Adamec, Mervis (2012) Behav Brain Res PDF

Embed Size (px)

Citation preview

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    1/14

    Behavioural Brain Research 226 (2012) 133–146

    Contents lists available at SciVerse ScienceDirect

    Behavioural Brain Research

     journal homepage: www.elsevier .com/ locate /bbr

    Research report

    Dendritic morphology of amygdala and hippocampal neurons in more and lesspredator stress responsive rats and more and less spontaneously anxioushandled controls

    Robert Adamec a,∗, Mark Heberta, Jacqueline Blundella, Ronald F. Mervis b,c

    a Memorial University, St. John’s, Newfoundland, Canada, A1B 3X9b Center of Excellence for Aging and Brain Repair, Department of Neurosurgery and Brain Repair, University of South Florida College of Medicine, Tampa, FL 33612,USAc Neurostructural Research Labs, Inc., 12409 Telecom Drive, Tampa, FL 33637,USA

    a r t i c l e i n f o

     Article history:

    Received 28 July 2011

    Received in revised form 2 September2011

    Accepted 4 September 2011

    Available online xxx

    Keywords:

    Stress

    Amygdala

    Hippocampus

    Morphology

    Resilience

    Vulnerability

    a b s t r a c t

    We investigated the neurobiological bases of variation in response to predator stress (PS). Sixteen days

    after treatment (PS or handling), rats were grouped according to anxiety in the elevated plus maze (EPM).

    Acoustic startle was also measured. We examined the structure of dendritic trees of basolateral amygdala

    (BLA) output neurons (stellate and pyramidal cells) and of dorsal hippocampal (DHC) dentate granule

    cells of less anxious (LA) and more (extremely) anxious (MA) stressed animals (PSLA and PSMA). Handled

    controls (HC) which were less anxious (HCLA) and spontaneously more anxious (HCMA) equivalently to

    predator stressed subgroups were also studied. Golgi analysis revealed BLA output neurons of  HCMA

    rats exhibited longer, more branched dendrites with higher spine density than the other groups of rats,

    which did not differ. Finally, spine density of DHC granule cells was equally depressed in HCMA and PSMA

    rats relative to HCLA and PSLA rats. Total dendritic length of  BLA pyramidal and stellate cells (positive

    predictor) and DHC spine density (negative predictor) together accounted for 96% of  the variance of 

    anxiety of handled rats. DHC spine density was a negative predictor of PSMA and PSLA anxiety, accounting

    for 70% of  the variance. Data are discussed in the context of  morphological differences as phenotypic

    markers of a genetic predisposition to anxiety in handled controls, and a possible genetic vulnerability to

    predator stress expressed as reduced spine density in the DHC. Significance of findings for animal models

    of anxiety and hyperarousal comorbidities of PTSD are discussed.

    © 2011 Elsevier B.V. All rights reserved.

    1. Introduction

    Individuals respond to stress and trauma differently. In some,

    traumatic experience leadsto posttraumatic stress disorder (PTSD)

    while others are less affected [1–3]. Relatively little is known about

    the molecular and neural substrates of individual differences in

    response to trauma [1]. However, correlational behavioral research

    implicates a variety of factors, including personality traits [4,5] as

    well as interaction of genetic factors and experiential factors, suchas reducedfunctioningpolymorphisms in theserotonin transporter

    (5-HTTLPR), and life stress or social support at the time of stress

     Abbreviations: BLA, basolateral amygdala; DHC, dorsal hippocampus; EPM,

    elevated plus maze; HC, handled control; 5-HTTLPR, reduced functioning polymor-

    phisms in the serotonin transporter; LA, less anxious; MA, more anxious; mRNA,

    messenger RNA; PS, predator stressed; PSS, predator scent stressed; PTSD, post

    traumatic stress disorder.∗ Corresponding author at: Department of Psychology, Memorial University, St.

     John’s, NL, Canada, A1B 3X9. Tel.: +1 709 737 7671; fax: +1 709 864 2430.

    E-mail address: [email protected] (R. Adamec).

