L'>#W$G$1K%'R)&L>O$MS)$5)%J&MK)>M$'P$0)O=IJM'&Q$"O)>NL)#$M'$*)IL#M$N)&MJL>$N'>*LML'>JI$ILN)>#)#W$G$2'II)NML>O$*JMJW$G$1>N'=&JOL>O$MS)$)ILKL>JML'>$'P$KJ>*JM'&Q$N'IIJM)&JI$N'>#)X=)>N)#W$G$->N)>ML(LYL>O$'%%'&M=>LMQ$)V%J>#L'>$TQ$#MJM)$N'>M&JNM'&#W$J>*$G$->N&)J#L>O$M&J>#%J&)>NQ$'P$JO)>NQ$%'ILNL)#Z$

$E67A:776;@$2'I'&J*'$O'()&>K)>M$&)O=IJM)#$MS)$)K%I'QK)>M$'P@$'&$*L&)NMIQ$)K%I'Q#@$J$#=T#MJ>MLJI$%'&ML'>$'P$MS)$8MJM)[#$%'%=IJML'>Z$$6S)$5)%J&MK)>M$'P$0)O=IJM'&Q$"O)>NL)#$\530"]$JI'>)$J*KL>L#M)&#$'()&$^B$&)O=IJM'&Q$%&'O&JK#$O'()&>L>O$%&'P)##L'>#@$'NN=%JML'>#@$J>*$T=#L>)##)#$N'K%&L#L>O$'()&$DCB@BBB$L>*L(L*=JI$ILN)>#))#ZC$$6S)$8MJM)$*L&)NMIQ$)K%I'Q#$'()&$?^@BBB$%)'%I)@A$J>*$KJ>Q$K'&)$J&)$)K%I'Q)*$TQ$I'NJI$O'()&>K)>M#Z$$$$"$N&LKL>JI$&)N'&*$NJ>$J*()&#)IQ$LK%JNM$J>$L>*L(L*=JI[#$JTLILMQ$M'$'TMJL>$)LMS)&$J$ILN)>#)$>)N)##J&Q$M'$R'&_$'&$*L&)NM$)K%I'QK)>M$RLMS$#MJM)$'&$I'NJI$O'()&>K)>M#ZH$$6SL#$L##=)$L#$'P$RL*)#%&)J*$N'>N)&>@$J#$LM$L#$)#MLKJM)*$MSJM$>)J&IQ$'>)$L>$MS&))$"K)&LNJ>#$'P$R'&_L>O$JO)$SJ()$#'K)$P'&K$'P$N&LKL>JI$&)N'&*Z`$$->$2'I'&J*'$JI'>)@$'()&$C?B@BBB$%)'%I)$R)&)$J&&)#M)*$L>$ABC^^$J>*$J>$)#MLKJM)*$CZ^$KLIIL'>$SJ()$N&LKL>JI$&)N'&*#Za$$$6S)$L>JTLILMQ$'P$IJ&O)$>=KT)&#$'P$%)'%I)$M'$'TMJL>$)K%I'QK)>M$J*()&#)IQ$JPP)NM#$MS)$%=TILN[#$#JP)MQ$J>*$R)IPJ&)Z$$3>$J>$L>*L(L*=JI$I)()I@$OJL>P=I$)K%I'QK)>M$L#$J$_)Q$PJNM'&$MSJM$)>JTI)#$%)'%I)$M'$J('L*$P=M=&)$J&&)#M#$J>*$L>NJ&N)&JML'>ZD$$4'&)$T&'J*IQ@$MS)$)N'>'KQ$J#$J$RS'I)$L#$>)OJML()IQ$LK%JNM)*$TQ$MS)$

C$530"$\ABCa@$3NMZ$C]@$!"#$%!"#&'()*+,-.)/-'0),12,.+/3)'04+/5'\#))$%Z$a$JM$N'I'&J*'ZO'(b*'&Jb*'&JG)V)N=ML()G*L&)NM'&#G'PPLN)]Z$A$2'I'Z$5L(Z$'P$9=KJ>$0)#Z$\ABC^]@$67'!"#8%#9':2,;12,3)'<)*2,-@$\#))$%Z$H$+-$N'I'&J*'ZO'(b*S&bPQABC`GC^R'&_P'&N)&)%'&M]Z$H$4J&_$1(J>#@$2'I'Z$8MJM)$7=TILN$5)P)>*)&[#$3PPLN)@$=>)'?2/@)AB)/3)@'21'?2/CD3-D2/E'F+/3-D2/@'G)H2/I'->)'F)/-)/3)'J/I),'?242,+I2'K+L$C`GC^@$^CG?`$\ABC`$)*Z]$\+C+D4+M4)'+-$SMM%UbbRRRZN'I'&J*'*)P)>*)&#Z=#bN'>#)X=)>N)#G'PGN'>(LNML'>GAbN'>#)X=)>N)#G'PGN'>(LNML'>GAb]Z$$`$:Z2Z$4NcL>MQ$\ABC^@$"=OZ$D]@$9'R$4J>Q$"K)&LNJ>#$9J()$J$7'ILN)$0)N'&*d@$=>)':+44'F-,))-'N2B,/+4$\JM$SMM%#UbbRRRZR#eZN'KbJ&MLNI)#bS'RGKJ>QGJK)&LNJ>#GSJ()GJG%'ILN)G&)N'&*G%&'TJTIQGK'&)GMSJ>GQ'=GMSL>_GC`HF?H?FBAZ$$^$2'I'Z$f=&)J=$'P$->()#MLOJML'>@$?,D.)'D/'?242,+I2'!"#9@$SMM%UbbN&LK)L>N'ZNTLZ#MJM)ZN'Z=#bNLNA_C^b#MJM)gM'MJI#b#MJM)RL*)gJ*=IMgJ&&)#M#Z%S%$\IJ#M$(L#LM)*$,)TZ$A@$ABCD]Z$$a$f=&)J=$'P$:=#MLN)$8MJML#MLN#$\ABC`@$:J>=J&Q]@'FB,C)H'21'F-+-)'?,D.D/+4'OD@-2,H'P/12,.+-D2/'FH@-).@5';Z8Z$5)%MZ$'P$:=#MLN)$\#))$6JTI)$C$'>$%Z$C`$JM$SMM%#UbbRRRZ>Ne&#ZO'(b%*PPLI)#CbTe#bO&J>M#bA``âHZ%*P]Z$D$/)MM)&$P&'K$;>LM)*$8MJM)#$"MM'&>)Q$c)>)&JI$1&LN$9'I*)&@$:&Z@$M'$2'I'&J*'$"MM'&>)Q$c)>)&JI$:'S>$8=MS)&#$\"%&LI$CF@$ABCC]W$@))'+4@2$:Z9Z$/J=T$h$0Z:Z$8JK%#'>$\ABBC]@$;>*)&#MJ>*L>O$*)#L#M)>N)$P&'K$N&LK)@'?,D.)'+/I'NB@-D3)5'!&Q#R5'#%ST$\*'LU$CBZCBFabaÂABF]W$.JML'>JI$0)#)J&NS$2'=>NLI$\ABBF]@$0+,24)5'()@D@-)/3)'1,2.'?,D.)5'+/I'?2..B/D-H'P/-)U,+-D2/@$2'KKLMM))$'>$2'KK=>LMQ$8=%)&(L#L'>$J>*$5)#L#M)>N)$P&'K$2&LK)$\#))$%%Z$AHGA`$JM$N*%#*'N#Z#MJM)ZN'Z=#bNNeeb0)#'=&N)#b0)Pb.20ABBDZ%*P]W$J>*$:Z$0J*LN)$\ABCA]@$"*KL>L#M)&L>O$e=#MLN)U$0)K'(L>O$#MJM=M'&Q$TJ&&L)&#$M'$&))>M&Q@$J/DC),@D-H'21'?242,+I2'K+L'<)CD)L5'FH\H]@$DC^GDD?$\#))$%Z$DC?$JM$N'I'&J*'Z)*=bIJRb#LM)#b*)PJ=IMbPLI)#b<'IZFHZHZ%*P]Z$

