Upload
bbi-international
View
293
Download
24
Embed Size (px)
DESCRIPTION
Â
Citation preview
4 | 2016 Biomass Industry Directory
Sixth EditionJanuary 2016
Published byBBI International308 Second Ave. N., Suite 304Grand Forks, ND 58203phone: (701) 746-8385fax: (701) 746-5367
Copyright © January 2016All Rights ReservedPrinted in the United States of America
BiomassIndustry Directory2016
TM
directory.biomassmagazine.com
6 | 2016 Biomass Industry Directory
Contents
2016 U.S. BIOMASS POWER PLANT LIST 8
2015 U.S. & CANADA PELLET MILL LIST 11
AG PRODUCTS & SERVICES 16
Feedstock Collection Systems 16
Feedstock Procurement 16
ASSOCIATIONS & ORGANIZATIONS 16
CERTIFICATIONS 17
CONFERENCES/TRADE SHOWS & MEETINGS 17
DENSIFICATION & SIZE REDUCTION 18
Balers - Rectangle 18
Balers - Round 18
Briquetting 18
Chippers - Brush 18
Chippers - Rechipper 19
Chippers - Whole Log 19
Grinders - Horizontal 19
Grinders - Tub 21
Grinders - Vertical 21
Mills - Hammer 21
Pellet Mills 21
Pyrolysis 22
Torrefaction 22
EDUCATION 22
EMPLOYMENT 22
Executive Search 22
ENGINEERING & CONSTRUCTION 22
Anaerobic Digestion Systems 22
Biomethane 22
Buildings 23
CHP Systems 23
Civil Engineering 25
Detailed Design 25
District Heating Systems 25
Electrical 25
EPC 25
Fabrication 26
Gasifiers 26
Information Technology Services 27
Management Services 27
Piping 27
Plant Optimization 27
Power Plant Construction 27
Pyrolysis 29
Stacks 29
Structural Fabrication 29
Torrefaction 29
Water Treatment 30
FEEDSTOCK SUPPLY 30
Ag Residues 30
Biomass Based Fuel Oil 30
Briquettes 30
Dedicated Energy Crops 31
Pellets 31
Wood Chips 31
LEGAL SERVICES 31
Attorney 31
Business 33
Permit & License 33
MATERIAL HANDLING & STORAGE 33
Conveyor - Belt 33
Conveyor - Drag 33
Conveyor - Enclosed 33
Conveyor - Mechanical 34
Conveyor - Pneumatic 34
Conveyor - Screw 34
Cranes - Overhead 35
Dryer - Conveyor 35
Dryer - Rotary Drum 35
Elevator-Bolts 36
Elevator-Buckets 36
Loading Equipment 36
Railcar - Moving 37
Railcar - Parts 37
Scale - Bulk Weigh 37
Scale - Software 37
Screens - Disc 37
Screens - Disc Scalping 38
Screens - Fines 38
Screens - Other 38
Screens - Trommel 38
Specialty Parts and Equipment 38
Stockyard Equipment 39
Storage-Bins 39
Storage-Other 41
Storage-Silos 41
Storage - Silo Reclaimer 41
Trailer - Moving Floor 42
Transportation - Rail 42
Truck Receiving/Dumpers 42
Vibration Equipment 42
MEDIA 42
Publications 42
PROCESS EQUIPMENT & SERVICES 43
Air Pollution Control 43
Biogas-Capture 43
Biogas-Purification 44
Biogas-Storage 44
Boilers - Control Agents 44
Boilers - Direct Fired 44
Boilers - Firetube 45
Boilers - Fluidized Bed 45
Boilers - Hot Water 45
Boilers - Parts & Service 45
Boilers - Solid Fuel 45
Boilers - Steam 47
Boilers - Waste Heat Recovery 47
Cargo Inspection and Sampling 47
Centrifuges 48
CIP 48
Cleaning 48
Combustion Equipment 48
Compressed Air Systems 48
Condensors 48
Control Systems 48
Control Systems-Distributed 49
Distillation & Dehydration Systems 49
Dust Control - Baghouses 49
Dust Control - Inertial Separators 49
Dust Control - Unit Collectors 49
Dust Control - Wet Scrubbers 49
Energy Management 50
Environmental Testing 50
Fans 50
Filters 50
Fire Protection 50
Furnaces 51
Generator - Diesel / Biodiesel 51
Generator - Natural Gas/Biogas 51
Generator - Steam Turbine 52
Heat Exchangers - Direct Contact 52
Heat Exchangers - Phase-Change 52
Heat Exchangers - Shell & Tube 52
Heat Exchangers - Waste Heat Recovery Unit 53
Hoppers 53
Instrumentation 53
Laboratory Equipment 53
Laboratory Services 54
Lubricants 54
Maintenance Services 54
Marine Surveying 54
Mixers/Agitators 55
Moisture Analyzers 55
Operations & Maintenance 55
Pipe 55
Pipe-Fittings 55
Pipe-Flanges 55
Safety 56
Sensors 56
Separators 56
Separators-Magnetic 57
Tank Equipment 57
VOC Scrubbers 57
Wastewater Treatment 57
PROJECT DEVELOPMENT & FINANCE 58
Business Plans 58
Debt Financing 58
Due Diligence 58
Feasibility Studies 59
Insurance 59
Investors 59
Mergers & Aquisitions 59
Owner Representation 59
Permitting - Air 59
Permitting - Other 59
Risk Management 59
Site Selection 59
Software - Accounting 59
Technology Assessment 59
RESEARCH & DEVELOPMENT 60
Government 60
Private 60
University 60
ADVERTISER INDEX 61
COMPANY INDEX 62
8 | 2016 Biomass Industry Directory
U.S. Biomass Power Facilities List
Company Plant Name LocationNameplate Capacity (MW)
CHP Capability Cofire Coal Fuel Feedstock
Abengoa Abengoa Bioenergy Biomass of Kansas LLC Hugoton, KS 21 Yes No Corn stover, straw, switchgrass
Akeida Capital Management Ampersand Chowchilla Biomass LLC Chowchilla, CA 12.5 No No Agricultural wastes
Amador Biomass LLC Buena Vista Biomass Power Ione, CA 18 No No Woody biomass
Ameresco Inc. Savannah River Site Biomass Cogeneration Facility Aiken, SC 20 Yes Yes Forest residue, tire-derived fuel
Anderson Plant LLC Shasta Renewable Anderson, CA 6.8 No No Ag waste, forest and urban wood
Arlington County/ City of Alexandria Covanta Alexandria/Arlington Alexandria, VA 23 No No Municipal solid waste
Atlantic Power Piedmont Green Power Barnesville, GA 60 No No Woody biomass
Avista Corp. Kettle Falls Generating Station Kettle Falls, WA 53.4 No No Logging and mill residue
Biomass One LP (Parent) Biomass One White City, OR 30 No No Woody biomass
BlueFire Renewables Inc. BlueFire Renewables Fulton LLC - Biomass Power Fulton, MS 25 No No Wood waste
Boise Cascade LLC Medford Operation Medford, OR 11 Yes No Mill residue
Bridgewater Power Co. LP Bridgewater Power LP Plymouth, NH 15 No No Woody biomass
Burlington Electric Department Joseph C McNeil Generating Station Burlington, VT 59.5 No No Forest and mill residue, local wood waste
Burney Forest Products Burney Forest Power Burney, CA 31 Yes No Logging and mill residue
Caletta Renewable Energy Palmer Renewable Energy Springfield, MA 35 No No Wood chips
California Ethanol & Power LLC California Ethanol & Power LLC Imperial Valley, CA Yes No Sugarcane
Capital Power Corp. CPI USA North Carolina LLC Southport, NC 55 Yes Yes Wood residuals, tire-derived fuel
Capital Power Corp. Roxboro Facility Roxboro, NC 67.5 Yes Yes Wood, tire-derived fuel
Cate Street Capital Burgess BioPower Berlin, NH 75 No No Woody biomass
City and County of Honolulu Covanta Honolulu Resource Recovery Venture Kapolei, HI 90 No No Municipal solid waste
City of Long Beach Covanta Long Beach Renewable Energy Long Beach, CA 36 No No Municipal solid waste
City of Perham Perham Resource Recovery Facility Perham, MN 4.5 Yes No Municipal solid waste
City of Spokane City of Spokane Waste to Energy Facility West of Spokane, WA 26 No No Municipal solid waste
City of Tampa McKay Bay Refuse-to-Energy Facility Tampa, FL 22 No No Municipal solid waste
CMS Energy Craven County Wood Energy New Bern, NC 50 No No Mill residue
CMS Energy Genesee Power Station LP Flint, MI 40 No No Wood waste solids, animal bedding
CMS Energy Grayling Generating Station Grayling, MI 38 No No Mill residue, tire-derived fuel
Collins Company Collins Pine Company Kane, PA 12 Yes No Woody biomass
Concord Blue USA Concord Blue Eagar LLC Eagar, AZ 1 No No Woody biomass
Concord Steam Corporation Concord Steam Corporation Concord, NH 20 Yes No Whole tree chips
Connecticut Resources Recovery Authority Covanta SECONN Preston, CT 18 No No Municipal solid waste
Connecticut Resources Recovery Authority Mid-Conn. Resource Recovery Facility Hartford, CT 68 No No Municipal solid waste
Connecticut Resources Recovery Authority Wheelabrator Bridgeport LP Bridgeport, CT 67 No No Municipal solid waste
Constellation NewEnergy Albany Green Energy Albany, GA 50 Yes No Forest residue, urban waste wood, pecan shells, peanut hulls
Covanta Covanta Energy Mendota Delano, CA 25 No No Orchard and vineyard prunings, nut shells, stone fruit pits
Covanta Covanta Babylon Inc. West Babylon, NY 17 No No Municipal solid waste
Covanta Covanta Bristol Inc. Bristol, CT 16.3 No No Municipal solid waste
Covanta Covanta Burney Mountain Power Burney, CA 11.4 No No Woody biomass
Covanta Covanta Camden Energy Recovery Center Camden, NJ 21 No No Municipal solid waste
Covanta Covanta Delano Delano, CA 58 No No Orchard and vineyard prunings, nut shells, stone fruit pits
Covanta Covanta Delaware Valley LP Chester, PA 80 No No Municipal solid waste
Covanta Covanta Essex Company Newark, NJ 65 No No Waste stream
Covanta Covanta Fairfax Inc. (I-95 Energy) Lorton, VA 80 No No Municipal solid waste
Covanta Covanta Haverhill Inc. Haverhill, MA 49 No No Municipal solid waste
Covanta Covanta Hempstead Company Westbury, NY 80 No No Municipal solid waste
Covanta Covanta Hennepin Energy Resource Co. LP Minneapolis, MN 40 No No Municipal solid waste
Covanta Covanta Huntington LP East Northport, NY 25 No No Municipal solid waste
