Upload
sawyer-eaton
View
30
Download
1
Tags:
Embed Size (px)
DESCRIPTION
Bioinformatics. Richard Tseng and Ishawar Hosamani. Outline. Homology modeling (Ishwar) Structural analysis Structure prediction Structure comparisons Cluster analysis Partitioning method Density-based method Phylogenetic analaysis. Structural Analysis. Overview Structure prediction - PowerPoint PPT Presentation
Citation preview
Outline• Homology modeling (Ishwar)• Structural analysis
– Structure prediction– Structure comparisons
• Cluster analysis– Partitioning method– Density-based method
• Phylogenetic analaysis
• Tools for protein structure prediction– Protein
• Secondary structure prediction: SSEAhttp://protein.cribi.unipd.it/ssea/
• Tertiary structure prediction: – Wurst: http://www.zbh.uni-hamburg.de/wurst/– LOOPP: http://cbsuapps.tc.cornell.edu/loopp.aspx
• WURST( Torda et al. (2004) Wurst: A protein threading server with a structural scoring function, sequence profiles and optimized substitution matrices
Nucleic Acids Res., 32, W532-W535)• Rationale
– Alignment: Sequence to structure alignments are done with a Smith-Waterman style alignment and the Gotoh algorithm
– Score function: fragment-based sequence to structure compatibility score and a pure sequence-sequence component substitution score
– Library: Dali PDB90 (24599 srtuctures)
• Tools for structure comparison– Pair structures comparison:
• TopMatch• Matras: (http://biunit.naist.jp/matras/)
– Multiple structures comparison: • 3D-surfer• Matras: (http://biunit.naist.jp/matras/)
• TopMatch (Sippl & Wiederstein (2008) A note on difficult structure alignment
problems. Bioinformatics 24, 426-427)– Rationale:
• Structure alignment: http://www.cgl.ucsf.edu/home/meng/grpmt/structalign.html
• Similarity measurement
– Input format• PDB, SCOP and CATH code• PDB structure directly
– Exercise: http://topmatch.services.came.sbg.ac.at/
2,, bababa DLLS
• 3D-surfer (David La et al. 3D-SURFER: software for high throughput protein
surface comparison and analysis. Bioinformatics , in press. (2009))– Rationale
1. Define a surface function2. Transform the surface function into a 3D Zernike description
function
– Input format• PDB and CATH code• PDB structure directly
– Exercise: http://dragon.bio.purdue.edu/3d-surfer/
,,, mlnl
mnl YrRrZ
Cluster analysis
• Goal: – Grouping the data into classes or clusters, so that
objects within a cluster have high similarity in comparison to one another but are very dissimilar to objects in other clusters.
• Methods– Partitioning method: k-means– Density-based method: Ordering Points to
Identify the Clustering Structure (OPTICS)
• k-means– Rationale: Partition n observations into k clusters
in which each observation belongs to the cluster with the nearest mean
– Exercise
http://cgm.cs.ntust.edu.tw/etrex/kMeansClustering/kMeansClustering2.html
k
i Cpi
i
mpE1
2
• OPTICS– Rationle: Partition
observations based on the density of similar objects
– Exercise
http://www.dbs.informatik.uni-muenchen.de/Forschung/KDD/Clustering/OPTICS/Demo/
Phylogenetic analysis
• Overviews– Comparisons of more than two sequences– Analysis of gene families, including functional
predictions– Estimation of evolutionary relationships among
organisms
• Theoretical tree– Parsimony method– Distance matrix method– Maximum likelihood and Bayesian method– Invariants method
• Software– Collections of toolshttp://evolution.genetics.washington.edu/phylip/software.html – A web server version for tree construction and display
• PHYLIP, http://bioweb2.pasteur.fr/phylogeny/intro-en.html • Interactive tree of life, http://itol.embl.de/
– Mostly common used stand alone software• PHYLIP, tool for evaluating similarity of nucleotide and amino
acid sequences.http://evolution.gs.washington.edu/phylip.html • TreeView, tool for visualization and manipulation of family
tree.http://taxonomy.zoology.gla.ac.uk/rod/treeview.html • Matlab - bioinformatics tool box
• Example: Alignment phylogenetic tree of Tubulin family– Searching homologous sequences of Tubulin (PDB
code: 1JFF) from RCSB protein databank• Blast for pair sequence alignment• Clustalw for comparative sequence alignment
– Evaluating protein distance matrix • using “Protdist” of PHYILIP (Particularly, Point Accepted
Mutation (PAM) matrix is used)
– Clustering proteins using “Neighbor” of PHYILIP (Neightboring-Joint method is considered)
• Example: n-distance phylogenetic tree– Evaluating n-distance matrix
• n-distance method
– Clustering proteins using “Neighbor” of PHYILIP (Neightboring-Joint method is considered)
• 16S and 18S Ribosomal RNA sequenecs of 35 organisms
Summary
• Homology modeling• Tools for structure prediction and
comparisons• Tools for phylogenetic tree construction
Thanks for your attention!!
1Z5V_A 3CB2_A 1JFF_B 1FFX_B 1TUB_B 1Z2B_B
1Z5V_A 0 0.000010 1.349411 1.349411 1.303115 1.345634
3CB2_A 0.000010 0 1.350506 1.350506 1.303115 1.346730
1JFF_B 1.349411 1.350506 0 0.000010 0.000010 0.010729
1FFX_B 1.349411 1.350506 0.000010 0 0.000010 0.010729
1TUB_B 1.303115 1.303115 0.000010 0.000010 0 0.006725
1Z2B_B 1.345634 1.346730 0.010729 0.010729 0.006725 0
•Protein distance matrix
• n-distance method– Frequency count of “n-letter words”
– n-dsiatnce matrix
– Advantage: 1. Identify fully conservative words located at nearly the
same sites2. Effecient
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNE
Nfp /
'', ppDn