112


!"#$"%%&'()*+! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BH$$$$$$$$$$$2'I'&J*'$2'KKL##L'>$'>$2&LKL>JI$J>*$:=()>LI)$:=#MLN)$$$$$$$$$$$$$$:=>)$?@$ABCD$ 7JO)$F$'P$F$

&)*=NML'>$'P$)K%I'QK)>M$&JM)#$P'&$%)'%I)$RLMS$J$N&LKL>JI$&)N'&*ZF$$.=K)&'=#$#M=*L)#$SJ()$#S'R>$MSJM$MS)$)K%I'QK)>M$&)IJM)*$N'>#)X=)>N)#$'P$J$N&LKL>JI$&)N'&*$*L#%J&JM)IQ$LK%JNM$N'KK=>LML)#$'P$N'I'&Z?$$-M$L#$MS=#$>)N)##J&Q$M'$)>#=&)$MSJM$2'I'&J*'[#$&)N'&*GTJ#)*$&)#M&LNML'>#$'>$)K%I'QK)>M$J>*$ILN)>#L>O$J&)$T'MS$PJL&$M'$L>*L(L*=JI#$J>*$%&'*=NML()$M'$MS)$#JP)MQ$J>*$R)IPJ&)$'P$#'NL)MQZ$!iS)>$J>$L>*L(L*=JI$RLMS$J$N&LKL>JI$&)N'&*$J%%IL)#$P'&$J$#MJM)$e'T@$#)NML'>$A`G^GCBC@$2Z0Z8Z$ABCa@$O'()&>#$MS)$)PP)NM$'P$MSJM$&)N'&*$'>$SL#$'&$S)&$)K%I'QK)>M$%&'#%)NM#Z$$iS)>$J>$L>*L(L*=JI$RLMS$J$&)N'&*$J%%IL)#$P'&$J$#MJM)$L##=)*$ILN)>#)$M'$)>OJO)$L>$K'#M$&)O=IJM)*$%&'P)##L'>#@$MS)$ILN)>#L>O$JO)>NQ$L#$O'()&>)*$TQ$MS)$#JK)ZCB$$$6S)$#MJM=M)$%=&%'&M#$M'$j)V%J>*$)K%I'QK)>M$'%%'&M=>LML)#$P'&$%)&#'>#$RS'@$>'MRLMS#MJ>*L>O$MSJM$PJNM$'P$N'>(LNML'>$'P$J>$'PP)>#)@$SJ()$T))>$&)SJTLILMJM)*$J>*$J&)$&)J*Q$M'$JNN)%M$MS)$&)#%'>#LTLILML)#$'P$J$IJRGJTL*L>O$J>*$%&'*=NML()$K)KT)&$'P$#'NL)MQZkCC$$-M$%&'(L*)#$ILMMI)$O=L*J>N)@$S'R)()&@$P'&$MS)$K'#M$P&)X=)>M$NL&N=K#MJ>N)#$L>$RSLNS$#MJM)$JO)>NL)#$K=#M$N'>#L*)&$J$N&LKL>JI$&)N'&*Z$$$$,L&#M@$MS)$'>IQ$NI)J&$#MJM=M'&Q$O=L*J>N)$'>$S'R$J$N&LKL>JI$&)N'&*$#S'=I*$T)$N'>#L*)&)*$*')#$>'M$J%%IQ$M'$ILN)>#=&)$*)NL#L'>#ZCA$$-M$J%%IL)#$'>IQ$M'$JNM=JI$)K%I'QK)>M$TQ$MS)$8MJM)Z$$6S)$#MJM=M'&Q$%&'(L#L'>#$J%%ILNJTI)$M'$ILN)>#=&)$*)NL#L'>#$L>*LNJM)$MSJM$J$%&L'&$N'>(LNML'>$#S'=I*$T)$N'>#L*)&)*@$T=M$*'$>'M$L>*LNJM)$S'RZCH$$$$8)N'>*@$MS)$O=L*J>N)$%&'(L*)*$P'&$#MJM)$)K%I'QK)>M$*)NL#L'>#$KJ>*JM)#$MSJM$MS)$#JK)$N&LM)&LJ$P'&$)(JI=JML>O$N'>(LNML'>#$RSLNS$SJ()$T))>$%J&*'>)*@$)V%=>O)*@$'&$#)JI)*$J%%IL)#$M'$MS'#)$MSJM$SJ()$>'MZC`$$6SL#$*)P)JM#$MS)$)V%&)##$O'JI$'P$J$%J&*'>@C^$J>*$MS)$LK%ILNLM$O'JI#$=>*)&IQL>O$MS)$#MJM=M'&Q$#NS)K)$P'&$)V%=>OL>O@$#)JIL>O@$'&$*L#KL##L>O$N'>(LNML'>$&)N'&*#ZCa$$-M$JI#'$KJ_)#$>'$K)>ML'>$'P$'&*)&#$'P$N'IIJM)&JI$

F$"Z$2S&L#MKJ>$h$4Z.Z$0'*&LO=)Y$\ABCa@$"=O=#M]Z$6+3-'F>))-E'<)@)+,3>'FB**2,-@'6+D,%?>+/3)'024D3D)@Z$6S)$.JM[I$1K%[M$/JR$7&'e)NM$\JM$>)I%Z'&ObN'>M)>Mb=%I'J*#b,JL&G2SJ>N)GfJ>GMS)Gf'VG0)#)J&NSZ%*P]W$:Z$0'T)&M#$\ABCC]@$iSQ$KL#*)K)J>'&#$KJMM)&U$5)PL>L>O$)PP)NML()$J*('NJNQ$L>$MS)$I'R)&$N&LKL>JI$N'=&M#@$JV?V'(+CD@'K+L'<)CD)L@$89\A]@$ADDGHDA$\#))$%%Z$HBBGHBC$JM$IJR&)(L)RZIJRZ=N*J(L#Z)*=bL##=)#b`^bAb"&MLNI)#b`^GAg:)>>Qg0'T)&M#Z%*P]W$:Z$8NSKLMM$h$lZ$iJ&>)&$\ABCB]@$WX%Y11)/I),@'+/I'->)'K+M2,'Z+,;)-5$2)>M)&$P'&$1N'>Z$h$7'ILNQ$0)#)J&NS$\JM$N)%&Z>)Mb*'N=K)>M#b%=TILNJML'>#b)VG'PP)>*)&#GABCBGCCZ%*P]Z$?$1Z$"Z$2J&#'>$\ABC^@$8)%M)KT)&]@$0,D@2/),@'D/'!"#8@$f=&)J=$'P$:=#MLN)$8MJML#MLN#@$;Z8Z$5)%MZ$'P$:=#MLN)$\&)%'&ML>O$'>$%Z$C^$MSJM$J#$'P$5)N)KT)&$HC@$ABC`@$TIJN_$K)>$J&)$LK%&L#'>)*$L>$#MJM)$J>*$P)*)&JI$PJNLILML)#$JM$J$&JM)$'P$A@DA`$%)&$CBB@BBB@$9L#%J>LN$K)>$J&)$LK%&L#'>)*$JM$J$&JM)$'P$C@B?C$%)&$CBB@BBB@$J>*$RSLM)$K)>$J&)$LK%&L#'>)*$JM$J$&JM)$'P$à^$%)&$CBB@BBBW$#LKLIJ&$*L#%J&LML)#$)VL#M$P'&$R'K)>]$\JM$Te#ZO'(bN'>M)>Mb%=Tb%*Pb%C`Z%*P]W$J>*$;Z$8Z$1X=JI$3%%'&M=>LMQ$2'KKL##L'>$\ABCA@$"%&LI$A^]@$W/12,3).)/-'[BDI+/3)'2/'->)'?2/@DI),+-D2/'21'\,,)@-'+/I'?2/CD3-D2/'<)32,I@'D/'W.*42H.)/-'()3D@D2/@'J/I),'=D-4)']PP'21'->)'?DCD4'<DU>-@'\3-'21'#TS8$\#))$j-Z$8=KKJ&Qk$JM$))'NZO'(bIJR#bO=L*J>N)bJ&&)#MgN'>(LNML'>ZNPK]Z$CB$j!-+P$J$ILN)>#L>O$)>MLMQ$L>$MLMI)$CB$'&$CA@$2Z0Z8Z@$*)M)&KL>)#$MSJM$J>$J%%ILNJ>M$P'&$ILN)>#=&)$SJ#$J$N&LKL>JI$&)N'&*@$MS)$ILN)>#L>O$)>MLMQ$L#$O'()&>)*$TQ$#)NML'>$A`G^GCBC$P'&$%=&%'#)#$'P$O&J>ML>O$'&$*)>QL>O$ILN)>#=&)$'&$%IJNL>O$J>Q$N'>*LML'>#$'>$ILN)>#=&)Zk$$m$A`GH`GCBA\FZD]@$2Z0Z8Z$ABCaZ$CC$m$A`G^GCBC\A]@$2Z0Z8Z$ABCaZ$$$CA$m$A`G^GCBC\H]@$GCBC\`]@$2Z0Z8Z$ABCaZ$CH$m$A`G^GCBC\C]@$GCBC\A]@$2Z0Z8Z$ABCaZ$C`$m$A`G^GCBC\H]\*]@$GCBC\`]@$2Z0Z8Z$ABCaZ$C^$j"$%J&*'>$L##=)*$TQ$MS)$O'()&>'&$#SJII$RJL()$JII$N'IIJM)&JI$N'>#)X=)>N)#$J##'NLJM)*$RLMS$)JNS$N'>(LNML'>$P'&$RSLNS$MS)$%)&#'>$&)N)L()*$J$%J&*'>$=>I)##$MS)$%J&*'>$ILKLM#$MS)$#N'%)$'P$MS)$%J&*'>$&)OJ&*L>O$N'IIJM)&JI$N'>#)X=)>N)#Zk$$m$CaGCDGCBH@$2Z0Z8Z$ABCaZ$Ca$8MJM)$J>*$I'NJI$O'()&>K)>M$JO)>NL)#$J&)$O)>)&JIIQ$P'&TL**)>$P&'K$J#_L>O$J%%ILNJ>M#$M'$*L#NI'#)$L>P'&KJML'>$L>$&)N'&*#$MSJM$R)&)$#)JI)*$*=)$M'$>'>G%&'#)N=ML'>@$*L#KL##JI@$'&$JNX=LMMJIZ$$m$A`GDAGDBA\C]\J]@$GDBA\C]\P]@$2Z0Z8Z$ABCaZ$$8MJM)$J>*$I'NJI$O'()&>K)>M$JO)>NL)#$J&)$JI#'$O)>)&JIIQ$P'&TL**)>$P&'K$J#_L>O$J%%ILNJ>M#$M'$*L#NI'#)$L>P'&KJML'>$L>$#)JI)*$&)N'&*#$&)IJML>O$M'$