Covanta Covanta Indianapolis Inc. Indianapolis, IN 7 Yes No Municipal solid waste
Covanta Covanta Jonesboro Power Station Jonesboro, ME 24.5 No No Logging and mill residue
Covanta Covanta Lake Inc. Okahumpka, FL 15 No No Municipal solid waste
Covanta Covanta Marion Inc. Brooks, OR 13 No No Municipal solid waste
Covanta Covanta Mount Lassen Power Westwood, CA 11.5 No No Forest thinning
Covanta Covanta Niagara Company Niagara Falls, NY 30 No No Municipal solid waste
Covanta Covanta Onondaga LP Jamesville, NY 40 No No Municipal solid waste
Covanta Covanta Pacific Oroville Power Oroville, CA 16.5 Yes Yes Forest residue, ag and urban waste
Covanta Covanta Pittsfield Inc. Pittsfield, MA 4 Yes No Municipal solid waste
Covanta Covanta Plymouth Renewable Energy Ltd. Conshohocken, PA 32 No No Municipal solid waste
Covanta Covanta Projects of Wallingford LP Wallingford, CT 11 No No Municipal solid waste
Covanta Covanta SEMASS LP West Wareham, MA 54 No No Municipal solid waste
Covanta Covanta Springfield LLC Agawam, MA 9 No No Municipal solid waste
Covanta Covanta Stanislaus Inc. Crows Landing, CA 22.5 No No Municipal solid waste
Covanta Covanta Warren Energy Resource Co. LP Oxford, NJ 14 No No Municipal solid waste
Covanta Covanta WBH LLC Tulsa, OK 17 No No Municipal solid waste
Covanta Covanta West Enfield West Enfield, ME 25 No No Forest and mill residue
D.R. Johnson Lumber Company Co Gen Co Prairie City, OR 9 Yes No Forest thinnings
D.R. Johnson Lumber Company Co Gen Co 2 Riddle, OR 9 Yes No Woody biomass
Detroit Thermal Detroit Renewable Energy Detroit, MI 68 Yes No Municipal solid waste
Dominion Virginia Power Altavista Power Station Altavista, VA 51 No No Whole tree chips
Dominion Virginia Power Hopewell Power Station Hopewell, VA 51 No No Whole tree chips
Dominion Virginia Power Pittsylvania Power Station Hurt, VA 83 No No Whole tree chips
Dominion Virginia Power Southampton Power Station Franklin, VA 51 No No Wood waste
DTE Energy DTE Stockton LLC Stockton, CA 45 Yes No Woody biomass, ag residues
DTE Energy Services DTE Stoneman Station Cassville, WI 40 No No Woody biomass
DTE Energy Services Woodland Biomass Power Ltd. Woodland, CA 28 No No Woody biomass
Dutchess County Resource Recovery Agency Covanta Hudson Valley Renewable Energy LLC Poughkeepsie, NY 9 No No Municipal solid waste
East Texas Electric Cooperative Woodville Renewable Power Woodville, TX 49 No No Wood chips
Eastern Connecticut Resource Recovery Authority Wheelabrator Lisbon Inc. Lisbon, CT 15 No No Municipal solid waste
Color KeyExisting Under Construction Proposed Idled
2016 Biomass Industry Directory | 9
U.S. Biomass Power Facilities ListNote: Plant map data as of September 22, 2015The map indicates electricity generation plants that:-have the ability to supply all or a portion of their power to the grid-use greater than 40% biomass by volume in annual fuel mix-have a nameplate capacity equal to or greater than 1 MW
Company Plant Name LocationNameplate Capacity (MW)
CHP Capability Cofire Coal Fuel Feedstock
Ecomaine (Parent) Ecomaine (Biomass Power Plant) Portland, ME 14 No No Municipal solid waste
ecoPower - Hazard ecoPower - Hazard Chavies, KY 58 No No Woody biomass
EDF Renewable Energy EDF-RE Allendale Allendale, SC 17.8 No No Forestry wood waste
EDF Renewable Energy Pinelands Biomass - Dorchester Dorchester, SC 35.6 No No Logging residue
EMD Millipore Corporation EMD Millipore Corporation Jaffrey, NH TBD Yes No Wood chips, wood pellets
Energy Management Inc. Gainesville Renewable Energy Center Gainesville, FL 102.5 No No Logging and mill residue, urban waste wood
EnergyWorks BioPower Inc Gettysburg Energy & Nutrient Recovery Facility LLC York Springs, PA 3.25 No No Egg layer manure
Enpower Corp. Wadham Energy LP Williams, CA 26.5 No No Rice hulls
Escanaba Green Energy LLC Escanaba Generating Station Escanaba, MI 23 Yes Yes Wood waste, tire-derived fuel
Evergreen BioPower LLC (Parent) Evergreen Biopower LLC Lyons, OR 10 Yes No Mill residue
Evergreen Clean Energy Eagle Valley Clean Energy Gypsum, CO 11.5 Yes No Forest restoration residue
Ever-Green Energy LLC St. Paul Cogeneration LLC St. Paul, MN 37 Yes No Urban wood residues
EWP Renewable Corp. DG Fairhaven Power Samoa, CA 18.8 No No Woody biomass
EWP Renewable Corp. DG Whitefield LLC (Biomass Power Plant) Whitefield, NH 19 No No Woody biomass
EWP Renewable Corp. Springfield Power LLC Georges Mills, NH 19 No No Whole chipped trees, round wood
Florida Crystals New Hope Power Co. South Bay, FL 128.9 Yes No Bagasse, wood
Florida Power Development LLC Brooksville Brooksville, FL 70 No No Woody biomass
Fortistar Hillman Power LLC Hillman, MI 20 No No Wood waste, tire-derived fuel
GDF Suez Energy North America Inc. Bethlehem Power Station Bethlehem, NH 16.2 No No Logging residue, forest thinnings
GDF Suez Energy North America Inc. Fitchburg Power Station Westminster, MA 17 No No Woody biomass
GDF Suez Energy North America Inc. Lincoln Power Station Lincoln, MI 16 No No Waste wood, natural gas, tire-derived fuel, creosote treated wood, pentachlorophenol
GDF Suez Energy North America Inc. McBain Power Station McBain, MI 18 No No Wood waste, tire-derived fuel
GDF Suez Energy North America Inc. Northumberland Cogeneration Facility Northumberland, PA 16 Yes No Woody biomass
GDF Suez Energy North America Inc. Ryegate Power Station East Ryegate, VT 20.5 No No Whole chipped trees
GDF Suez Energy North America Inc. Tamworth Power Station Tamworth, NH 22.5 No No Woody biomass
Grays Harbor Paper LP Grays Harbor Paper LP - Powerhouse Hoquiam, WA 14 Yes No Paper mill sludge
Great River Energy Elk River Energy Recovery Station Elk River, MN 29 No No Municipal solid waste
Green Planet Power Solutions Maryland Bio Energy Federalsburg, MD 13.4 No No Chicken litter
Greenleaf Power LLC Desert View Mecca, CA 47 Yes No Ag residue, urban wood waste
Greenleaf Power LLC Eel River Plant Scotia, CA 28 Yes No Logging and mill residue
Greenleaf Power LLC Honey Lake Wendel, CA 30 No No Mill and logging residue, forest thinning, urban woodwaste
Greenleaf Power LLC Plainfield Renewable Energy Plainfield, CT 37.5 No No C&D waste
Greenleaf Power LLC Tracy Biomass Tracy, CA 20.5 No No Waste wood, orchard waste
Hawaiian Commercial & Sugar Co Ltd (Parent) Hawaiian Commercial & Sugar Puunene Mill Puunene, HI 46.1 Yes Yes Bagasse
Hillsborough County Solid Waste Department Covanta Hillsborough Inc. Tampa, FL 46.5 No No Municipal solid waste
Hoge Lumber Co Hoge Lumber New Knoxville, OH 3.7 Yes No Mill residue
Homeland Renewable Energy Inc. Fibrominn Biomass Power Plant Benson, MN 50 No No Poultry litter, ag residue
Hometown Bioenergy LLC Hometown Bioenergy LLC LeSueur, MN No No Food and ag waste
Hu Honua Bioenergy LLC Hu Honua Bioenergy Facility Pepeekeo, HI 24 No No Eucalyptus, other biomass
Imperial Valley Resource Recovery Imperial Valley Resource Recovery Imperial, CA 18.1 No No Woodwaste, ag residue
Indeck Energy Services Inc. Indeck Energy - Alexandria LLC Alexandria, NH 16 No No Wood waste
INEOS Bio INEOS - Indian River Bioenergy Center Vero Beach, FL 6 Yes No Vegetative waste, ag waste, municipal solid waste
InventivEnergy LLC Aspen Biomass Power Plant Lufkin, TX 44 No No Logging and mill residue, urban wood waste
Islip Resource Recovery Agency Covanta MacArthur Renewable Energy Inc. Ronkonkoma, NY 12 No No Municipal solid waste
Jamestown Energy Inc. Pacific Ultrapower Chinese Station Jamestown, CA 19.8 Yes No Woody biomass
KapStone Kraft Paper Corp. Longview Fibre Longview, WA 55 Yes No Mill residue
Kent County Covanta Kent Inc. Grand Rapids, MI 18 No No Municipal solid waste
Koda Energy LLC Koda Energy LLC Shakopee, MN 23.4 Yes No Oat & rice hulls, corn, barley & malt screening, urban tree waste
Lancaster County Solid Waste Authority Covanta Harrisburg Inc. Harrisburg, PA 24 Yes No Municipal solid waste
Lancaster County Solid Waste Authority Covanta Lancaster Inc. Bainbridge, PA 36 No No Municipal solid waste
L’Anse Warden Electric Company L’Anse Warden L’Anse, MI 20 Yes No Wood chips
Leaf Clean Energy Company Multitrade Telogia Bristol, FL 14 No No Logging and mill residue, hogged fuel, peanut hulls
Lee County Solid Waste Authority Covanta Lee Inc. Ft. Myers, FL 57 No No Municipal solid waste
London Economics Merced Power LLC Merced, CA 10.5 No No Woody biomass
Los Angeles County Sanitation Districts Commerce Refuse-to-Energy Facility Commerce, CA 11.5 No No Municipal solid waste
Macpherson Energy Corporation Mt. Poso Cogeneration Company LLC Bakersfield, CA 44 Yes No Orchard & vineyard prunings, nut shells, fruit pits, C&D waste
Maple Island FH Stoltze Land & Lumber Columbia Falls, MT 3 Yes No Mill residue
Marquette Green Energy LLC Marquette Green Energy LLC - Gwinn Gwinn, MI 34 Yes No Tire-derived fuel, wood, waste wood
