Upload others
View 7
Download 0
Embed Size (px) 344 x 292 429 x 357 514 x 422 599 x 487
Citation preview
ChEMBL What does it contain?
Protein, Blast & Compound Searching
Malaria Data Neglected Tropical Disease (NTD) archive
Target & Taxonomy Browsing
Drug Approvals
Warwick Ward
Introduction - Warwick
Warwick, WMG and the Digital Laboratory · 2017-02-17 · Warwick, WMG and the Digital Laboratory. David Mullins. Location of University of Warwick. Warwick University. LONDON. BIRMINGHAM
Dr Carol Hawley Warwick Medical School University of Warwick
The Druggable Genome - EMBL-EBI · Anna Gaulton EMBL - European Bioinformatics Institute, ChEMBL Group The Druggable Genome
ControlCenter2 - Warwick
University of Warwick - Essential Warwick 2011
ChEMBL & RDKitrdkit.org/UGM/2012/Ochoa.RDKit-presentation_Final.pptx.pdfSAR Data Compound y Ki = 4.5 nM >Thrombin MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCS
Warwick Advantage
Warwick - AlienBass
ChEMBL’€¦ · DNDi ChEMBL Compound Search Results: 5961 ALogP 2.91 2.92 3.29 3.18 PSA 103.8 107.35 83.57 83.57 HBA HBD *R05 Vic. Bonds Passes Rule Of Three
Hf Warwick
ChEMBL an Open Data Resource of Medicinal Chemistry and ... ChEMBL Japan 2014.pdf · ChEMBL an Open Data Resource of Medicinal Chemistry and Patent Data John P. Overington European
Warwick neville
essential warwick
ChEMBL– Open Access Database For Drug Discovery By – Udghosh Singh M.S.(Pharm), 3 rd Sem Pharmacoinformatics
The ChEMBL bioactivity database: an update
Warwick 2011
ChEMBL database to model target of chemical compounds
Warwick Presentation
WMG - Warwick
Warwick Catalog
ChEMBL – Open Access Database For Drug Discovery
Warwick Heywood
ChEMBL & RDKit · 2012. 10. 15. · Fragment library • From a set of ChEMBL molecules, RECAP* algorithm was applied. • A filter based on the number of heavy atoms and molecular
WEST WARWICK HEALTH EQUITY ZONE · John Magiera - West Warwick Police Karen Tarasevich - West Warwick School Department Keith Remillard - West Warwick School Department
ChEMBL Database: Meeting Chemical and Biological ... · ChEMBL Database • Freely available (searchable and downloadable) resource for drug discovery • Updated regularly with new
between THE WARWICK SCHOOL COMMITTEE THE WARWICK …€¦ · XII General Conditions of Employment ... The School Committee of the City of Warwick and the Warwick Teachers' Union,
Warwick - Amplification
ChEMBL and Structural Alerts