CCJJ | Appendices

113

!"#$"%%&'()*+! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BH$$$$$$$$$$$2'I'&J*'$2'KKL##L'>$'>$2&LKL>JI$J>*$:=()>LI)$:=#MLN)$$$$$$$$$$$$$$:=>)$?@$ABCD$ 7JO)$2$'P$2$

&)IL)P@$RSLNS$NJ>$T)$L##=)*$TQ$N'=&M#$M'$&)IL)()$)ILOLTI)$L>*L(L*=JI#$'P$#MJM)$LK%'#)*$N'IIJM)&JI$N'>#)X=)>N)#ZCD$$6SL&*@$MS)$#NJ>M$)VL#ML>O$O=L*J>N)$P'&$ILN)>#=&)$*)NL#L'>#$J%%IL)#$'>IQ$RS)>$J$#MJM)$'&$I'NJI$JO)>NQ$L#$&)X=L&)*$M'$KJ_)$J$PL>*L>O$MSJM$MS)$J%%ILNJ>M$jL#$J$%)&#'>$'P$O''*$K'&JI$NSJ&JNM)&$J#$J$N'>*LML'>$M'$MS)$L##=J>N)$MS)&)'P$nkCF$$4'#M$'P$MS)$#MJM=M)#$O'()&>L>O$#MJM)$ILN)>#=&)$*)NL#L'>#$*'$>'M$&)X=L&)$J>$)(JI=JML'>$'P$RS)MS)&$J$%)&#'>$L#$'P$jO''*$K'&JI$NSJ&JNM)&Zk$$6S)Q$#LK%IQ$JII'R$J*()&#)$ILN)>#=&)$JNML'>$M'$T)$MJ_)>$'>$MS)$TJ#L#$'P$J$%&L'&$'PP)>#)Z$$$$,L>JIIQ@$MS)$O=L*J>N)$P'&$T'MS$)K%I'QK)>M$J>*$ILN)>#=&)$J%%IL)#$'>IQ$M'$*L#N&)ML'>J&Q$JO)>NQ$*)NL#L'>#Z$$-M$*')#$>'M$J%%IQ$LP$MS)&)$L#$J$#%)NLPLN$#MJM=M'&Q$%&'SLTLML'>$MSJM$%&)()>M#$J>$L>*L(L*=JI$P&'K$'TMJL>L>O$)K%I'QK)>M$'&$ILN)>#=&)ZC?$$$$->P'&KJML'>$'TMJL>)*$P&'K$530"$L>*LNJM)#$MSJM$LM#$(J&L'=#$&)O=IJM'&Q$%&'O&JK#$*'$>'M$SJ()$J$RL*)#%&)J*$%&JNMLN)$'P$*)>QL>O$ILN)>#=&)$TJ#)*$'>$J$%J#M$N&LKL>JI$SL#M'&QZ$$6S'#)$%&'O&JK#$RLII@$S'R)()&@$&)O=IJ&IQ$L##=)$ILN)>#)#$'>$J$N'>*LML'>JI$'&$%&'TJML'>J&Q$#MJM=#$TJ#)*$'>$#=NS$J$SL#M'&QZ$$6SL#$&)#=IM#$L>$J$&)N'&*$'P$MS)$L>*L(L*=JI[#$N&LKL>JI$SL#M'&Q$T)L>O$%=TILNIQ$JNN)##LTI)$MS&'=OS$530"[#$R)T#LM)Z$$530"$*')#$>'M$SJ()$MS)$%'R)&$M'$)()&$&)K'()$%=TILN$JNN)##$M'$MSJM$L>P'&KJML'>Z$$$&G67!<4A;CC4@?986;@!6@AB:?47!;@4!@;@$7898:8;<=!4B4C4@8H!.3!!I@A<4974!8<9@7D9<4@A=!;J!9>4@A=!D;B6A6473!8MJM)$)K%I'QK)>M$J>*$ILN)>#L>O$*)NL#L'>#$J&)$KJ*)$TQ$S=>*&)*#$'P$%)'%I)$RS'$#)&()$'>$(J&L'=#$&)O=IJM'&Q$T'J&*#Z$$6'$JNSL)()$N'>#L#M)>M@$PJL&@$J>*$%&'*=NML()$&)#=IM#@$MS)Q$#S'=I*$SJ()$O=L*J>N)$'>$S'R$M'$)(JI=JM)$MS)$LK%JNM$'P$J%%ILNJ>M#[$N&LKL>JI$SL#M'&QZ$$$$22::$&)N'KK)>*#$MSJM$530"$*)()I'%$J$R&LMM)>$%'ILNQ$'>$S'R$#MJM)$JO)>NL)#$#S'=I*$LK%I)K)>M$#)NML'>$A`G^GCBC$J>*$#)NML'>$A`GHAGCBA\FZD]Z$$6S)$%'ILNQ$#S'=I*$%&'(L*)$NI)J&$O=L*J>N)$'>$S'R$J>$J%%ILNJ>M[#$N&LKL>JI$&)N'&*$KJQ$LK%JNM$#MJM)$)K%I'QK)>M$J>*$ILN)>#=&)$*)NL#L'>#@$J>*$#S'=I*$T)$J(JLIJTI)$M'$MS)$%=TILN$'>$530"[#$R)T#LM)Z$$&G67!<4A;CC4@?986;@!6@AB:?47!J654!7898:8;<=!4B4C4@87H!.3!!(C4@?!74A86;@!FK$L$.1.3!F3!!#CD;M4<!E,"(!8;!?4B678!A4<896@!A;@?686;@9B!B6A4@7473!23!!-;BB4A8!?9893!K3!!#@A;:<9>4!8G4!4B6C6@986;@!;J!:@@4A4779<=!C9@?98;<=!A;BB984<9B!A;@74N:4@A473!L3!!I@A4@8656O4!;DD;<8:@68=!4PD9@76;@!Q=!78984!A;@8<9A8;<73!