Maryland Environmental Service Eastern Correctional Institute Cogeneration Plant Westover, MD 3.8 Yes No Woody biomass
MeadWestvaco MeadWestvaco Corporation - Covington Covington, VA 75 Yes No Logging and paper making residues
Miami-Dade County Covanta Dade Renewable Energy Doral, FL 77 No No Municipal solid waste, wood waste
Mid-Maine Waste Action Corp. MMWAC Resource Recovery Facility Auburn, ME 3.6 No No Municipal solid waste
Minnesota Power Hibbard Energy Center Duluth, MN 72.8 Yes Yes Cellulose mattress fill, wood waste, oily rags
Minnesota Power Rapids Energy Center Grand Rapids, MN 26.5 No Yes Logging and mill residue
New Hanover County New Hanover County WASTEC Wilmington, NC 10.3 No No Municipal solid waste
Nippon Paper Industries USA NPI USA Co-Generation Facility Port Angeles, WA 20 Yes No Logging and mill residue
North American Power Group Rio Bravo Fresno Fresno, CA 28 No No Woody biomass
North American Power Group Rio Bravo Rocklin Lincoln, CA 24.4 No No Urban wood, ag wood waste
Northeast Maryland Waste Disposal Authority Covanta Montgomery Inc. Dickerson, MD 55 No No Municipal solid waste
Northeast Maryland Waste Disposal Authority Wheelabrator Baltimore LP Baltimore, MD 64.5 Yes No Municipal solid waste
Novo Power LLC Novo BioPower LLC Snowflake, AZ 27 Yes No Forest thinnings, mill residue
Olmsted County Environmental Resources Olmsted Waste-To-Energy Facility Rochester, MN 9.6 Yes No Municipal solid waste
Oswego County Solid Waste Authority Oswego County Energy Recovery Facility Fulton, NY 3.6 No No Municipal solid waste
Pasco County Covanta Pasco Inc. Spring Hill, FL 31.2 No No Municipal solid waste
Patriarch Partners LLC Old Town Fuel & Fiber Old Town, ME 28.5 Yes No Mill residue, residual fuel oil
Pecan Row Landfill Pecan Row Landfill Valdosta, GA No No Municipal solid waste, biogas
Color KeyExisting Under Construction Proposed Idled
10 | 2016 Biomass Industry Directory
U.S. Biomass Power Facilities List (continued)Source: Biomass Magazine / BBI International Please contact Steve Stucko, Data & Content Manager, with questions or comments regarding the 2016 Biomass Power List at [email protected].
Company Plant Name LocationNameplate Capacity (MW)
CHP Capability Cofire Coal Fuel Feedstock
Phoenix Energy Cabin Creek Biomass Energy Facility Truckee, CA 2 No No Woody biomass
Pinellas County Utilities Pinellas County Resource Recovery Facility St Petersburg, FL 75 No No Municipal solid waste
PSNH - Public Service of New Hampshire Northern Wood Power Portsmouth, NH 50 No Yes Whole chipped trees
ReEnergy Holdings LLC ReEnergy Ashland Ashland, ME 39 No No Woody biomass
ReEnergy Holdings LLC ReEnergy Black River Fort Drum, NY 60 No No Woody biomass, tire-derived fuel
ReEnergy Holdings LLC ReEnergy Chateaugay Chateaugay, NY 21 No No Woody biomass
ReEnergy Holdings LLC ReEnergy Fort Fairfield Fort Fairfield, ME 37 No No Woody biomass
ReEnergy Holdings LLC ReEnergy Livermore Falls Livermore Falls, ME 39 No No Woody biomass
ReEnergy Holdings LLC ReEnergy Lyonsdale Lyons Falls, NY 22 Yes No Whole chipped trees
ReEnergy Holdings LLC ReEnergy Sterling Sterling, CT 30 No No Woody biomass, tire-derived fuel
ReEnergy Holdings LLC ReEnergy Stratton Stratton, ME 48 No No Woody biomass
ReVenture Park ReVenture Park Charlotte, NC 3.6 Yes No Landfill gas
Rio Grande Valley Sugar Growers Inc. Rio Grande Valley Sugar Growers Santa Rosa, TX 23.5 Yes No Bagasse
Riverstone Holdings Coastal Carolina Clean Power Kenansville, NC 35 Yes No Woody biomass
Robbins Lumber Inc. Robbins Lumber Searsmont, ME 1.2 Yes No Woody biomass
RockTenn RockTenn - Tacoma Tacoma, WA 64 Yes No Mill residue
Rollcast Energy Inc. Cadillac Renewable Energy Cadillac, MI 44 No No Forest residue
Roseburg Forest Products Dillard Complex Roseburg, OR 51.5 Yes No Softwood
Sappi Fine Paper North America S D Warren Westbrook Westbrook, ME 62.5 Yes Yes Mill residue, black liquor, tire-derived fuel
Sappi Fine Paper North America Sappi Cloquet Mill Cloquet, MN 60.7 Yes No Mill residue
Sappi Fine Paper North America Somerset Plant Skowhegan, ME 116.9 Yes Yes Mill residue
SDS Lumber Co. SDS Lumber Gorge Energy Division Bingen, WA 10 Yes No Logging and mill residue
Seneca Sawmill Company Seneca Sustainable Energy Eugene, OR 19.8 Yes No Mill residue, forest residues
Sierra Pacific Industries Sierra Pacific - Aberdeen Aberdeen, WA 18 Yes No Logging and mill residue
Sierra Pacific Industries Sierra Pacific - Anderson Anderson, CA 5 Yes No Logging and mill residue
Sierra Pacific Industries Sierra Pacific - Burlington Mount Vernon, WA 28 Yes No Logging and mill residue
Sierra Pacific Industries Sierra Pacific - Burney Burney, CA 20 Yes No Logging and mill residue
Sierra Pacific Industries Sierra Pacific - Lincoln Lincoln, CA 19.2 Yes No Woody biomass
Sierra Pacific Industries Sierra Pacific - Loyalton Loyalton, CA 20 Yes No Mill residue
Sierra Pacific Industries Sierra Pacific - Quincy Quincy, CA 27.5 Yes No Mill residue
Sierra Pacific Industries Sierra Pacific - Sonora Sonora, CA 7.5 Yes No Logging and mill residue
Sierra Power Corporation Sierra Power Cogen Terra Bella, CA 7.5 Yes No Agricultural, logging and mill residue
Smurfit-Stone Container Corp. Stone Container Panama City Mill Panama City, FL 34 Yes No Paper mill waste
Snider Industries Inc. Snider Industries Marshall, TX 5 Yes No Woody biomass
Solid Waste Authority of Palm Beach Palm Beach Renewable Energy #1 West Palm Beach, FL 62.3 No No Municipal solid waste
Solid Waste Authority of Palm Beach Palm Beach Renewable Energy #2 West Palm Beach, FL 100 No No Municipal solid waste
South Boston Energy LLC NOVEC Energy Production, Halifax County Biomass (NEPHCB) South Boston, VA 49.9 No No Forest slash
Southeast Renewable Fuels LLC Southeast Renewable Fuels LLC - Clewiston Clewiston, FL 25 Yes No Sweet sorghum
Southern Power Company Southern Co. Nacogdoches Generating Facility Sacul, TX 100 No No Forest residue, wood processing residue, municipal solid waste
SP Newsprint Company SP Fiber Technologies - Newberg Newberg, OR 36 Yes No Logging residue, paper waste, paper mill sludge
Standardkessel Baumgarte Green Energy Team LLC Koloa, Kauai, HI 7.5 Yes No Eucalyptus, albizia
Stimson Lumber Company Plummer Cogen Plummer, ID 6 Yes No Wood waste
Taylor Biomass Energy LLC TBE-Montgomery LLC Montgomery, NY 24 No No Municipal solid waste, C&D and wood waste
Telogia Power Telogia Power Telogia, FL 14 No No Logging and mill residue, hogged fuel, peanut hulls
The Powell Group Agrilectric Power Partners Ltd. Lake Charles, LA 12.1 No No Waste stream
U.S. EcoGen LLC U.S. EcoGen Clay Generating Facility Green Cove Springs, FL 66 No No Eucalyptus grandis
U.S. EcoGen LLC U.S. EcoGen Martin Generating Facility Indiantown, FL 66 No No Eucalyptus grandis
U.S. EcoGen LLC U.S. EcoGen Okeechobee LLC Okeechobee, FL 66 No No Eucalyptus grandis
U.S. EcoGen LLC U.S. EcoGen Polk Generating Facility Fort Meade, FL 66 No No Waste wood, eucalyptus grandis
Union County Utilities Authority Covanta Union Inc. Rahway, NJ 44 No No Municipal solid waste
United States Sugar Corporation United States Sugar Corporation Clewiston, FL 50 Yes No Bagasse
US Renewables Group Niagara Generation LLC Niagara Falls, NY 56 No Yes Woody biomass, treated wood, tire-derived fuel, petroleum coke
USA Energy Group LLC Penobscot Energy Recovery Orrington, ME 25 No No Municipal solid waste, woody biomass
Warm Springs Forest Products Industries Warm Springs Forest Products Warm Springs, OR 9 Yes No Mill residue
Wasatch Integrated Waste Management District Wasatch Integrated Energy Recovery Layton, UT 1.6 No No Municipal solid waste
We Energies Rothschild Biomass Cogeneration Plant Rothschild, WI 50 Yes No Urban wood waste, mill residue
Wheelabrator Technologies Inc. Wheelabrator Concord Company LP Concord, NH 14 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator Falls Inc. Morrisville, PA 53.3 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator Gloucester Company LP Westville, NJ 14 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator Hudson Falls LLC Hudson Falls, NY 15 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator Millbury Inc. Worcester, MA 46 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator North Andover Inc. North Andover, MA 40 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator North Broward Inc. Pompano Beach, FL 68 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator Portsmouth Portsmouth, VA 60 Yes No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator Ridge Energy Inc. Auburndale, FL 50 No No Woodwaste, tire-derived fuel, landfill gas