    [6–8]. Moreover,the 5-HTTLPRexerts a potent modulatory effect on

    amygdala reactivity to environmental threat [6]. Since this geneti-

    cally driven effect exists in healthy subjects, Hariri and colleagues

    suggest that the 5-HTTLPR mayrepresent a susceptibility factor for

    affectivedisorders by biasing the functional reactivity of thehuman

    amygdala in the context of stressful life experiences and/or defi-

    cient cortical regulatory input [6]. Supportfor this idea comes from

    studies associating PTSD with 5-HTTLPR [8–13]. So, factors affect-

    ing functional amygdala reactivity may be important contributorsto vulnerability to stress. In this context, it is important to note

    that right amygdala reactivity to both trauma reminders and gen-

    eral negative stimuli is enhanced in humans diagnosed with PTSD

    [14,15].

    One way to identify putative causal substrates is to study the

    effects of stress on brain and behavior of more and less stress vul-

    nerable animals. A useful paradigm in this regard is exposure of 

    rodents to brief predator stress, a putative model of hyperarousal

    and generalized anxiety characteristics of PTSD [16–18]. Domes-

    ticated strains of laboratory rats retain the fear of predators like

    a cat, even if they have never been exposed to predators [19,20].

    0166-4328/$ – seefrontmatter © 2011 Elsevier B.V. All rights reserved.

    doi:10.1016/j.bbr.2011.09.009

    http://localhost/var/www/apps/conversion/tmp/scratch_4/dx.doi.org/10.1016/j.bbr.2011.09.009http://localhost/var/www/apps/conversion/tmp/scratch_4/dx.doi.org/10.1016/j.bbr.2011.09.009http://www.sciencedirect.com/science/journal/01664328http://www.elsevier.com/locate/bbrmailto:[email protected]://localhost/var/www/apps/conversion/tmp/scratch_4/dx.doi.org/10.1016/j.bbr.2011.09.009http://localhost/var/www/apps/conversion/tmp/scratch_4/dx.doi.org/10.1016/j.bbr.2011.09.009mailto:[email protected]://www.elsevier.com/locate/bbrhttp://www.sciencedirect.com/science/journal/01664328http://localhost/var/www/apps/conversion/tmp/scratch_4/dx.doi.org/10.1016/j.bbr.2011.09.009

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    2/14

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    3/14

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    4/14

    136   R. Adamecet al./ Behavioural Brain Research 226 (2012) 133–146

    Fig.1. (A)A photomicrographof a Golgistainedstellate cellof thebasolateralamyg-

    dala(BLA).(B) A photomicrographof a Golgistainedpyramidal cellof thebasolateral

    amygdala (BLA).

    cells were selected from thegranule cell layer of theDHC. These cells haddendritic

    trees extendingclearly intothe molecular layer. Fig. 2A containsa photomicrograph

    of a Golgi stained dentate granule cell in theDHC. Fig. 2B contains two examples of 

    dentate dendritic spinesfrom HCLA and HCMA rats.

    Allselected neurons hadto meet certain criteria:theyhadto bewell stained and

    they hadto havebranches whichwere unobscuredby otherneurons, glia,blood ves-

    sels, orprecipitate.For theanalysisof dendriticbranching andlength,all theselectedneurons had to be located in the middle third of the thickness of the section. This

    was done toavoidevaluatingneuronswhich– iflocatedtoo superficiallyor toodeep

    within the thickness of the section – may have had too many branches foreshort-

    ened. Foreach subject andfor each BLAcell type, three neurons were selected from

    the right hemisphere and three neurons were selected from the left hemisphere

    for analysis. For the dentate four neurons were selected from each hemisphere for

    analysis.