N)&MJL>$N'>M&'II)*$#=T#MJ>N)@$%)MMQ$'PP)>#)@$J>*$K=>LNL%JI$'PP)>#)$N'>(LNML'>#Z$$m$A`GDAGDBH\`]\*]\-]@$2Z0Z8Z$ABCaZ$$iLMS$MS)$)VN)%ML'>$'P$N)&MJL>$N'>M&'II)*$#=T#MJ>N)$J>*$S=KJ>$M&JPPLN_L>O$&)IJM)*$'PP)>#)#@$MS)$#)JIL>O$'P$J$&)N'&*$&)PI)NM#$MSJM$J$e=*O)$SJ#$JI&)J*Q$*)M)&KL>)*$MSJM$MS)$SJ&K$M'$MS)$L>*L(L*=JI[#$%&L(JNQ$'=MR)LOS#$MS)$%=TILN[#$L>M)&)#M$L>$MS)$J(JLIJTLILMQ$'P$MS)$&)N'&*Z$$mm$A`GDAGDBA\C]\T]\--]\f]@$GDB`\C]\N]@$GDB^@$GDBa@$GDBF\H]@$2Z0Z8Z$ABCaZ$CD$F))$mm$CFGCZHGCBD@$CFGCZHGACH@$CFGCZHGHBH@$2Z0Z8Z$ABCaZ$$6S)$8MJM)$'P$.)R$E'&_$SJ#$I'>O$L##=)*$N)&MLPLNJM)#$#LKLIJ&$M'$2'I'&J*'[#$'&*)&#$'P$N'IIJM)&JI$&)IL)PZ$$6S)&)@$S'R)()&@$%=TILN$JO)>NL)#$J>*$%&L(JM)$)K%I'Q)&#$J&)$&)X=L&)*$M'$OL()$N'>#L*)&JML'>$M'$#=NS$N)&MLPLNJM)#Z$$.ZEZ$2'&&)NMZ$/JR$m$D^H\A]Z$$3MS)&$#MJM)#$SJ()$#LKLIJ&$K)NSJ>L#K#Z$$F))$2'>>Z$c)>Z$8MJMZ$m$^`GCHB)\T]W$DHB$-IIZ$2'K%Z$8MJMZ$">>Z$^b^G^Z^GC^W$.Z2Z$c)>Z$8MJMZ$m$C^"GCDHZAW$3SL'Z$0)(Z$2'*)$">>Z$m$A?^HZA^Z$CF$m$A`G^GCBC\A]@$2Z0Z8Z$ABCaZ$$$C?$mm$A`G^GCBC\H]\J]@$A`GH`GCBA\FZD]@$2Z0Z8Z$ABCaZ$$$

114


!"#$"%%&'()*+! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BH$$$$$$$$$$$2'I'&J*'$2'KKL##L'>$'>$2&LKL>JI$J>*$:=()>LI)$:=#MLN)$$$$$$$$$$$$$$:=>)$?@$ABCD$ 7JO)$K$'P$K$

R<;D;74?!)898:8;<=!S9@>:9>4!6S)#)$%&'%'#)*$NSJ>O)#$J**&)##$J>*$&)NMLPQ$MS)$L##=)#$*)IL>)JM)*$JT'()Z$$6S)Q$KJ_)$NI)J&$MSJM$MS)$#JK)$#MJ>*J&*#$O'()&>$J>$JO)>NQ[#$)(JI=JML'>$'P$J>$J%%ILNJ>M[#$N&LKL>JI$&)N'&*@$RS)MS)&$MSJM$J%%ILNJML'>$L#$P'&$#MJM)$)K%I'QK)>M$'&$#MJM)$ILN)>#=&)Z$$6S)Q$JI#'$OL()$K)J>L>O$M'$2'I'&J*'[#$)VL#ML>O$#MJM=M'&Q$%&'(L#L'>#$P'&$&)N'&*$#)JIL>O@$)V%=>O)K)>M@$%J&*'>#@$J>*$'&*)&#$'P$N'IIJM)&JI$&)IL)PZ$$$$$$6S)$NSJ>O)#$R'=I*$JI#'$OL()$530"$MS)$JTLILMQ$M'$L##=)$J$N'>*LML'>JI$ILN)>#)$*=)$M'$J>$J%%ILNJ>M[#$N&LKL>JI$SL#M'&Q@$T=M$IJM)&$O&J>M$MS)$P=II$T)>)PLM#$'P$ILN)>#=&)$TQ$*)IL#ML>O$MS)$N'>*LML'>JI$ILN)>#=&)$JPM)&$J$%)&L'*$'P$MLK)$SJ#$)IJ%#)*Z$$"**LML'>JIIQ@$MS)Q$R'=I*$N&)JM)$J>$L>N)>ML()$P'&$)K%I'Q)&#$RS'$N'>M&JNM$RLMS$MS)$8MJM)$M'$%&'(L*)$J$PJL&$NSJ>N)$M'$L>*L(L*=JI#$RLMS$J$&)N'&*Z$$6'O)MS)&@$MS)#)$NSJ>O)#$JLK$M'$)>#=&)$MSJM$&)N'&*GTJ#)*$&)#M&LNML'>#$'>$#MJM)$)K%I'QK)>M$J>*$ILN)>#L>O$J&)$T'MS$PJL&$M'$L>*L(L*=JI#$J>*$%&'*=NML()$M'$MS)$#JP)MQ$J>*$R)IPJ&)$'P$2'I'&J*'$#'NL)MQZ$$$$.3!!(C4@?!74A86;@!FK$L$.1.!97!J;BB;M73!QW/-D,)'@)3-D2/'D@'D/34BI)I'12,',)1),)/3)VR!$