Wheelabrator Technologies Inc. Wheelabrator Saugus Inc. Saugus, MA 38 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator Shasta Energy Co. Inc. Anderson, CA 50 No No Logging and mill residue, ag residue
Wheelabrator Technologies Inc. Wheelabrator South Broward Inc. Davie, FL 66 No No Municipal solid waste
Wheelabrator Technologies Inc. Wheelabrator Westchester LP Peekskill, NY 59.7 No No Municipal solid waste
Xcel Energy Bay Front Power Plant Ashland, WI 40 No No Wood waste, err ties
Xcel Energy French Island Generating Plant La Crosse, WI 30.4 No No Refuse-derived fuel, wood waste, RR ties
Xcel Energy Red Wing Red Wing, MN 20 No No Refuse-derived fuel, wood
Xcel Energy Wilmarth Generating Station Mankato, MN 20 No No Refuse-derived fuel, wood
York County Solid Waste Authority Covanta York Renewable Energy LLC York, PA 36.5 No No Municipal solid waste
Total Existing Nameplate Capacity: 6863 MW
Total Under Construction Nameplate Capacity: 107 MWTotal Proposed Nameplate Capacity: 479 MW
2016 Biomass Industry Directory | 11
Advantek Energy - Prospect PlantAgri Fibers Inc.ATP-SC LLCAlexander Energy Inc.Allegheny Pellet CorporationAllendale White Pellet PlantAmerican Pellet CompanyAmerican Wood Fibers - CirclevilleAmerican Wood Fibers - MarionAmerican Wood Fibers - WisconsinAppalachian Wood PelletsArbor Pellet LLCAssociated Harvest Inc.Barefoot Pellet CompanyBear Mountain Forest Products - Cascade LocksBear Mountain Forest Products- BrownsvilleBearlodge Forest ProductsBeaver Wood EnergyBiomass Power Louisiana LLCDry Creek ProductsPA PelletsBlue Mountain Lumber ProductsNew Biomass EnergyThermogen IndustriesConfluence Energy-KremmlingConfluence Energy-WaldenCorinth Wood Pellets LLCCornerstone Biomass Corp.Curran Renewable Energy LLCDejno’s Inc.Dover Resources Inc.Amite BioEnergyMorehouse BioEnergyEB Clean Energy Ltd. - BoardmanEden PelletsEnergex Pellet Fuel Inc.Enginuity Worldwide LLCEnova Energy Group - JohnstonEnova Energy Group - NahuntaEnova Energy Group - GordonEnviro Energy LLCEnvironmental Energy Partners LLCEnviva Pellets AhoskieEnviva Pellets AmoryEnviva Pellets Northampton LLCEnviva Pellets Southampton LLCEnviva Pellets WigginsE-Pellets Group - AthensEquustock - ChesterEquustock - ClareEquustock - MontebrookEquustock - TroyErnst BiomassEssex Pallet & PelletEureka Pellet MillsF.E. Wood & Sons - Natural EnergyFiber By-Products - White PigeonFiber Energy Products AR LLCOzark Hardwood PelletsFiber Recovery Inc.Fiber Resources Inc.Forest Energy Corp.Appling County Pellets LLCHazlehurst Wood Pellets, LLCFrank PelletsFulghum Graanul Oliver LLCOgeechee River Pellet MillGeneral Biofuels - GeorgiaGeneva Wood FuelsGerman Pellets Louisiana LLCGerman Pellets TexasGlobal Harvest OrganicsGo Green International Inc.Golden Peanut Co. - DawsonGolden Peanut Co. - HeadlandGreat Lakes Renewable Energy Inc.Green Circle Bio Energy-Miss. plantGreen Friendly Pellets LLCGreene Team Pellet Fuel CompanyGulf Coast Renewable EnergyHamer Pellet Fuel ElkinsHassell & Hughes Lumber CompanyHannas Candle CompanyHenry County Hardwoods Inc.Highland Pellets LLC - Pine BluffHorizon Biofuels Inc.Indeck Energy Ladysmith Biofuel Center LLC
ProspectRapid CityAllendaleSt. Mary’sYoungsvilleAllendaleCorunnaCirclevilleMarionSchofieldKingwoodSalt Lake CityLa FargevilleTroyCascade LocksBrownsvilleHulettFair HavenNatchitochesArcadeUlyssesPendletonQuitmanPortsmouthKremmlingWaldenCorinthLive OakMassenaKenoshaStocktonGlosterMorehouse ParishBoardmanChesapeakeMifflintownColumbiaJohnstonNahuntaGordonUnadillaSilver PlumeAhoskieAmoryGarysburgFranklinWigginsAthensChesterClareMontbrookTroyMeadvilleKeesevilleEurekaWest BaldwinWhite PigeonMountain ViewSeymourRinglePine BluffShow LowBaxleyHazlehurstMill CityOliverMillenSandersvilleStrongOllaWoodvilleAuroraPaigeDawsonHeadlandHaywardGeorge CountyBalsam LakeGarards FortWest MonroeElkinsCollinwoodFayettevilleParisWhite HallFremontLadysmith
MESDSCPAPASCMIOHVAWIWVUTNYPAORORWYVTLANYPAORMSNHCOCOMEFLNYWICAMSLAORVAPAMOSCGAGANYCONCMSNCVAMSGAVAMIFLVAPANYMTMEMIARMOWIARAZGAGAORGAGAGAMELATXMOTXGAALWIMSWIPALAWVTNARTNARNEWI
120,0008,047
13,0008,500
77,16266,13912,00050,00075,00025,000
Undisclosed60,000
8,00045,00040,000
120,0005,000
110,0001,000,000
100,00050,00020,000
250,000110,231100,000
65,00075,000
220,500100,000
40,00035,000
500,000496,040
30,00045,000
120,0006,000
500,000150,000545,644
1,80018,000
365,00090,000
551,156551,156136,000496,040
80,00036,00040,00040,00025,000
6,000Undisclosed
343,92165,00039,68385,00075,00050,00062,000
220,462551,156
21,000200,000396,832440,000
90,0001,100,000
551,15550,000
220,462UndisclosedUndisclosed
70,000500,000
17,00050,00060,00060,00030,000
2,00040,000
551,15620,00090,000
NoNoYesNoNoYesNoYesYesYesNoYesNoNoYesNoNoNoYesNoNoNoYesYesNoNoYesYesYesNoYesYesYesNoYesNoNoYesYesYesNoNoYesYesYesYesYesYesYesYesYesYesNoNoNoYesNoNoNoNoNoNoYesYesYesYesYesYesNoYesYesNoYesYesYesYesNoNoNoNoNoNoNoNoYesNoYes
Pine Beetle WoodPlant and Wood BiomassHardwoodHardwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwoodHardwood and SoftwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodSoftwoodHardwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodWoody BiomassSoftwoodSoftwoodHardwood and SoftwoodMill Residue (Yellow Pine)Hardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodWoody BiomassWoody Biomass/Wheat/Corn Stover/Areundo DonuxHardwood and SoftwoodHardwoodCorn Stover/MiscanthusSoftwoodSoftwoodWoody BiomassMixed Grass/WeedsSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and Softwood
Hardwood and SoftwoodHardwood and SoftwoodSoftwoodHardwood and SoftwoodSwitch GrassHardwood and SoftwoodSoftwoodHardwood and SoftwoodHardwoodHardwoodHardwoodHardwoodHardwoodSoftwoodHardwood and SoftwoodSoftwoodSoftwoodHardwood and SoftwoodWoody BiomassSoftwoodHardwoodSoftwoodHardwood and SoftwoodAlfalfa/Wood Residuals/Poultry LitterForest ThinningsPeanut HullsPeanut HullsHardwood and SoftwoodSoftwoodHardwoodHardwoodHardwood and SoftwoodHardwoodHardwoodWood Fiber/WaxHardwood
Hardwood and Softwood
Europe
Asia, EuropeAsia, EuropeAsia
Japan, Korea
Japan
Europe
EuropeEurope
United KingdomEuropeBelgium, Italy
Asia
United Kingdom
Europe
Europe
EuropeEuropeEuropeEuropeEuropeEuropeAustralia, Europe, Iceland, Italy, Korea, TaiwanAustralia, Europe, Iceland, Italy, Korea, TaiwanAustralia, Europe, Iceland, Italy, Korea, TaiwanAustralia, Europe, Iceland, Italy, Korea, Taiwan
Europe
EuropeEuropeEuropeEuropeEurope, United Kingdom
EuropeEurope
EuropeUnited KingdomUnited KingdomGermany, Netherlands, Poland
Europe
Canada
COMPANY PLANT NAME LOCATION FEEDSTOCK
PRODUCTIONCAPACITY (SHORT TONS/YR) EXPORTING DESTINATION
Note: Pellet mill map as of March 11, 2015-To add a pellet production facility to this map email [email protected]
Find up-to-date information at :www.biomassmagazine.com/plants/listplants/pellet/US/Source: Pellet Mill Magazine / BBI International
Pellet Mill Map List
Advantek Energy LLCAgri Fibers Inc.Agri-Tech Producers LLCAlexander Energy Inc.Allegheny Pellet CorporationAllendale White Pellet PlantAmerican Pellet CompanyAmerican Wood FibersAmerican Wood FibersAmerican Wood FibersAppalachian Wood PelletsArbor Pellet LLCAssociated Harvest Inc.Barefoot Pellet CompanyBear Mountain Forest ProductsBear Mountain Forest ProductsBearlodge Forest ProductsBeaver Wood EnergyBiomass Secure Power Inc.BioMaxx Inc.BioMaxx Inc.Blue Mountain Lumber ProductsBTH Quitman Hickory LLCCate Street CapitalConfluence Energy-KremmlingConfluence Energy-WaldenCorinth Wood Pellets LLCCornerstone Biomass Corp.Curran Renewable Energy LLCDejno’s Inc.Dover CapitalDrax Biomass International Inc.Drax Biomass International Inc.EB Clean Energy Ltd. - BoardmanEden PelletsEnergex CorporationEnginuity Worldwide LLCEnova Energy GroupEnova Energy GroupEnova Energy Group - GordonEnviro Energy LLCEnvironmental Energy Partners LLCEnviva LPEnviva LPEnviva LPEnviva LPEnviva LPE-Pellets Group LLCEquustock LLCEquustock LLCEquustock LLCEquustock LLCErnst BiomassEssex Pallet & PelletEureka Pellet Mills Inc.F.E. Wood & Sons - Natural EnergyFiber By-Products Corp.Fiber Energy Products AR LLCFiber Energy Products AR LLCFiber Recovery Inc.Fiber Resources Inc.Forest Energy Corp.Fram Renewable Fuels LLCFram Renewable Fuels LLCFrank PelletsFulghum Graanul Oliver LLCGeechee Energy LLCGeneral BiofuelsGeneva Wood Fuels LLCGerman Pellets GmbHGerman Pellets GmbHGlobal Harvest Organics LLCGo Green International Inc.Golden Peanut Company, Hull and FiberGolden Peanut Company, Hull and FiberGreat Lakes Renewable Energy Inc.Green Circle Bio Energy IncGreen Friendly Pellets LLCGreene Team Pellet Fuel CompanyGulf Coast Renewable EnergyHamer Pellet FuelHassell & Hughes Lumber CompanyHCC BrandsHenry County Hardwoods Inc.Highland Pellets LLCHorizon Biofuels Inc.Indeck Energy Services Inc.