    In summary, forBLA stellate cells,from each brain,we evaluatedthreeneurons

    from each hemisphere – a total of 6 stellate cellsper brain. Similarly, for the pyra-

    mids, we also evaluated 6 neurons per brain. A total of 25 brains were used. Of a

    possible total of 6×2×25= 300 neurons in the study, due to staining issues, three

    brains wereeach oneneuronshort,so a totalof 297BLA neuronswere evaluated.The

    brains missing cells were HCMA right hemisphere missing a pyramidal cell; HCLA

    left hemisphere missing a pyramidalcell; HCLA right hemisphere missing a stellate

    cell. Forthe dentate granule cells we evaluatedfour neurons from each hemisphere

    – a total of 8 dentate cells per brain. A total of 20 brains were used (5 rats from

    each of four groups), these were rats with DHC sections containing granule cells in

    Fig. 2. (A) A photomicrograph of a Golgi stained dentate granulecell of the dorsal

    hippocampus. (B) Photomicrograph of Golgi stained dentate granule cell spines of 

    the dorsal hippocampusof a handled less anxious (HCLA top) rat and of a handled

    more anxious (HCMA bottom) rat.

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    5/14

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    6/14

    138   R. Adamecet al./ Behavioural Brain Research 226 (2012) 133–146

    Fig. 4. Plotted in (A and B) are mean+SEM of behaviors in the hole board for all

    handled controls (HC) and all predator stressed rats (PS). (A) shows mean+ SEM of 

    measures of exploration (head dips) and activity (rears) in the hole board test. (B)

    shows mean+ SEM of time spent in the centerand timespent near the walls of the

    hole board. Within a given behavioral plot in (A and B), means marked differently

    differ and unmarked means do notdiffer.

    F (1,299)≥23.67 all  p < .001). Consistent with this analysis, there

    were no group differences in the hole board measures of activ-

    ity/exploration (rears or head dips, Fig. 4A). However, stressed rats

    spent more time near thewalland less time in the centerof the hole

    board (Fig. 4 B, all F (1,300)≥5.86,  p < .02). This is consistent with

    the anxiety data in the EPM. Taken together these data support the

    conclusion that PS rats as a group were selectively more anxious in

    the EPM than handled controls.

     3.2. LA – PS and HC, and MA – PS and HC animals show

    equivalent levels of anxiety in the EPM 2 weeks after treatment 

    Behavior of rats selected for Golgi analysis was analysed using

    two way ANOVA for Stress (HC and PS) and Anxiety Level (LA, MA).

    There wasa main Anxiety Level effectfor anxiety scores in the EPM

    (Fig. 5A, F (1,21) = 233.71,  p < .0001). There was no Stress or Stress

    by Anxiety Level interaction (all F (1,21)≤ .05, p > .80). So PSMA and

    HCMA rats displayedequal anxiety scores whichwere greater than

    the anxiety scores of PSLA and HCLA rats, which did not differ.

    There was a Stress effect for closed arm entries in which PS rats

    entered the closed arms less frequently than did HC rats (Fig. 5B,

    F (1,21) = 10.70,  p .22; Fig. 5B) suggesting

    reduced locomotor activity/exploration in the EPM in stressed rats.

    To assess if locomotor activity/exploration contributed to Anxiety

    Fig.5. (A)Plottedaremean+ SEM ofthe anxiety indexof less anxious (LA– less EPM

    anxiety) and moreanxious (MA – more EPManxiety)ratsselected forGolgi analysis

    in the Handled Controls and Predator Stressed groups. Means marked similarly do

    notdifferwhilemeansmarkeddifferentlydiffer.(B) Plottedare mean+ SEMof closed

    arm entries in the EPM of less anxious (LA – less EPM Anxiety) and more anxious

    (MA – more EPM anxiety) rats selected for Golgi analysis in the Handled Controls

    and Predator Stressed groups. In this plot means marked differently differ, means

    marked the same do not differ. (C). Plotted are mean+SEM of the anxiety index

    of less anxious (LA – less EPManxiety)and more anxious (MA– more EPManxiety)

    rats selectedfor Golgianalysis inthe HandledControlsand PredatorStressedgroups.

    Means arethoseobserved after theinfluenceof closedarm entries is removed with

    analysis of covariance. Means marked similarly do not differ while means marked

    differently differ.