\C]\J]$1VN)%M$J#$'MS)&RL#)$%&'(L*)*$L>$%J&JO&J%S$\T]$'P$MSL#$#=T#)NML'>$\C]@$MS)$PJNM$MSJM$J$%)&#'>$SJ#$T))>$N'>(LNM)*$'P$J$P)I'>Q$'&$'MS)&$'PP)>#)$L>('I(L>O$K'&JI$M=&%LM=*)$#SJII$>'M@$L>$J>*$'P$LM#)IP@$%&)()>M$MS)$%)&#'>$P&'K$J%%IQL>O$P'&$J>*$'TMJL>L>O$%=TILN$)K%I'QK)>M$'&$P&'K$J%%IQL>O$P'&$J>*$&)N)L(L>O$J$ILN)>#)@$N)&MLPLNJML'>@$%)&KLM@$'&$&)OL#M&JML'>$&)X=L&)*$TQ$MS)$IJR#$'P$MSL#$#MJM)$M'$P'II'R$J>Q$T=#L>)##@$'NN=%JML'>@$'&$%&'P)##L'>Z$\T]$6SL#$#=T#)NML'>$\C]$#SJII$>'M$J%%IQ$M'U$\-]$6S)$'PPLN)#$J>*$N'>(LNML'>#$*)#N&LT)*$L>$#)NML'>$`$'P$J&MLNI)$o--$'P$MS)$#MJM)$N'>#MLM=ML'>W$\--]$6S)$N)&MLPLNJML'>$J>*$&)('NJML'>$'P$N)&MLPLNJML'>$'P$%)JN)$'PPLN)&#$J#$%&'(L*)*$L>$#)NML'>$A`GHCGHB^W$\---]$6S)$)K%I'QK)>M$'P$%)&#'>>)I$L>$%'#LML'>#$L>('I(L>O$*L&)NM$N'>MJNM$RLMS$(=I>)&JTI)$%)&#'>#$J#$#%)NLPL)*$L>$#)NML'>$ADG?BGCCC@$2Z0Z8ZW$\-<]$6S)$ILN)>#=&)$'&$J=MS'&LYJML'>$'P$)*=NJM'&#$%&'SLTLM)*$%=&#=J>M$M'$#)NML'>$AAGaBZ^GCBD\A]@$\AZ^]@$'&$\AZa]@$2Z0Z8ZW$\<]$6S)$)K%I'QK)>M$'P$%)&#'>#$L>$%=TILN$'&$%&L(JM)$N'&&)NML'>JI$PJNLILML)#$%=&#=J>M$M'$MS)$%&'(L#L'>#$'P$#)NML'>#$CDGCGCB?Z^$J>*$CDGCGABA\C]\J]\-]$J>*$\CZ^]@$2Z0Z8Z@$J>*$MS)$)K%I'QK)>M$'P$%)&#'>#$L>$%=TILN$'&$%&L(JM)$e=()>LI)$PJNLILML)#$%=&#=J>M$M'$MS)$%&'(L#L'>#$'P$#)NML'>#$C?GAG`BHZH$J>*$C?GAG`CB\`]@$2Z0Z8ZW$\<-]$6S)$)K%I'QK)>M$'P$%)&#'>#$TQ$MS)$%=TILN$)K%I'Q))#p$&)ML&)K)>M$J##'NLJML'>$N&)JM)*$%=&#=J>M$M'$#)NML'>$A`G^CGABC$RS'@$=%'>$MS)$N'KK)>N)K)>M$'P$MSJM$)K%I'QK)>M@$RLII$SJ()$JNN)##$M'$J##'NLJML'>$L>()#MK)>M$L>P'&KJML'>@$J##'NLJML'>$J##)M#@$'&$PL>J>NLJI@$*)K'O&J%SLN@$'&$'MS)&$L>P'&KJML'>$&)IJML>O$M'$J##'NLJML'>$K)KT)&#$'&$T)>)PLNLJ&L)#W$J>*$\<--]$6S)$)K%I'QK)>M$'P$%)&#'>#$TQ$MS)$*)%J&MK)>M$'P$%=TILN$#JP)MQ$J>*$MS)$*)%J&MK)>M$'P$N'&&)NML'>#Z$$\A]T(U!iS)>)()&$J>Q$#MJM)$'&$I'NJI$JO)>NQ$L#$&)X=L&)*$M'$KJ_)$J$PL>*L>O$MSJM$J>$J%%ILNJ>M$P'&$J$ILN)>#)@$N)&MLPLNJML'>@$%)&KLM@$'&$&)OL#M&JML'>$L#$J$%)&#'>$'P$O''*$K'&JI$NSJ&JNM)&$J#$J$N'>*LML'>$M'$MS)$L##=J>N)$MS)&)'P@$,"!#V(SW(&#!&X#!IYR(-&!,+!(%!

CCJJ | Appendices

115

!"#$"%%&'()*+! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BH$$$$$$$$$$$2'I'&J*'$2'KKL##L'>$'>$2&LKL>JI$J>*$:=()>LI)$:=#MLN)$$$$$$$$$$$$$$:=>)$?@$ABCD$ 7JO)$L$'P$L$

(RRSI-(%&Z)!-"IYI%(S!"#-,"E[$MS)$PJNM$MSJM$#=NS$J%%ILNJ>M$SJ#@$JM$#'K)$MLK)$%&L'&$MS)&)M'@$T))>$N'>(LNM)*$'P$J$P)I'>Q$'&$'MS)&$'PP)>#)$L>('I(L>O$K'&JI$M=&%LM=*)@$J>*$%)&ML>)>M$NL&N=K#MJ>N)#$N'>>)NM)*$RLMS$#=NS$N'>(LNML'>@$#SJII$T)$OL()>$N'>#L*)&JML'>$L>$*)M)&KL>L>O$RS)MS)&@$L>$PJNM@$MS)$J%%ILNJ>M$L#$\W(SI+I#EZ$J$%)&#'>$'P$O''*$K'&JI$NSJ&JNM)&$JM$MS)$MLK)$'P$MS)$J%%ILNJML'>Z$6S)$L>M)>M$'P$MSL#$#)NML'>$L#$M'$)V%J>*$)K%I'QK)>M$'%%'&M=>LML)#$P'&$%)&#'>#$RS'@$>'MRLMS#MJ>*L>O$MSJM$PJNM$'P$N'>(LNML'>$'P$J>$'PP)>#)@$SJ()$T))>$&)SJTLILMJM)*$J>*$J&)$&)J*Q$M'$JNN)%M$MS)$&)#%'>#LTLILML)#$'P$J$IJRGJTL*L>O$J>*$%&'*=NML()$K)KT)&$'P$#'NL)MQZ$T]U!I+!&X#!(^#%-'!E#&#"YI%#)!&X(&!&X#!(RRSI-(%&!X()!]##%!(""#)&#E!,"!-X("^#E!]W&!%,&!-,%VI-&#E!,+!(!-"IYI%(S!,++#%)#!(%E!&X#!-"IYI%(S!-()#!I)!%,&!(-&IV#S'!R#%EI%^[!&X(&!&X#!(RRSI-(%&!X()!]##%!-,%VI-&#E!]W&!R("E,%#E[!&X(&!&X#!(RRSI-(%&!X()!]##%!-,%VI-&#E!]W&!"#-,"E)!,+!&X#!-,%VI-&I,%!X(V#!]##%!)#(S#E!,"!#_RW%^#E[!,"!&X(&!(!-,W"&!X()!I))W#E!(%!,"E#"!,+!-,SS(&#"(S!"#SI#+!)R#-I+I-!&,!&X#!-"#E#%&I(S!),W^X&[!&X#!(^#%-'!)X(SS!%,&!W)#!&X(&!I%+,"Y(&I,%!()!(!]()I)!+,"!E#%I(S!,"!+,"!&(*I%^!(%'!(EV#")#!(-&I,%!(^(I%)&!&X#!(RRSI-(%&3!T-U!I+!&X#!(^#%-'!E#&#"YI%#)!&X(&!&X#!(RRSI-(%&!X()!X(E!(%'!,&X#"!-"IYI%(S!-,%VI-&I,%[!I&!)X(SS!]#!^,V#"%#E!]'!)W])#-&I,%!TKU!,+!&XI)!)#-&I,%3!$\H]\J]$;>I)##$#MJM=M)$%&'SLTLM#$MS)$)K%I'QK)>M$'P$J$%)&#'>$RLMS$J$#%)NLPLN$N&LKL>JI$N'>(LNML'>$P'&$J$%J&MLN=IJ&$%'#LML'>@$J>$JO)>NQ$#SJII$>'M$J*()&ML#)$MS)$%'#LML'>$RLMS$J$#MJM)K)>M$MSJM$J$%)&#'>$RLMS$J$N&LKL>JI$&)N'&*$KJQ$>'M$J%%IQ$P'&$MS)$%'#LML'>$'&$%IJN)$'>$MS)$J%%ILNJML'>$J$#MJM)K)>M$MSJM$J$%)&#'>$RLMS$J$N&LKL>JI$&)N'&*$KJQ$>'M$J%%IQ$P'&$MS)$%'#LML'>Z$\T]$iLMS$MS)$)VN)%ML'>$'P$MS)$*)%J&MK)>M$'P$N'&&)NML'>#$J>*$MS)$*)%J&MK)>M$'P$%=TILN$#JP)MQ@$MS)$JO)>NQ$#SJII$>'M$%)&P'&K$J$TJN_O&'=>*$NS)N_$=>MLI$MS)$JO)>NQ$*)M)&KL>)#$MSJM$J>$J%%ILNJ>M$L#$J$PL>JIL#M$'&$KJ_)#$J$N'>*LML'>JI$'PP)&$'P$)K%I'QK)>M$M'$MS)$J%%ILNJ>MZ$\N]$-P@$JPM)&$*)M)&KL>L>O$MSJM$J>$J%%ILNJ>M$L#$J$PL>JIL#M$'&$JPM)&$KJ_L>O$J$N'>*LML'>JI$'PP)&$'P$)K%I'QK)>M$M'$J>$J%%ILNJ>M@$MS)$JO)>NQ$*)M)&KL>)#$MSJM$MS)$J%%ILNJ>M$SJ#$T))>$J&&)#M)*$'&$NSJ&O)*$T=M$>'M$N'>(LNM)*$'P$J$N&LKL>JI$'PP)>#)$J>*$MS)$N&LKL>JI$NJ#)$L#$>'M$JNML()IQ$%)>*L>O@$&X(&!&X#!(RRSI-(%&!X()!]##%!-,%VI-&#E!]W&!R("E,%#E[!&X(&!&X#!(RRSI-(%&!X()!]##%!-,%VI-&#E!]W&!"#-,"E)!,+!&X#!-,%VI-&I,%!X(V#!]##%!)#(S#E!,"!#_RW%^#E[!,"!&X(&!(!-,W"&!X()!I))W#E!(%!,"E#"!,+!-,SS(&#"(S!"#SI#+!)R#-I+I-!&,!&X#!#YRS,'Y#%&!),W^X&[!MS)$JO)>NQ$#SJII$>'M$=#)$MSJM$L>P'&KJML'>$J#$J$TJ#L#$P'&$>'M$KJ_L>O$J>$'PP)&$'P$)K%I'QK)>M$'&$P'&$RLMS*&JRL>O$MS)$N'>*LML'>JI$'PP)&$'P$)K%I'QK)>MZ$\*]$-P@$JPM)&$*)M)&KL>L>O$MSJM$J>$J%%ILNJ>M$L#$J$PL>JIL#M$'&$KJ_L>O$J$N'>*LML'>JI$'PP)&$'P$)K%I'QK)>M$M'$J>$J%%ILNJ>M@$MS)$JO)>NQ$*)M)&KL>)#$MSJM$MS)$J%%ILNJ>M$SJ#$SJ*$(%'!,&X#"!-"IYI%(S!-,%VI-&I,%[!I&!)X(SS!]#!^,V#"%#E!]'!)W])#-&I,%!TKU!,+!&XI)!)#-&I,%3!J$N&LKL>JI$N'>(LNML'>$)V%=>O)*$'&$#)JI)*$P&'K$SL#$'&$S)&$&)N'&*@$&)N)L()*$J$%J&*'>@$'&$MSJM$NSJ&O)#$R)&)$*L#KL##)*$%=&#=J>M$M'$#=NN)##P=IIQ$N'K%I)ML>O$J$*)P)&&)*$e=*OK)>M$'&$#)>M)>N)@$MS)$JO)>NQ$#SJII$>'M$=#)$MSJM$L>P'&KJML'>$J#$J$TJ#L#$P'&$>'M$KJ_L>O$J>$'PP)&$'P$)K%I'QK)>M$'&$P'&$RLMS*&JRL>O$MS)$N'>*LML'>JI$'PP)&$'P$)K%I'QK)>M$