Color KeyExisting Under Construction Proposed
12 | 2016 Biomass Industry Directory
U.S. Pellet Producers (continued)
International Biomass Energy LLCIsabella PelletNorthern Renewable EnergyGreen Circle Bio Energy IncJensen Lumber Co.Kirtland Products LLCKoetter & Smith Inc.Lee Energy SolutionsGreenwood FuelsLignetics of Idaho IncLignetics of Virginia Inc.Lignetics of West Virginia Inc.Log Hard Premium Pellets Inc.LowCountry BiomassMaeder Brothers Quality Wood Pellets Inc.Maine Woods Pellet CompanyMallard Creek Inc.Manke Lumber CompanyMarth Peshtigo Pellet Co. - PeshtigoMarth Wood Shavings SupplyMichigan TimberMichigan Wood FuelsMt. Taylor - WoodYouRecycleMt. Taylor Machine Pellet FuelNature’s Earth Pellets - LaurinburgNature’s Earth Pellets - ReformSpearfish Pellet Co. LLCDeposit Manufacturing FacilityJaffrey Manufacturing FacilitySchuyler Manufacturing FacilityNorth Idaho Energy Logs - HauserNorth Idaho Energy Logs - Moyie SpringsNortheast Pellets LLCNortheast Wood Products LLC - LigonierNortheast Wood Products LLC - PeeblesMalheur Pellet MillOlympus Pellets - SheltonO’Malley Wood PelletsOrganic Green Solutions - GreenvillePacific Pellet LLCPatterson Wood Products Inc.Pellet America Corp.Pellet Technology USAPellheat Inc.Penn Wood Products Inc.Colombo Energy Inc - GreenwoodPotomac Supply LLCLemhi Valley PelletsQueston Wood PelletsRisley Pellet Solutions LLCRocky Canyon Pellet Co.Dillard Composite SpecialtiesGeorgia BiomassShow Me Energy CooperativeSomerset Pellet FuelSouth Shore Biofuels LLCSouthern Indiana HardwoodsSouthern Kentucky Pellet Mill Inc.Southwest Renewable ResourcesSuperior Pellet Fuels LLCTelfair Forest Products LLCDeadwood Biofuels LLCWestervelt Renewable Energy LLCTrae Fuels Ltd - Pellet PlantTri State BiofuelsTurman Hardwood PelletsInstantheat Wood Pellets Inc.Varn Wood PelletsVermont Wood Pellet Co. LLCVulcan Renewables LLCVulcan Wood ProductsWest Oregon Wood Products - BanksWest Oregon Wood Products - Columbia CityWestern Wood Products Inc.Wood Pellet CoopWood Pellets C&C Smith LumberWoodgrain Millwork Inc.Woodshed Renewables LLCZilkha Biomass - CrockettZilkha Biomass - MonticelloZilkha Biomass - Selma
Lake IsabellaInternational FallsCottondaleOvidBoyne CityBordenCrossvilleGreen BayKootenaiKenbridgeLinnSpartansburgRidgelandWeidmanAthensRocklinTacomaPeshtigoMarathonFlintHollandAlbuquerqueMilanLaurinburgReformSpearsfishDepositJaffreySchuylerHauserMoyie SpringsAshlandLigonerPeeblesJohn DaySheltonTappahannockGreenvilleRedmondNacogdochesAppletonGretnaGlen HopeEast BerlinGreenwoodKinsaleSalmonWest WindsorMonticelloGrangevilleRoseburgWaycrossKingsvilleSomerset
HuntingburgGamalielSnowflakeNorth PoleLumber CityRapid CityAlicevilleBumpassLemont FurnaceGalaxAddisonHobokenNorth ClarendonSt AugustineVulcanBanksColumbia CityRatonPierzSummerhillPrinevilleFinleyCrockettMonticelloSelma
ALMIMNFLIDMIINALWIIDVAWVPASCMIMECAWAWIWIMIMINMNMNCALSDNYNHNYIDIDMEINOHORWAVAFLORTXWINEPAPASCVAIDVTWIIDORGAMOKYKYINKYAZAKGASDALVAPAVANYGAVTFLMIORORNMMNPAORNDTXARAL
Hardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodHardwood and SoftwoodHardwoodHardwoodPaper WasteSoftwoodHardwoodHardwoodHardwoodHardwoodHardwoodHardwood and SoftwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodHardwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwoodHardwood and SoftwoodSoftwoodSoftwoodHardwood
HardwoodSoftwoodPaper WasteCorn Stover/Corn Syrup/DDGSHardwoodHardwood
SoftwoodHardwood and SoftwoodSoftwoodHardwoodHardwood and SoftwoodSoftwoodSoftwoodBiomass CropsHardwoodHardwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodSoftwoodSoftwoodDebarked Clean Wood ChipsHardwoodHardwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and Softwood
485,01740,00050,000
660,00015,00035,00015,000
110,000120,000
80,00070,000
125,00025,000
220,46222,046
105,00060,00038,00064,00064,00018,00050,000
6,0006,000
100,00075,00055,00084,00084,00084,00060,00050,00040,000
130,00065,00022,00050,00040,000
100,00040,00040,00050,000
2,5005,0005,000
460,00050,000
2,60060,00042,00010,00040,000
825,00015,00050,000
100,00010,00012,00018,00035,000
150,00071,000
309,000130,000
50,00028,00050,00088,00016,600
132,2779,000
30,00050,00040,000
Undisclosed36,000
Undisclosed22,04644,000
413,000303,136
YesNoNoYesNoNoNoYesNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoYesYesNoNoNoYesNoNoNoNoYesNoNoNoNoNoYesNoNoNoNoNoYesNoNoNoNoNoNoNoYesYes
Europe, Japan, Scandinavia, S. Korea
United Kingdom
Canada, Italy, South KoreaCanada, Italy, South Korea
Japan
Italy
Undisclosed
Europe
Europe
EuropeEurope
Europe
Europe, Korea
Australia, Italy, S. KoreaAustralia, Italy, S. Korea
Asia, EuropeEuropeAsia, Europe
COMPANY PLANT NAME LOCATION FEEDSTOCK
PRODUCTIONCAPACITY (SHORT TONS/YR) EXPORTING DESTINATION
Total U.S. Existing Capacity - U.S. 11,158,927Total U.S. Under Construction Capacity - U.S. 3,381,698Total U.S. Proposed Capacity - U.S. 6,715,301
Pellet Mill Map List
International Biomass Energy LLCIsabella PelletJAL Holding LLCJCE Group ABJensen Lumber Co.Kirtland Products LLCKoetter & Smith Inc.Lee Energy SolutionsLibra GroupLigneticsLigneticsLigneticsLog Hard Premium Pellets Inc.LowCountry BiomassMaeder Bros. Inc.Maine Woods Pellet CompanyMallard Creek Inc.Manke Lumber CompanyMarth Peshtigo Pellet CompanyMarth Peshtigo Pellet CompanyMichigan TimberMichigan Wood FuelsMt. Taylor Machine Pellet FuelMt. Taylor Machine Pellet FuelNature’s Earth Pellet Energy LLCNature’s Earth Pellet Energy LLCNeiman Enterprises Inc.New England Wood Pellet LLCNew England Wood Pellet LLCNew England Wood Pellet LLCNorth Idaho energy Logs Inc.North Idaho energy Logs Inc.Northeast Pellets LLCNortheast Wood Products LLCNortheast Wood Products LLCOchoco Lumber CompanyOlympus PelletsO’Malley Wood PelletsOrganic Green SolutionsPacific Pellet LLCPatterson Wood Products Inc.Pellet America Corp.Pellet Technology USAPellheat Inc.Penn Wood Products Inc.PortucelPotomac Supply LLCQb Corp.Queston Inc.Risley Pellet Solutions LLCRocky Canyon Pellet Co.Roseburg Forest ProductsRWE Innogy CogenShow Me Energy CooperativeSomerset Pellet FuelSouth Shore Biofuels LLCSouthern Indiana HardwoodsSouthern Kentucky Pellet Mill Inc.Southwest Renewable ResourcesSuperior Pellet Fuels LLCTelfair Forest Products LLCThe Earth Partners LPThe Westervelt CompanyTrae Fuels ltdTri State BiofuelsTurman Hardwood PelletsTwo Rivers TimberVarn Wood ProductsVermont Wood Pellet Co. LLCVulcan Renewables LLCVulcan Wood ProductsWest Oregon Wood Products Inc.West Oregon Wood Products Inc.Western Wood Products Inc.Wood Pellet CoopWood Pellets C&C Smith LumberWoodgrain Millwork Inc.Woodshed Renewables LLCZilkha Biomass EnergyZilkha Biomass EnergyZilkha Biomass Energy
Color KeyExisting Under Construction Proposed
2016 Biomass Industry Directory | 13
Canadian Pellet Producers