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    7/14

    R. Adamec et al./ Behavioural Brain Research 226 (2012) 133–146 139

    Level differences in anxiety scores, closed arm entries were used

    as a covariate in a reanalysis of anxiety scores. Reduced locomotor

    activity/exploration in the EPM did not contribute to anxiety score

    differences, as the original pattern of Anxiety Level differences

    was preserved in the analysis of covariance (Fig. 5C, Anxiety Level

    effect, F (1,20) = 205.54  p < .0001; Stress effects and interaction all

    F (1,20)≤ .17, p > .69). There were no effects in theanalysis of behav-

    iors in the hole board test (F (1,21)≤0.79,  p > .05). Together these

    data support the conclusion that MA rats as a group (PS +HC) were

    selectively and equally more anxious in the EPM than LA rats as a

    group (PS+ HC), which were selectively and equally less anxious.

     3.3. LA, MA – HC rats show a different pattern of startle response

    than LA, MA PS rats 2 weeks after treatment 

    Peak startle amplitudes were not normally distributed

    (Omnibus test 694.62,  p < .001). So LA and MA HC rats and LA

    and MA PS rats were compared in a one way non parametric

    Kruskal–Wallis ANOVA on median peak startle amplitudes. Groups

    differed (2(3) = 35.43,  p >.01; Fig. 6A) such that HCMA rats andPSLA and PSMA rats showed greater peak startle amplitudes than

    HCLArats. MoreoverHCMA ratsequaledPSLA andPSMA rats,which

    did not differ (Kruskal–Wallis multiple Z test, p < .01).

    Rate of habituation (Tau – the trial constant) was calculated asdescribedin the methods section. Allfits to theexponentialdecline

    functionwere good(all degrees of freedom adjusted r 2 >.505 13.78 p < .001, all > 0, p < .01).The estimateof Tau included a standard error of estimate. These standard errors

    were used to calculate t-statistics between the trial constants of 

    the different groups. Planned comparisons of the Tau estimates

    between groups were done using two-tailed t tests. Like peak star-

    tle amplitudes, HCMA rats andPSLA and PSMA rats showedgreater

    Tau values (more prolongedhabituation)than HCLA rats.Moreover

    HCMA rats equaled PSLA andPSMAratswhichdid not differ(Fig.6B,

    two tailed t tests, all t (58)≥2.66, p < .01).

     3.4. The predator stress experience

    LA and MA predator stressed rats were compared with respect

    to cat response to them and their responses to the cat. There were

    no group differences (allF (1,5)≤ .75, p > .43). Thereforethe predator

    stress experience, as measured, did not differ between LA and MA

    predator stressed rats.

     3.5. Dendritic morphology of BLA neurons – total dendritic length

    BLA stellate and pyramidal principle output neurons of the

    groups differed in total dendritic length (all F (3,21)≥3.63, p

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    8/14

    140   R. Adamecet al./ Behavioural Brain Research 226 (2012) 133–146

    Fig.7. Plotted aremean+ SEMof totaldendritic length(mM)collapsedacrosshemi-

    spheres. Plotted separately are Handled Controls which are less anxious (HCLA) or

    more anxious (HCMA) and Predator Stressed rats which are less anxious (PSLA) or

    moreanxious(PSMA). (A) shows datafrom basolateral amygdala stellate cellswhile

    data from pyramidal cells appear in (B). For a given plot (A or B) means marked

    similarly do not differ, while means marked differently differ.

    showed elevated spine densities on pyramidal cell dendrites (basi-

    lar and apical combined, there being no effects of type of dendritic

    segment). Moreover, HCMA rat spine density was greater than all

    other groups, whichdid not differ (Fig. 11A, all t (21)≥2.08, p

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    9/14

    R. Adamec et al./ Behavioural Brain Research 226 (2012) 133–146 141

    Fig. 9. Plotted are mean shell crossings vs distance from the soma of the crossingsfrom the Sholl analysis of basolateral amygdala pyramidal cells collapsed across

    hemispheres.Plottedseparatelyare HandledControlswhich areless anxious (HCLA)

    or more anxious (HCMA) and Predator Stressed rats which are less anxious (PSLA)

    or more anxious (PSMA). (A) shows mean±SEM, while (B)showsmean±95% con-

    fidence intervals of shell crossings. In (B), HCMA means marked with an “*” differ

    from the remaining groups which do not differ. This occurs over a range from the

    soma of 40–90M.

    greater anxiety. Therewere no correlations of dendritic length with

    anxiety or peak startle amplitude in PS rats (all r ≤ .47,  p >.10).