116


!"#$"%%&'()*+! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BH$$$$$$$$$$$2'I'&J*'$2'KKL##L'>$'>$2&LKL>JI$J>*$:=()>LI)$:=#MLN)$$$$$$$$$$$$$$:=>)$?@$ABCD$ 7JO)$`$'P$`$

=>I)##@$JPM)&$&)(L)RL>O$MS)$PJNM'&#$L>$#=T#)NML'>$\`]$'P$MSL#$#)NML'>@$MS)$JO)>NQ$*)M)&KL>)#$MSJM$MS)$J%%ILNJ>M$#S'=I*$T)$*L#X=JILPL)*$P'&$MS)$%'#LML'>Z$\)]$.'MSL>O$L>$MSL#$#)NML'>$%&)()>M#$J>$JO)>NQ$P&'K$N'>#L*)&L>O$N&LKL>JI$SL#M'&Q$L>P'&KJML'>$MSJM$MS)$J%%ILNJ>M$('I=>MJ&LIQ$%&'(L*)#Z$$\`]$1VN)%M$J#$%&'(L*)*$L>$#=T#)NML'>$\a]$'P$MSL#$#)NML'>@$LP$JPM)&$*)M)&KL>L>O$MSJM$J>$J%%ILNJ>M$L#$J$PL>JIL#M$'&$KJ_L>O$J$N'>*LML'>JI$'PP)&$'P$)K%I'QK)>M$M'$J>$J%%ILNJ>M@$MS)$JO)>NQ$*)M)&KL>)#$MSJM$MS)$J%%ILNJ>M$SJ#$T))>$N'>(LNM)*$'P$J$N&LK)$,&X#"!&X(%!()!E#)-"I]#E!I%!R("(^"(RX)!TFUT]U!,"!T2UT-U!,+!&XI)!)#-&I,%[$MS)$JO)>NQ$#SJII$N'>#L*)&$MS)$P'II'RL>O$PJNM'&#$RS)>$*)M)&KL>L>O$RS)MS)&$MS)$N'>(LNML'>$*L#X=JILPL)#$MS)$J%%ILNJ>MU$P'&$MS)$%'#LML'>U$\J]$6S)$>JM=&)$'P$MS)$N'>(LNML'>W$\T]$iS)MS)&$MS)&)$L#$J$*L&)NM$&)IJML'>#SL%$T)MR))>$MS)$N'>(LNML'>$J>*$MS)$%'#LML'>p#$*=ML)#$J>*$&)#%'>#LTLILML)#$J>*$MS)$T)J&L>O@$LP$J>Q@$MS)$N'>(LNML'>$KJQ$SJ()$'>$MS)$J%%ILNJ>Mp#$PLM>)##$'&$JTLILMQ$M'$%)&P'&K$'>)$'&$K'&)$#=NS$*=ML)#$J>*$&)#%'>#LTLILML)#@$L>NI=*L>O$RS)MS)&$MS)$N'>(LNML'>$RJ#$P'&$=>IJRP=I$#)V=JI$T)SJ(L'&$J#$IL#M)*$L>$#)NML'>$CaGAAGCBA\?]@$2Z0Z8Z@$J>*$RS)MS)&$MS)$*=ML)#$'P$)K%I'QK)>M$R'=I*$%IJN)$J$N'GR'&_)&$'&$MS)$%=TILN$L>$J$(=I>)&JTI)$%'#LML'>W$\N]$">Q$L>P'&KJML'>$%&'*=N)*$TQ$MS)$J%%ILNJ>M$'&$%&'*=N)*$'>$SL#$'&$S)&$T)SJIP$&)OJ&*L>O$SL#$'&$S)&$&)SJTLILMJML'>$J>*$O''*$N'>*=NMW$J>*$\*]$6S)$MLK)$MSJM$SJ#$)IJ%#)*$#L>N)$MS)$N'>(LNML'>Z$$\^]$.'MRLMS#MJ>*L>O$J>Q$'MS)&$%&'(L#L'>$'P$IJR$M'$MS)$N'>M&J&Q@$MS)$%&'(L#L'>#$'P$MSL#$#)NML'>$J%%IQ$M'$MS)$'PPLN)$'P$MS)$O'()&>'&Z$$\a]$-P@$JM$J>Q$#MJO)$L>$MS)$SL&L>O$%&'N)##@$MS)$*)%J&MK)>M$'P$N'&&)NML'>#$'&$MS)$*)%J&MK)>M$'P$%=TILN$#JP)MQ$*)M)&KL>)#$MSJM$MS)$J%%ILNJ>M$SJ#$T))>$N'>(LNM)*$'P$J$N&LK)@$MS)$*)%J&MK)>M$K=#M$N'>#L*)&$MS)$PJNM'&#$IL#M)*$L>$%J&JO&J%S#$\J]$M'$\*]$'P$#=T#)NML'>$\`]$'P$MSL#$#)NML'>$RS)>$*)M)&KL>L>O$RS)MS)&$MS)$N'>(LNML'>$*L#X=JILPL)#$MS)$J%%ILNJ>M$P'&$MS)$%'#LML'>Z$