Canadian Northern Timber Canadian Northern Timber Courtice IndustriesDansonsDiacarbon EnergyDirect Pellet Industries Inc.Energex CorporationFoothills Forest Products Inc.Gildale FarmsGranules LGGranules LGGroupe Savoie Inc.H.J. Crabbe & Sons Ltd.K.D. Quality PelletsLa Crete Sawmills Ltd.LacWood IndustriesLauzon Recycled Wood Energy Inc.Lauzon Recycled Wood Energy Inc.Manning Diversified Forest Products LTD.Marwood Ltd.Meadow Lake Tribal Council Pellet MillMuskoka Timber Mills Ltd.New Forest Industries (Parent)Northern Energy Solutions Ltd.Pacific BioEnergy CorporationPinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Pinnacle Renewable Energy Inc. (Parent)Premium Pellet Ltd.Princeton Co-Generation Corp.Protocol Energy CorpRentech Inc.Rentech Inc.Resolute Forest ProductsShaw Resources - BelleduneShaw Resources - ShubenacadieSMG Wood PelletSPB SolutionsT.P. Downey & Sons Ltd.Trebio Renewable BiomassVanderhoof Specialty Wood ProductsVanderwell Contractors Ltd.Viridis Energy Inc.Viridis Energy Inc.Wawasum GroupWhitesand First Nation
Atlantic Fiber Resources - GoosebayAtlantic Fiber Resources - ChandlerHamilton BiofuelFriendly Fuels LimitedMerritt Wood Pellet and Torrefaction PlantDirect Pellet IndustriesGranules Combustibles Energex, Inc.Foothills Forest Products, Inc.Gildale FarmsGranules LG Inc.Granules LG InternationalGroupe Savoie Inc.H.J. Crabbe & Sons Ltd.K.D. Quality PelletsLa Crete Sawmills Ltd.LacWood IndustriesLauzon Recycled Wood Energy - PapineauvilleLauzon Recycled Wood Energy - Saint-PaulinNorth Country 100% Softwood PelletsMarwood Ltd.Meadow Lake Tribal Council Pellet MillMuskoka Timber Mills Ltd.New Forest Industries (Pellet Mill)Northern Energy Solutions Ltd.Pacific Bioenergy Pellet MillHouston Pellet Limited Partnership, Houston, BCPinnacle Renewable Energy Inc. - ArmstrongPinnacle Renewable Energy Inc. - Burns LakePinnacle Renewable Energy Inc. - QuesnelPinnacle Renewable Energy Inc. - StrathnaverPinnacle Renewable Energy Inc. - Williams LakeTolko/Pinnacle Pellet Plant - LavingtonPremium Pellet Ltd.Princeton Co-Generation Corp.Protocol Biomass Corp.Rentech Inc. - AtikokanRentech Inc. - WawaThunder Bay Pellet PlantShaw Resources - BelleduneShaw Resources - ShubenacadieMission Wood PelletSPB Bio MaterialsT.P. Downey & Sons Ltd.Trebio Renewable BiomassVanderhoof Specialty Wood ProductsVanderwell Contractors Ltd.Okanagan Pellet Co. Inc.Scotia Atlantic Biomass Co. Inc.Wawasum GroupWhitesand First Nation
GoosebayChandlerHamiltonEdmontonMerrittHaliburtonLac-MéganticGrande CacheSt. MarysSt-FelicienMashteuiatshSt-QuentinBristolNew LiskeardLa CreteHearstPapineauvilleSaint-PaulinHotchkissFrederictonMeadow LakeBracebridgeNew RichmondMiramichiPrince GeorgeHoustonArmstrongBurns LakeQuesnelStrathnaverWilliams LakeLavingtonVanderhoofPrincetonPrescottAtikokanWawaThunder BayBelleduneShubenacadieMissionPeterboroughWeldonPortage-du-FortVanderhoofSlave LakeWest KelownaMiddle MusquodoboitGreenstoneArmstrong
NLQCONABBCONQCABONQCQCNBNBONABONQCQCABNBSKONQCNBBCBCBCBCBCBCBCBCBCBCONONONONNBNSBCONNBQCBCABBCNSONON
120,000190,000
50,00027,21685,000
Undisclosed120,000
30,00012,000
120,00080,00055,00040,00045,00070,00010,00058,00058,06015,00010,000
6,00050,000
125,000200,000400,000220,000
60,000440,000100,000220,000200,000270,000140,000108,000400,000100,000450,000
45,000100,000
50,000160,000
UndisclosedUndisclosed
130,00015,00050,00060,000
120,00067,00068,000
YesYesYesNoYesYesYesNoNoYesYesYesNoYesYesYesYesYesYesNoNoNoYesYesNoYesYesYesYesYesYesNoNoYesYesYesYesNoYesNoYesYesNoYesNoYesYesYesYesYes
Denmark, Sweden United Kingdom
KoreaItalyEurope, USA
Italy, USAItaly, USAEuropeUSAUnited KingdomUndisclosedItalyEurope
Asia, Europe, USA
Europe
Asia, EuropeAsia, EuropeAsia, EuropeAsia, EuropeAsia, EuropeAsia, Europe
Asia, EuropeEuropeEuropeEurope
Europe
AsiaUSA
Europe
USAEuropeEuropeEuropeEurope
SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodMill ResidueHardwood and SoftwoodHardwood and SoftwoodSoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodHardwood and SoftwoodSoftwoodHardwood and SoftwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwood and Softwood
SoftwoodSoftwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodSoftwoodMill ResidueSoftwoodSoftwoodHardwood and Softwood
Crown Forest WoodSoftwoodHardwood and SoftwoodHardwood and Softwood
Oat HullsHardwood and SoftwoodHardwood and SoftwoodSoftwoodSoftwoodSoftwoodHardwood and SoftwoodHardwoodHardwood and Softwood
COMPANY PLANT NAME LOCATION FEEDSTOCK
PRODUCTION CAPACITY (METRIC TONS/YR) EXPORTING DESTINATION
Pellet Mill Map List
Total Existing Capacity - Canada 3,242,060Total Under Construction Capacity - Canada 855,000Total Proposed Capacity - Canada 1,452,216
Color KeyExisting Under Construction Proposed
PARTNERSHIPS FOR INNOVATIONDRIVING SUCCESS IN BIOENERGY
REGISTER NOW bioenergyconference.org
Contact us for more information: Event Manager, Cam McAlpinecam bioenergyconference.org • +1.250.961.6611
Join us in Prince George, Canada for the 7th International Bioenergy Conference and Exhibition.
Over the three days of the conference, held at the centre of one of the largest biomass fi bre baskets
in the world, there will be many opportunities to learn more about the industry in British Columbia
as well as the latest global trends in fi bre supply, sustainability, products, technology, policies and
other drivers of the future bioeconomy.
15 - 17 JUNE 2016PRINCE GEORGE, BC, CANADA
Ag Products & Services Feedstock Collection Systems
Ag Products & Services
Associations & Organizations
Feedstock Collection Systems
Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]
AGCO Corporation4205 River Green ParkwayDuluth, GA 30096 USGlenn Farris, Segment Strategy Manager, Biomass/IndustrialsPhone (770-662-0256)[email protected]
New Holland Agriculture500 Diller AvenueNew Holland, PA 17557 USJarrod Angstadt, Manager, Growth Initiatives, Biomass & SpecialtyPhone (281-687-9159) | Fax (281-763-2632)[email protected]/na
Feedstock Procurement
Equinox LLC4255 43rd Ave SFargo, ND 58104 USKyle Althoff, PresidentPhone (303-910-6052)[email protected]
Associations & Organizations
Advanced Biofuels USA507 North Bentz StreetFrederick, MD 21701 USJoanne Ivancic, Executive DirectorPhone (301-644-1395)[email protected]
Biomass Thermal Energy Council1211 Connecticut Ave NW #650Washington, DC 20036 USJoel Stronberg, Executive DirectorPhone (202-596-3974) | Fax (202-223-5537)[email protected]
International Bioenergy Conference & Exhibition PO Box 1421323 5th AvePrince George, V2L 4R9 CANADACam McAlpine, PresidentPhone (250-961-6611)[email protected]/SEE OUR AD ON PAGE 15
www.nsfsustainability.org | [email protected] | +1 734 827 5668
North American pellet manufacturers now have the opportunity
to obtain certification to the Sustainable Biomass Partnership
Framework through NSF Sustainability, the first approved
SBP certification body in North America and leader in forest
certification services.