     3.11.2. BLA mean number of dendritic branches correlations with

    behavior 

    There were no correlations with behavior (anxiety or peak star-tle amplitude) of branches in pyramidal or stellate cells of HC or PS

    rats (all r ≤ .47, p > .10). So dendritic complexity in the BLA did not

    predict behaviors measured here.

     3.11.3. BLA spine density correlations with behavior 

    Spine density didcorrelate with anxiety butnot startle. Thecor-

    relationwas between anxietyand spine densityon pyramidal apical

    dendrites of HCMA and HCLA rats (r = .51, p < .04). The positive cor-

    relationindicates thatgreater spinedensitypredicts higher levels of 

    anxiety. There were no correlations of spine density with behavior

    on basilar dendrites of HCMA and HCLA rats, nor were there corre-

    lations with behavior of apical and basilar dendriticspine densities

    of PSMA and PSLA rats (all r ≤ .36,  p < .24).

    Fig. 10. Plotted aremean+ SEMof numberof branches in thebranch point analysiscollapsedacrosshemispheresand branch order.Plottedseparatelyare HandledCon-

    trols which areless anxious (HCLA)or more anxious (HCMA)and Predator Stressed

    rats which are less anxious (PSLA) or more anxious (PSMA). (A) shows data from

    basolateral amygdala stellatecells whiledata frompyramidalcells appear in (B).For

    a given figure (A or B) means marked similarly do not differ, while means marked

    differently differ.

     3.12. Dendritic morphology of DHC dentate neurons – total

    dendritic length

    There were no group effects or interactions with hemisphere

    for total dendriticlength of dentate granule cells. Averagedover all

    rats, the dendritic length equaled 2076.3±37.5M.

     3.13. Dendritic morphology of DHC dentate neurons – Shollanalysis

    The Sholl analyses were consistent with the total den-

    dritic length analyses. There were no Group or Group (HCLA,

    HCMA, PSMA, PSLA) x shell interactions (F (3,16) = .72,  p >.55;

    F (99,528)= .83, p > .87).

     3.14. Dendritic morphology of DHC dentate neurons – branch

     point analysis

    There were no group effects of mean total branches

    (F (3,16) = 0.97,  p > . 42) or group by branch order interactions

    (F (3,15) = 1.41,  p > .26; F (15,75)= .92,  p > .54) for dentate granule

    cells.

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    10/14

    142   R. Adamecet al./ Behavioural Brain Research 226 (2012) 133–146

    Fig. 11. (A) Plotted are mean+ SEM of spine densities (spines/M) of basolateral

    amygdala pyramidal cells collapsed across hemispheres and basilar and apicalden-

    drites. Plotted separately are Handled Controls which are less anxious (HCLA) ormore anxious (HCMA) and Predator Stressed rats which are less anxious (PSLA) or

    more anxious (PSMA). Means marked similarly do not differ, while means marked

    differently differ.

    (B) Plotted are mean+ SEM of total dendritic length (M) of basolateral amygdala

    stellateand pyramidalcells combined fromthe righthemisphere.Plottedseparately

    are Handled Controls which are less anxious (HCLA) or more anxious (HCMA) and

    PredatorStressed ratswhich areless anxious (PSLA) or moreanxious(PSMA).Means

    marked similarly do not differ, while means markeddifferently differ.

     3.15. Dendritic morphology of DHC Dentate neurons – spine

    density analysis

    Dueto non normality ofthe data (Omnibus test = 34.58, p < .001),

    DHC spine density was analysed comparing group medians with

    Kruskal–Wallis non parametric analysis of medians. Median con-trasts were done using the Kruskal–Wallis multiple Z test ( p

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    11/14

    R. Adamec et al./ Behavioural Brain Research 226 (2012) 133–146 143

    sine) was used to correlate independent variables (dendritic mor-

    phology) with anxiety. The criteria for a successful model included

    a significant multiple R, and all coefficients of independent vari-

    ables being significantly different from zero. The correlation was

    done on HC rats (across HCMA and HCLA). The first model tested

    included all three independent variables. Two of three coeficients

    of independent variables were significantly different from zero

    (−2.54 = t (7) = 2.54, p < .04) and multiple R was significantly differ-

    ent from zero (F (3,7) = 62.3,  p

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    12/14

    144   R. Adamecet al./ Behavioural Brain Research 226 (2012) 133–146

    and behavior in PS rats. In HC rats, anxiety correlated positively

    with total dendritic length of pyramidal and stellate cells. There-

    fore in HC rats longer dendrites predict greater anxiety. In contrast

    there were no correlations with behavior (anxiety or peak startle

    amplitude) of branches in pyramidal or stellate cells of HC rats.