$F3!!#CD;M4<!E,"(!8;!?4B678!A4<896@!A;@?686;@9B!B6A4@7473!$$ iS)>$J>$L>*L(L*=JI$RLMS$J$N&LKL>JI$SL#M'&Q$J%%IL)#$P'&$ILN)>#=&)$M'$%&JNMLN)$J$%&'P)##L'>@$&)O=IJM'&Q$JO)>NL)#$KJQ$#'K)MLK)#$SJ()$N'>N)&>#$JT'=M$MS)$LK%JNM$'P$MSJM$SL#M'&Q$'>$MS)$L>*L(L*=JI[#$JTLILMQ$M'$*'$#'Z$$3>N)$MS'#)$N'>N)&>#$SJ()$T))>$%&'()>$=>P'=>*)*@$S'R)()&@$MS)$L>*L(L*=JI$#S'=I*$T)$%)&KLMM)*$J$P=II$'%%'&M=>LMQ$M'$#=NN))*$L>$SL#$'&$S)&$NS'#)>$%&'P)##L'>Z$$22::$MS=#$&)N'KK)>*#$J**L>O$J$>)R$#=T#)NML'>$\^]$M'$MS)$P'II'RL>O$#)NML'>$A`GH`GCBD@$2Z0Z8Z$ABCaUAB$$

\^]$iS)>$J>Q$*L(L#L'>@$T'J&*@$'&$JO)>NQ$'P$MS)$*)%J&MK)>M$'P$&)O=IJM'&Q$JO)>NL)#$*)M)&KL>)#$MSJM$J>$L>*L(L*=JI$J%%IQL>O$P'&$J$ILN)>#)$SJ#$T))>$N'>(LNM)*$'P$J$N&LK)$%&L'&$

AB$8)NML'>$A`GH`GCBD@$2Z0Z8Z$ABCa$L#$MLMI)*$j"%%ILNJML'>#$P'&$ILN)>#)#$q$J=MS'&LMQ$M'$#=#%)>*$ILN)>#)#$q$&=I)#Zk$$-M$%&)#N&LT)#$IJRP=I$%&)#)>N)$J#$J$N'>*LML'>$'P$ILN)>#=&)@$J>*$OL()#$530"$MS)$%'R)&$M'$*)>Q$'&$&)('_)$J$ILN)>#)$'>$MS)$TJ#L#$'P$=>%JL*$NSLI*$#=%%'&MZ$$$

CCJJ | Appendices

117

!"#$"%%&'()*+! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BH$$$$$$$$$$$2'I'&J*'$2'KKL##L'>$'>$2&LKL>JI$J>*$:=()>LI)$:=#MLN)$$$$$$$$$$$$$$:=>)$?@$ABCD$ 7JO)$a$'P$a$

M'$MS)$J%%ILNJML'>$T)L>O$#=TKLMM)*$LM$KJQ@$#=Te)NM$M'$MS)$%&'(L#L'>#$'P$#)NML'>$A`G^GCBC@$2Z0Z8Z@$L##=)$J$N'>*LML'>JI$ILN)>#)$M'$MSJM$L>*L(L*=JIZ$$-P$MS)$L>*L(L*=JI$&)KJL>#$P&))$'P$J>Q$N&LKL>JI$N'>(LNML'>$'&$ILN)>#L>O$#J>NML'>$)LMS)&$=>MLI$MS)$L>*L(L*=JI$J%%IL)#$P'&$J$&)>)RJI$'P$ILN)>#=&)$'&$P'&$MR'$Q)J&#@$RSLNS)()&$L#$#''>)&@$MS)$L>*L(L*=JI$NJ>$&)X=)#M$MSJM$MS)$N'>*LML'>JI$*)#LO>JML'>$'&$J>Q$&)IJM)*$J*()&#)$JNML'>$T)$&)K'()*Z$$6S)$*L(L#L'>@$T'J&*@$'&$JO)>NQ$#SJII$O&J>M$MS)$&)X=)#M$=>I)##$LM$*)M)&KL>)#$MSJM@$=>*)&$MS)$%&'(L#L'>#$'P$#)NML'>$A`G^GCBC@$2Z0Z8Z@$MS)$N'>*LML'>JI$*)#LO>JML'>$&)KJL>#$>)N)##J&QZ$$-P$MS)$*L(L#L'>@$T'J&*@$'&$JO)>NQ$&)K'()#$MS)$N'>*LML'>JI$*)#LO>JML'>@$LM$#SJII$KJ_)$MS)$'&LOL>JI$N'>*LML'>JI$*)#LO>JML'>$N'>PL*)>MLJI@$J>*$#SJII$&)K'()$P&'K$MS)$L>*L(L*=JI[#$%&'P)##L'>JI$SL#M'&Q$J>Q$&)P)&)>N)$M'$N&LK)#$N'KKLMM)*$T)P'&)$MS)$J%%ILNJML'>$P'&$ILN)>#=&)$RJ#$#=TKLMM)*Z$$$

$23!!-;BB4A8!?9893!$$ 530"[#$&)O=IJM'&Q$JO)>NL)#$J&)$&)X=L&)*$M'$N'II)NM$J>*$&)%'&M$*JMJ$'>$jMS)$>=KT)&$'P$ILN)>#)#$'&$N)&MLPLNJML'>#$MSJM$MS)$JO)>NQ$*)>L)*@$&)('_)*@$'&$#=#%)>*)*$TJ#)*$'>$J$*L#X=JILPLNJML'>$J>*$MS)$TJ#L#$P'&$MS)$*L#X=JILPLNJML'>ZkAC$$->P'&KJML'>$P&'K$530"$SJ#$&)()JI)*$MSJM$JO)>NL)#$J&)$>'M$#)%J&JML>O$MSJM$*JMJ$TJ#)*$'>$RS)MS)&$J>$J%%ILNJML'>$P'&$ILN)>#=&)$RJ#$*)>L)*$'>$MS)$TJ#L#$'P$J$%J#M$N&LKL>JI$SL#M'&Q@$'&$RS)MS)&$)VL#ML>O$ILN)>#=&)$RJ#$%)>JILY)*$*=)$M'$N&LKL>JI$T)SJ(L'&$TQ$J$ILN)>#)*$%)&#'>Z$$"O)>NL)#$J&)$JI#'$>'M$N'II)NML>O$*JMJ$'>$MS)$>=KT)&$'P$N'>*LML'>JI$ILN)>#)#$L##=)*$'>$MS)$TJ#L#$'P$J$N&LKL>JI$SL#M'&QZ$$6SL#$*JMJ$L#$N&LMLNJI$P'&$)(JI=JML>O$RS)MS)&$MS)$L>M)>M$'P$MS)$I)OL#IJM=&)$L#$T)L>O$&)JILY)*Z$$22::$MS=#$&)N'KK)>*#$JK)>*L>O$MS)$#MJM=M)$O'()&>L>O$530"[#$#=>#)M$&)(L)R$%&'N)##@$J#$P=&MS)&$)V%IJL>)*$L>$#MJM=M'&Q$)I)K)>M$r`Z$$K3!!#@A;:<9>4!8G4!4B6C6@986;@!;J!:@@4A4779<=!C9@?98;<=!A;BB984<9B!A;@74N:4@A473!$$ 530"[#$&)O=IJM'&Q$JO)>NL)#$J&)$#=Te)NM$M'$#=>#)M$&)(L)R$'>$J$M)>GQ)J&$NQNI)ZAA$$5=&L>O$MS)$#=>#)M$&)(L)R$%&'N)##@$'>)$PJNM'&$L>$*)M)&KL>L>O$RS)MS)&$MS)$N=&&)>M$*)O&))$'P$&)O=IJML'>$#S'=I*$N'>ML>=)$L#U$jiS)MS)&$MS)$JO)>NQ$MS&'=OS$LM#$ILN)>#L>O$'&$N)&MLPLNJML'>$%&'N)##$LK%'#)#$J>Q$*L#X=JILPLNJML'>#$'>$J%%ILNJ>M#$TJ#)*$'>$%J#M$N&LKL>JI$SL#M'&Q$J>*@$LP$#'@$RS)MS)&$MS)$*L#X=JILPLNJML'>#$#)&()$%=TILN$#JP)MQ$'&$N'KK)&NLJI$'&$N'>#=K)&$%&'M)NML'>$L>M)&)#M#ZkAH$$$ 22::$&)N'O>LY)#$MSJM$N&LKL>JI$SL#M'&Q$TJ#)*$&)#M&LNML'>#$'>$#MJM)$ILN)>#L>O$J&)$#'K)MLK)#$>)N)##J&Q@$T=M$T)IL)()#$MS)Q$#S'=I*$T)$LK%'#)*$'>$J$NJ#)GTQGNJ#)$TJ#L#Z$$4J>*JM'&Q$ILN)>#=&)$#J>NML'>#@$RSLNS$J%%IQ$J=M'KJMLNJIIQ$&)OJ&*I)##$'P$J>$L>*L(L*=JI[#$NL&N=K#MJ>N)#@$J&)$&J&)IQ$LP$)()&$J%%&'%&LJM)Z$$22::$MS=#$&)N'KK)>*#$JK)>*L>O$#=T#)NML'>$A`GH`GCB`\a]\T]\-o]$J#$P'II'R#U$$