Get certified to the SBP Framework through
Associations & Organizations
International Biomass Conference & ExpoPhone (866-746-8385)[email protected] OUR AD ON PAGE 14
Global Pellet Market Outlook SummitPhone (866-746-8385)[email protected]
Conferences/Trade Shows & Meetings
Maine Pellet Fuels Association 97A Exchange StreetSuite 305Portland, ME 04101 USWilliam Bell, Executive DirectorPhone (207-752-1392)[email protected]
Certifications
Associations & Organizations
Certifications
NSF International789 N. Dixboro RoadAnn Arbor, MI 48105 USJamie Bush, Business Development Manager - SustainabilityPhone (734-827-5668)[email protected] OUR AD ON PAGE 17
Control Union Certifications150 North University DriveSuite 210Plantation, FL 33324 USRobert Demianew, Regional DirectorPhone (954-900-2087)[email protected]://controlunion.com/en
18 | 2016 Biomass Industry Directory
Conferences/Trade Shows & Meetings
Conferences/Trade Shows & Meetings
Balers - Rectangle
AGCO Corporation4205 River Green ParkwayDuluth, GA 30096 USGlenn Farris, Segment Strategy Manager, Biomass/IndustrialsPhone (770-662-0256)[email protected]
Forest Concepts, LLC3320 West Valley Hwy NAuburn, WA 98001 USMike Perry, CEOPhone (253-333-9663) | Fax (253-833-2639)[email protected]
Balers - Round
Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]
Briquetting
DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Chippers - Brush
Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]
Please visit www.cbi-inc.com or call 603-382-0556Continental Biomass Industries
22 Whittier StreetNewton, NH 03858
RECYCLING SYSTEMS DONE RIGHT.
Within the construction and demolition waste recycling industry, CBI’s complete, custom systems allow for the separation of usable (recyclable) materials from mixed waste. The unusable waste is shredded into a reduced size; therefore, it takes up far less space in landfills. In some cases, a single landfill can be used for 30 years longer as a result of this size reduction. This results in less landfills and more natural surroundings!
CBI_Directory Listing_2016.indd 1 11/19/2015 11:23:32 AM
Densification & Size Reduction
International Fuel Ethanol Workshop & ExpoPhone (866-746-8385)[email protected]
Densification & Size ReductionDensification & Size Reduction Chippers - Brush
Please visit www.cbi-inc.com or call 603-382-0556Continental Biomass Industries
22 Whittier StreetNewton, NH 03858
RECYCLING SYSTEMS DONE RIGHT.
Within the construction and demolition waste recycling industry, CBI’s complete, custom systems allow for the separation of usable (recyclable) materials from mixed waste. The unusable waste is shredded into a reduced size; therefore, it takes up far less space in landfills. In some cases, a single landfill can be used for 30 years longer as a result of this size reduction. This results in less landfills and more natural surroundings!
CBI_Directory Listing_2016.indd 1 11/19/2015 11:23:32 AM
Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Chippers - Rechipper
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Chippers - Whole Log
Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]
Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]
ANDRITZ5405 Windward Parkway, Suite 100WAlpharetta, GA 30004 USDave Evans, Area Sales ManagerPhone (770-640-2431)[email protected] OUR AD ON PAGE 22
Grinders - Horizontal
Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]
Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]
Apollo Equipment2062 20th Ave. S.E.Largo, FL 33771 USWayne Brown, Executive Vice PresidentPhone (503-585-1442) | Fax (727-585-3499)[email protected]
2016 Biomass Industry Directory | 21
Densification & Size Reduction Grinders - Horizontal
Continental Biomass Industries (a Terex brand)22 Whittier St.Newton, NH 03858 USArt Murphy, Marketing ManagerPhone (603-382-0556)[email protected] OUR AD ON PAGE 19
Rawlings Waste Wood Recovery SystemsPO Box 4485Missoula, MT 59806 USJohn Rawlings, PresidentPhone (406-728-6182) | Fax (406-728-7957)[email protected] OUR AD ON PAGE 18
Vecoplan, LLCPO Box 7224High Point, NC 27264 USYuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 16
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Grinders - Tub
Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]
Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]
Grinders - Vertical
Virtus Equipment340 Commerce Drive, Unit BCrystal Lake, IL 60014 USThomas Breslin, PresidentPhone (815-477-2100)[email protected]
Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23
Vecoplan, LLCPO Box 7224High Point, NC 27264 USYuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 16
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Mills - Hammer
CPM Global Biomass Group181 Davis Johnson Dr, Suite JRichland, MS 39218 USTim Gilbert, Sales ManagerPhone (601-932-9080) | Fax (601-932-9081)[email protected] OUR AD ON PAGE 20
ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22
Bliss Industries, LLC1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601 USChad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
Pellet Mills
CPM Global Biomass Group181 Davis Johnson Dr, Suite JRichland, MS 39218 USTim Gilbert, Sales ManagerPhone (601-932-9080) | Fax (601-932-9081)[email protected] OUR AD ON PAGE 20
LM Machinery and Equipment, LLC401 Liberty Ave. Three Gateway Center, Suite 1651Pittsburgh, PA 15222 USWladimiro Labeikovsky, PresidentPhone (412-608-8528) | Fax (412-904-7530)[email protected]://www.lm-machinery.net/
ABC Machinery19F, Suite B, Global Trade Mansion, Wenfeng AvenueAnyang, HENAN 455000 ChinaTina Lee, General ManagerPhone (86-372-5965148)[email protected]://www.pellet-machine.com/
ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22
Bliss Industries, LLC1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601 USChad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]
Densification & Size Reduction
22 | 2016 Biomass Industry Directory
Densification & Size Reduction
Densification & Size Reduction Pellet Mills
Education
International Generator Technical CommunityPO Box 370Columbus, OH 43215 USJane Hutt, Webmaster and Site ManagerPhone (360-515-7861)webmaster@generatortechnicalforum.orgwww.powerplanttechnicalforum.org
Education
GEMCO Energy MachinerySuite B,4/F Jinhao Business Bld.,Renmin Rd.,Anyang,Henan,P.R.C455000 CHINAYanooka Yang, Pellet Mill ManufacturerPhone (0086-372-5965148)Fax (0086-372-5951936)[email protected]://www.gcmec.com
ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23
Vecoplan Midwest4005 Earnings WayNew Albany, IN 47150 USBill Miller, Chief Operating OfficerPhone (812-923-4992)[email protected] OUR AD ON PAGE 16
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Pyrolysis
Biochar Now, LLC1907 Gail CtLoveland, CO 80537 USJames Gaspard, EVP Business DevelopmentPhone (970-622-8071)[email protected]
Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810)Fax (412-788-9822)[email protected]
Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575) | Fax (660-263-2526)[email protected] OUR AD ON PAGE 32
Torrefaction
CNFbiofuel5038 Salida BlvdPO Box 1316Salida, CA 95368 USJohn Paoluccio, PresidentPhone (209-545-1663) | Fax (209-545-3533)[email protected]
Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810) | Fax (412-788-9822)[email protected]
Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575)Fax (660-263-2526)[email protected] OUR AD ON PAGE 32
Employment Executive Search
2017 Biomass Industry Directory | 23
Engineering & Construction
MULTI-FUEL, MOVING GRATE, BIOMASS BOILER
HOT WATER & STEAM / AUTOMATIC ASH REMOVAL
WOOD CHIPS, POULTRY LITTER / HORSE MANURE
PELLETS / RICE HULLS 2,000,000 BTU to 20,000,000 BTU
RENEWABLE ENERGY
CONSULTANTS, LLC
BIOMASS EQUIPMENT SUPPLY CO.(Div. of REC, LLC)
MULTI-FUEL BIOMASS BOILERBIOCHAR SYSTEM / AUTO ASH REMOVAL
CONTAINER SYSTEMS / COLORING SYSTEMSDRYING SYSTEM
100,000 BTU / 300,000 BTU / 500,000 BTU
ANDMULTI-FUEL HOT WATER BOILER
AUTO ASH REMOVALWOOD CHIPS / POULTRY LITTER /
HORSE MANUREGRASSES / PELLETS
68,000 BTU to 1,700,000 BTU
P.O. Box 41Beavertown, PA 17813
570-765-2020 / [email protected]://renewableenergyconsult.us
Densification & Size Reduction
Education
Anaerobic Digestion Systems
ADI Systems Inc.370 Wilsey RoadFredericton, NB E3B 6E9 CANADAShannon Grant, PresidentPhone (506-452-7307)[email protected]
BIOFerm Energy Systems440 Science DriveSte 300Madison, WI 53711 USWhitney Beadle, Marketing CommunicationsPhone (608-229-6504)[email protected]
BIOGAS Equity 2, Inc.130 Eleanor Dr.Woodside, CA 94062 USMike Muller, COOPhone (650-283-9555)[email protected]
Impact Bioenergy Inc.1001 NW 167th StShoreline, WA 98177 USJan Allen, PresidentPhone (206-250-3242)[email protected]
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]
UEM1818 S. Australian Ave. Suite 110West Palm Beach, FL 33409 USNina Kshetry, Project ManagerPhone (561-294-0138)Fax (561-683-2996)[email protected]
Biomethane
Morrow Renewables, LLCPO Box 61447Midland, TX 79711 USLuke Morrow, PresidentPhone (432-563-0447)[email protected]
First Environment, Inc.91 Fulton StreetBoonton, NJ 07005 USKristy Cerullo, Marketing/Proposal ManagerPhone (973-334-0003Fax (973-334-0928)[email protected]
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]
Three-esVia Libertà 105Lazzate, MB 20824 ITALYMarco Soldo, ManagerPhone (0039-02-9632-8225) | Fax (0039-02-9632-0029)[email protected]
Executive Search
H.T. PROF Clean Tech575 N. Patterson Ave.Suite 444Winston-Salem, NC 27101 USTodd Porter, PresidentPhone (770-420-7440) | Fax (770-420-7440)[email protected]/clean-tech.htm
Olson Search International, Inc.PO Box 3127Redmond, WA 98073 USJon Olson, PresidentPhone (800-985-5191) | Fax (406-756-5154)[email protected]
Employment
Engineering & Construction Buildings
Engineering & Construction
Buildings
Legacy Building Solutions 19500 County Rd 142South Haven, MN 55382 USJenniefer Halverson, Business ResourcePhone (320-258-0500)jhalverson@legacybuildingsolutions.comwww.legacybuildingsolutions.com/industries/waste-recycling/
Alberici Constructors, Inc.8800 Page Ave.Saint Louis, MO 63114 USVictoria Fleddermann, Director of Business DevelopmentPhone (314-733-2256)[email protected]
ICS, Inc. PO Box 13158Grand Forks, ND 58208-3158 USDavid Dangerfield, Project DevelopmentPhone (701-775-8480)Fax (701-775-8479)[email protected]
Miron Construction Co., Inc.1471 McMahon DriveNeenah, WI 54956 USDan Goymerac, Vice President Industrial Business DevelopmentPhone (920-969-7004)Fax (920-969-7393)[email protected]
Rubb Buildings Inc.1 Rubb LaneSanford, ME 04073 USChuck Auger, Marketing ManagerPhone (207-324-2877)[email protected]
CHP Systems
Turboden Srl628 Hebron Avenue, Suite 400Glastonbury, CT 06033 USIlaria Peretti, Manager, Sales & Business Development North AmericaPhone (860-881-0281)[email protected] OUR AD ON PAGE 28
PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606)Fax (816-531-2195)[email protected]
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23
RR Renewable Energy23 Lafayette StRumson, NJ 07760 USGeorge Saintonge, PresPhone (732-768-7007)Fax (732-741-2087)[email protected]
Experience and Innovation Working for You
We are a full service, consulting engineering firm that provides a broad range of professional engineering services. Our multi-disciplined staff has served state and local governments as well as industrial and commercial clients across the United States and around the world.