    So dendritic complexity did not predict behaviors measured here.

    On the other hand, spine density on pyramidal apical dendrites of 

    HCMA and HCLA rats correlated positively with anxiety but not

    startle amplitudes. Thus greater excitatory spine density [56] pre-

    dicts higher levels of anxiety.In contrast, there wereno correlations

    of spine density with behavior on basilar dendrites of HCMA and

    HCLA rats.

    4.3. Golgi findings – dorsal hippocampus dentate granule cells

    There were no groupdifferencesbetween HC and PS rats in total

    dendritic length or branching of dentate granule cells. However,

    more anxious PS and HC rats displayed equally reduced spine den-

    sity on granule cell dendrites relative to less anxious PS andHC rats

    (Fig. 12). Moreover, across PS and HC rats, spine density correlated

    negatively with anxiety, but not startle, suggesting fewer dendritic

    spines predict more anxiety.

    Functionally,reducedspines would be associatedwith less exci-

    tatory activity in the trisynaptic circuit of the dorsal hippocampus.This might make sense in view of dorsal hippocampus projections

    to the medial prefrontal cortex [58]. This circuit whenexcited could

    exert an inhibitory influence on BLA and central amygdala (CeA)

    excitability via medial prefrontal cortex excitatory projections onto

    inhibitory intercalatednucleus neurons in the amygdala[59]. If this

    surmise is true, one would predict thatin LA PS rats there would be

    more mPFC output cellular activation during predator stress, and

    conversely in MA PS rats there would be less mPFC cellular activa-

    tion during predator stress. This is in fact the case (Adamec et al.,

    accepted).

    Since HC rats display thesespinedifferences, they likelyreflect a

    spontaneouslyoccurring and perhaps genetically determined mor-

    phological feature. In viewof thispossibility,the samemightbe said

    of the PS rats. If true, then a bias toward more dorsal hippocampalactivation in PSLA rats would suppress BLA and CeA excitabil-

    ity and reduce BLA plasticity in response to stress. The opposite

    would be the case for PSMA rats, where reduced dorsal hippocam-

    pal activation would relieve medial prefrontal cortical suppression

    of the amygdala and promote more BLA plasticity in response to

    stress. This is an attractive hypothesis from a translation perspec-

    tive, where smaller human hippocampal volume is a vulnerability

    marker for PTSD [38].

    4.4. Robust correlation and multiple correlation analyses of BLA

    and hippocampal morphology with behavior 

    Multiple correlation of BLA and DHC morphology variables

    distinguishing the groups was done on HC rats (across HCMAand HCLA). The multiple correlation of dentate cells spine den-

    sities and dendritic lengths of BLA stellate and pyramidal cells

    combined yielded a satisfactory model of the following form: Anx-

    iety=−1.19×dentate cells spine densities + 2.12×BLA pyramidal

    and stellate cells total dendritic lengths (summed). Coefficients

    were standardized and differed from zero and the multiple R was

    significantly different from zero. These two variables accounted for

    96.2% of the variance of anxiety (df adjusted R2 = .962). The model

    indicates that lower DHC dendritic spine densities predict more

    anxiety while greater BLA dendritic lengths predict more anxiety.