\-o]$iS)MS)&$MS)$JO)>NQ$MS&'=OS$LM#$ILN)>#L>O$'&$N)&MLPLNJML'>$%&'N)##$LK%'#)#$J>Q$)(%-&I,%)!,"!*L#X=JILPLNJML'>#$'>$J%%ILNJ>M#$TJ#)*$'>$%J#M$N&LKL>JI$SL#M'&Q$J>*@$LP$#'@$RS)MS)&$MS)$)(%-&I,%)!,"$*L#X=JILPLNJML'>#$#)&()$%=TILN$#JP)MQ$'&$N'KK)&NLJI$'&$N'>#=K)&$%&'M)NML'>$L>M)&)#M#Z$6'$J##L#M$L>$N'>#L*)&L>O$MSL#$PJNM'&@$MS)$J>JIQ#L#$%&)%J&)*$

AC$m$A`GH`GCB`\a]\T]\-o]@$2Z0Z8Z$ABCaZ$AA$m$A`GH`GCB`\CB]$M'$GCB`\AD]@$2Z0Z8Z$ABCaZ$$AH$m$A`GH`GCB`\a]\T]\-o]@$2Z0Z8Z$ABCaZ$

118


!"#$"%%&'()*+! "#$#%&"'!&()*!+,"-#!,-."/$0123441.5"6-3.$70181.615$63$691$

23/30"53$2344-88-3.$3.$20-4-."/$".5$:;<1.-/1$:;86-21$:=>)$?@$ABCD$

,ECFG01BH$$$$$$$$$$$2'I'&J*'$2'KKL##L'>$'>$2&LKL>JI$J>*$:=()>LI)$:=#MLN)$$$$$$$$$$$$$$:=>)$?@$ABCD$ 7JO)$/$'P$/$

%=&#=J>M$M'$%J&JO&J%S$\J]$'P$#=T#)NML'>$\^]$'P$MSL#$#)NML'>$K=#M$L>NI=*)$*JMJ$'>$MS)$>=KT)&$'P$ILN)>#)#$'&$N)&MLPLNJML'>#$MSJM$MS)$JO)>NQ$*)>L)*$]()#E!,%!&X#!(RRSI-(%&Z)!-"IYI%(S!XI)&,"'[!&X#!%WY]#"!,+!-,%EI&I,%(S!SI-#%)#)!,"!-#"&I+I-(&I,%)!I))W#E!,%!&X#!]()I)!,+!&X#!(RRSI-(%&Z)!-"IYI%(S!XI)&,"'[!(%E!&X#!%WY]#"!,+!SI-#%)#)!,"!-#"&I+I-(&I,%)$&)('_)*$'&$#=#%)>*)*$TJ#)*$'>$(%!I%EIVIEW(SZ)!-"IYI%(S!-,%EW-&3$$J$*L#X=JILPLNJML'>$J>*$MS)$TJ#L#$P'&$MS)$*L#X=JILPLNJML'>Z$+,"!#(-X!)#&!,+!E(&([!&X#!(%(S')I)!YW)&!I%-SWE#!&X#!-"IYI%(S!,++#%)#)!&X(&!S#E!&,!&X#!)(%-&I,%!,"!EI)\W(SI+I-(&I,%3!&X#!(%(S')I)!YW)&!(EE"#))!bX#&X#"!(%'!Y(%E(&,"'!-,SS(&#"(S!)(%-&I,%)!IYR,)#E!-(%!]#!-,%V#"&#E!&,!EI)-"#&I,%("'!EI)\W(SI+I-(&I,%)[!()!E#+I%#E!I%!)#-&I,%!./$.32$.1a[!-3"3)3!

L3!!I@A4@8656O4!;DD;<8:@68=!4PD9@76;@!Q=!78984!A;@8<9A8;<73!$$ 2'I'&J*'[#$#MJM=M'&Q$O=L*J>N)$N'>N)&>L>O$N&LKL>JI$SL#M'&L)#$J%%IL)#$'>IQ$M'$#MJM)$ILN)>#=&)$J>*$)K%I'QK)>M$*)NL#L'>#Z$$"IMS'=OS$MSJM$O=L*J>N)$*')#$>'M$J%%IQ$M'$%&L(JM)$L>*=#M&Q@$%&L(JM)$)K%I'Q)&#$#S'=I*$T)$L>N)>ML(LY)*$M'$=#)$#LKLIJ&$%&JNMLN)#Z$$22::$&)N'KK)>*#$)#MJTIL#SL>O$J>$L>N)>ML()$K'*)I)*$JPM)&$2'I'&J*'[#$N=&&)>MIQG)VL#ML>O$%=&NSJ#L>O$%&)P)&)>N)$P'&$)>(L&'>K)>MJIIQ$%&)P)&JTI)$%&'*=NM#ZA`$$6SL#$L>N)>ML()$R'=I*$>'M$&)X=L&)$%&L(JM)$)K%I'Q)&#$M'$MJ_)$J>Q$JNML'>Z$$-M$R'=I*$#LK%IQ$)#MJTIL#S$J$#MJM)$%=&NSJ#L>O$%&)P)&)>N)$P'&$%&'*=NM#$J>*$#)&(LN)#$#'I*$TQ$)K%I'Q)&#$RS'#)$SL&L>O$J>*$&)M)>ML'>$%'ILNL)#$J&)$#=T#MJ>ML()IQ$)X=L(JI)>M$M'$MS)$8MJM)[#$%'ILNL)#$P'&$ILN)>#=&)$J>*$)K%I'QK)>M$'P$%)'%I)$RLMS$J$N&LKL>JI$SL#M'&Q@$J#$*)#N&LT)*$L>$#=T#)NML'>#$\H]$J>*$\`]$'P$#)NML'>$A`G^GCBCZ$$$

A`$m$A`GCBHGABDZ^@$2Z0Z8Z$ABCaZ$

Colorado Department of Public Safety700 Kipling Street, Suite 1000Denver, Colorado 80215http://www.colorado.gov/ccjj

CCJJ ANNUAL REPORT 2017

Documents

Colorado Commission on Criminal and Juvenile Justice: FY ... · Norm Mueller Criminal Defense Attorney Lenya Robinson Colorado Department of Health Care Policy and Financing ... legalization