    Itis strikinghow much of the variance of anxiety is accountedfor by

    these two variables, which together account for much of the anx-

    iety seen in HCMA and HCLA rats. As suggested above, the HCMA

    phenotype likely reflects an underlying genotype, and present data

    strongly implicate BLA dendritic hypertrophy and dentate spine

    density reduction as the neural expression of the phenotype. The

    modelsuggests dendritichypertrophy in BLA principle output neu-

    rons increases BLA excitability. Moreover reduced excitability in

    the trisynaptic circuit of the DHC likely adds to this excitability

    by reducing hippocampal driving of a negative feedback from hip-

    pocampal to medial prefrontal cortex to amygdala projections (see

    above). Together this increase in BLA excitability produces more

    anxiety in HCMA rats. Conversely reduced BLA dendritic lengths

    and increased DHC dentate spine density produces less anxiety in

    HCLA rats.

    For PSMA and PSLA a robust correlation was done using hip-

    pocampal spine densities alone. The correlation of dentate cells

    spine densities yielded a satisfactory model of the following form:

    Anxiety =−0.86×dentate cells spine densities. The coefficient is

    standardized and differs from zero and R was significantlydifferent

    from zero. This variable accounted for 70.4% of the variance of anx-

    iety (df adjusted R2 = .704). If spine density is decreased by stress,

    then the reduced driving of the dorsal hippocampus may serve to

    prolong anxiety by increasing BLA response to subsequent stress.

    If spine density is a phenotypic marker of vulnerability to stress,

    its presence alone does not alter anxiety but by relieving negative

    cortical feedback during stress enhances BLA excitability changes

    in response to predator stress.

    4.5. Conclusions

    Our findings implicate variation in dendritic arbor of amygdala

    neurons as a candidate mechanism for variation in anxiety but not

    startle in spontaneously more and less anxious rats. Correlation

    analysis suggests that dendritic length is particularly relevant to

    anxiety levels. It is surprising that the same cannot be said of vari-

    ation in anxiety of stressed rats. The BLA can undergo structural

    reorganization in response to stressors as diverse as immobi-

    lization, maternal stress and external application of the stress

    hormone,corticosterone [32,34,60,61]. A prominent feature of such

    structural reorganization is dendritic expansion (hypertrophy) of 

    excitatory neurons of the BLA. Once evoked, BLA hypertrophy isas lasting as long-lasting anxiety [33]. Conversely, dendritic retrac-

    tion achieved by viral-mediated over expression of inhibitory SK2

    potassium channels in BLA results in reduced anxiety [35]. Clearly

    predator stress is not a stressor which induces dendritic hyper-

    trophy. Therefore, dendritic remodeling of BLA by stress seems to

    be stressor specific. This is consistent with earlier work of Vyas

    and colleagues [32]. This raises a caution regarding translation of 

    findings in animal models of stress vulnerability/resilience. While

    morphological characteristics of amygdala cells are a putative sub-

    strate for individual differences in response to stress, there are

    other possibilities. So effects of a variety of stressors on brain and

    behavior should be examined to categorize candidate mechanisms.

    It is an open question if different stressors impact limbic circuits in

    humans differently.In contrast,spine density of DHC dentate granule cells is a nega-

    tive predictor of anxiety in both handled (HCMA and HCLA) and

    predator stressed (PSMA and PSLA) rats. This either means that

    predator stress reduces spine density on DHCdentate granule cells,

    or giventhe spontaneousreduction of spine densitiesin HCMA rats,

    representsa preexisting phenotype. If the latter, reduced DHC spine

    densities represents a vulnerability factor in anxious response to

    predator stress. From our present data, it is difficult to determine

    if morphimetric differences between MA and LA stressed animals

    werestress induced,or werepre-existingdifferences.It is notpossi-

    ble to achieve paired measurements before andafter stress, because

    of the post-mortem nature of Golgi staining. Nor is it yet possible

    to reliably predict MA or LA responses to predator stress. So test

    of whether reduction in dendritic spine density of dentate granule

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    13/14

    http://dx.doi.org/10.1038/mp.2009.9

  • 8/18/2019 Adamec, Mervis (2012) Behav Brain Res PDF

    14/14

    146   R. Adamecet al./ Behavioural Brain Research 226 (2012) 133–146

    [44] RodgersRJ, JohnsonNJT. Factor analysisof spatiotemporaland ethological mea-sures in the murine elevated plus-maze test of anxiety. Pharmacol BiochemBehav 1995;52:297–303.

    [45] Paxinos G,WatsonC. Theratbrainin stereotaxiccoordinates. 5thed.San Diego,CA: Elsevier Academic Press;2005.

    [46] Valverde F. The rapid Golgi technique for staining CNS neurons.Neurosci Pro-tocols 1993;1:1–9.

    [47] Sholl DA. Dendriticorganization in theneuronsof thevisual andmotor corticesof thecat. J Anat 1953;87(387):406.

    [48] Adamec R. Doe s lon g t er m pote nt iation in periacqueductal gray ( PAG)mediate lasting c hang es in rodent ALB produced by predator stress?

    Effects of low frequency stimulation (LFS) of PAG on place preference andchanges in ALB produced by predator stress. Behav Brain Res 2001;120:111–35.

    [49] Adamec RE,Blundell J,BurtonP. Relationshipof thepredatoryattack experienceto neural plasticity,pCREB expressionand neuroendocrine response. NeurosciBiobehav Rev 2006;30(3):356–75.

    [50] Hinojosa FR, Spricigo L, Izídio GS, Brüske GR, Lopes DM, Ramos A. Evaluationof  two genetic animal models in behavioral tests of anxiety and depression.Behav Brain Res 2006;168(1):127–36.

    [51] AguilarR, Gil L, Flint J,GrayJA, DawsonGR, Driscoll P,et al. Learned fear, emo-tional reactivity and fear of heights: A factor analytic map from a large F-2intercross of Roman rat strains. Brain ResBull 2002;57(1):17–26.

    [52] Pawlak CR, Ho YJ, Schwarting RKW. Animal models of human psychopathol-ogy based on individual differences in novelty-seeking and anxiety. NeurosciBiobehav Rev 2008;32(8):1544–68.

    [53] Wigger A, Sánchez MM, Mathys KC, Ebner K, Frank E, Liu D, et al. Alter-ations in central neuropeptide expression, release, and receptor binding in rats

    bred for high anxiety: critical role of vasopressin. Neuropsychopharmacolgy2004;29(1):1–14.

    [54] Landgraf R, Wigger A. High vs low anxiety-related behavior rats: an animalmodel of extremes in trait anxiety. Behav Genet 2002;32(5):301–14.

    [55] MarenS, Fanselow MS.Synaptic plasticity in thebasolateral amygdala inducedby hippocampal formation stimulation in vivo. J Neurosci 1995;15:7548–64.

    [56] Muller J F, Mascagni F , McDon ald AJ. Py ramidal cells of t he r at baso lat-eral amygdala: synaptology and innervation by parvalbumin-immunoreactiveinterneurons. J Comp Neurol 2006;494(4):635–50.

    [57] Engin E, Treit D. The effects of intra-cerebral drug infusions on animals’unconditioned fear reactions: a systematic review. Prog Neuro Psychchol Biol

    Psychiatry 2008;32(6):1399–419.[58] Almada RC, Borelli KG, brechet-Souza L, Brandao ML. Serotonergic mecha-

    nisms of the median raphe nucleus-dorsal hippocampus in conditioned fear:output circuit involves the prefrontal cortex and amygdala. Behav Brain Res2009;203(2):279–87.

    [59] Quirk GJ,Likhtik E, PelletierJG, Paré D. Stimulation of medial prefrontal cortexdecreases the responsiveness of central amygdala output neurons. J Neurosci2003;23(25):8800–7.

    [60] Mitra R, Jadhav S, McEwen BS, Vyas A, Chattarji S. Stress duration modulatesthe spatiotemporal patterns of spine formation in the basolateral amygdala.Proc Nat Acad Sci USA 2005;102(26):9371–6.

    [61] Weinstock M. Thelong-term behaviouralconsequences ofprenatalstress.Neu-rosci Biobehav Rev 2008;32(6):1073–86.

    [62] AdamecRE, BurtonP, Shallow T, Budgell J. Unilateral block of NMDA receptorsin the amygdala prevents predator stress-induced lasting increasesin anxiety-like behavior and unconditioned startle – effect on behavior depends on thehemisphere. Physiol Behav 1999;65(4–5):739–51.