1658 Malvern AvenueHot Springs, AR 71901
501-321-2276
Multiple locations to serve you
200 MacKenan Drive Cary, NC 27511919-481-1084
70 Spring StreetMillinocket, ME 04462
207-723-6871
We have provided engineering services and management to Biomass, Bio-Energy & Green Energy Industries for projects and companies of every size at sites all across North America.
From the feedstock handling to the final emission controls, let us utilize our expertise and 45 years of experience
to design engineering solutions for your specific needs.
Call us today at
501-321-2276
www.mseco.comFor more information visit
Engineering & Construction
Engineering & Construction CHP Systems
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]
Civil Engineering
Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276)Fax (501-624-4214)[email protected] OUR AD ON PAGE 24
Detailed Design
PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]
Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24
District Heating Systems
Wisewood, Inc2409 N. Kerby Ave. Portland, OR 97227 USMeagan Nuss, Project Development CoordinatorPhone (503-706-6187) | Fax (503-715-0483)[email protected]
Electrical
APT Consulting Group Co., Ltd.3/1 Muang Thong Thani Bldg. C7Popular Road, BangpootPakgret, Nonthaburi, 11120 THAILANDJohn Diecker, Managing DirectorPhone (6624-02-5235)[email protected]
ISC Companies12905 Highway 55 WestMinneapolis, MN 55441 USLindsay Distel, MarketingPhone (763-559-0033) | Fax (763-519-1574)[email protected]
EPC
Dome Technology 4946 North 2900 EastIdaho Falls, ID 83401 USLane Roberts, Business Development ManagerPhone (208-227-1485)[email protected]
Alberici Constructors, Inc.8800 Page Ave.Saint Louis, MO 63114 USVictoria Fleddermann, Director of Business DevelopmentPhone (314-733-2256)[email protected]
Fagen, Inc.501 W Hwy 212Granite Falls, MN 56241 USRick Cantor, VP - Business DevelopmentPhone (864-627-0060) | Fax (320-564-3324)[email protected]
PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
Fabrication
Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27
AGRA Industries1211 West Water StreetMerrill, WI 54452 USPat Hinner, PresidentPhone (800-842-8033)[email protected] OUR AD ON PAGE 26
Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35
Kent Industrial Co., Ltd.No.17, Dou-Kung 9th Rd., Dou Liu Expanded Industrial Park, Dou Liu City,Yun Lin Hsien, 640 TAIWANSteve Lien, Sales ManagerPhone (88655575356) | Fax (88655575136)[email protected]://www.surface-grinder-kentind.com/
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Precision Injection-Multiplas Enginery Co., Ltd.No.65, Technology 7th Road, Hwa-Ya Technology Park,Taoyuan, 33333 TAIWANApple Wang, Marketing SpecialistPhone (88633180090) | Fax (88633975498)[email protected]://www.injection-molding-machines.com/
Gasifi ers
Biotech Energy102 Pineridge DriveMissoula, MT 59803Patrick Browne, Vice President of Sales and MarketingPhone (518-564-0513)[email protected] OUR AD ON PAGE 25
Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27
Green Star Gasifi ers, LLC127 Dishman Ln, Suite B-1Bowling Green, KY 42101 USChris Jeff ries, PresidentPhone (270-904-4964) | Fax (270-721-0134)info@greenstargasifi ers.comwww.GreenStarGasifi ers.com
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
Engineering & Construction EPC
www.AgrAInd.com800-842-8033 AGRA has Custom-DesigneD Biomass solutions for You!
to faBriCationfrom Design
AGRAIndustries
Your ePC ContraCtor
to ComPletion!
Engineering & Construction
2016 Biomass Industry Directory | 27
(562) 634-6425 | WWW.COLUMBIASPECIALTY.COM2) 634-6425 | WWW.COLUMBIASW.COLU BIAS62) 634-6425 | WWW.COLUMBIASPECIALTY.COWWW.CO| W2) MWWW
CALL US TODAY, WE WILL HELP YOUTURN YOUR IDEAS INTO FINISHED PRODUCTS
TODAY, WE WILL HELP YOUCALL US TODAY, WE WILL HELP YOUTODAY, WTODODAY, WE UP YLP YOUHE OTO OOCUSTOM MANUFACTURING
SPECIALIZING IN WELDING AND MACHINING OF HIGHTEMPERATURE, CORROSION RESISTANT ALLOYS.
ALIZING IN WELDING AND MACHINING OF HIGIN WELDING AND MACHINING OF HIGHCIALIZING IN WELDING AND ALIZZING IN WELDING AND ACHINING OF HIGHACMAMACAAAZZIZZIZZZ NGINZ G ACHINING OF HHIGC HCZZZZZ NZ NGH OIH GC ACIALC AERATURE CORROSION RESISTANT ALORROSION RESISTANT ALLOYSMPERATURE CORROSION RERATURE CORROSION R SISTANT ALLOYSREEE STANT ALLOOYSTT N L
DISTRIBUTOR AND FABRICATOR OF CARBON, STAINLESS AND ALLOY PIPING MATERIALS
Engineering & Construction Gasifi ers
Engineering & ConstructionSmart E2 Solutions14 Edgewood RoadRumson, NJ 07760 USGeorge St.Onge, Director of Business DevelopmentPhone (732-768-7007) | Fax (732-758-1169)[email protected]
Information Technology Services
ALDATA Software203, 211 Pembina Ave.Hinton, AB T7V 2B3 CANADAMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)[email protected]
Simplyfeye Softwares Pvt LtdFlat S1, 2nd Floor, 8-3-970Srinagar ColonyHyderabad 500073 INDIAAnshuman Bansal, DirectorPhone (914042217057)[email protected]://www.simplyfeye.com
Management Services
Alberici Constructors, Inc.8800 Page Ave.Saint Louis, MO 63114 USVictoria Fleddermann, Director of Business DevelopmentPhone (314-733-2256)[email protected]
Piping
Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Plant Optimization
Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24
Power Plant Construction
Turboden Srl628 Hebron Avenue, Suite 400Glastonbury, CT 06033 USIlaria Peretti, Manager,Sales & Business Development North AmericaPhone (860-881-0281)[email protected] OUR AD ON PAGE 28
ASI Industrial1300 Minnesota AveBillings, MT 59101 USRobert Hamlin, PresidentPhone (406-245-6231) | Fax (406-245-6236)[email protected]
Casey Industrial, Inc.1400 West 122nd Ave., Ste 200Westminster, CO 80234 USTom Lepak, Vice PresidentPhone (720-974-2659)[email protected]
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
2016 Biomass Industry Directory | 29
Engineering & Construction
Engineering & Construction Power Plant Construction
TEi Construction Services170 Tucapau RdDuncan, SC 29334 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/tei-construction-services-incSEE OUR AD ON PAGE 7
Pyrolysis
Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27
Enginuity Worldwide651 E Commerce RoadMexico, MO 65255 USNancy Heimann, President, CEOPhone (573-567-4417)[email protected]
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575) | Fax (660-263-2526)[email protected] OUR AD ON PAGE 32
Stacks
Hoffmann, Inc.6001 49th St. SouthMuscatine, IA 52761 USPaul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)[email protected]
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Structural Fabrication
Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27
Alaska Structures9024 Vanguard Drive #101Anchorage, AK 99507 USAlaska Structures, InquiryPhone (907-344-1565)[email protected]://alaskastructures.com
Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Torrefaction
Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575) | Fax (660-263-2526)[email protected] OUR AD ON PAGE 32
30 | 2016 Biomass Industry Directory
FUEL | AIR | GAS | ASH processbarron.com/biomass
205-663-5330
BIOMASS to ENERGYProcessBarron is there every step of the way.
Biomass diagram july 15.indd 1 6/9/2015 10:20:30 AM
Engineering & Construction
Engineering & Construction Water Treatment
Water Treatment
Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]
Feedstock Supply
Ag Residues
Global Sustainable Products, Inc.4879 Magnolia RoadMarianna, FL 32448 USJoe Busby, PresidentPhone (850-209-1331)[email protected]
Biomass Based Fuel Oil
Green Energy of FL12429 Colony Preserve DrBoynton Beach, FL 33436 USJeff Balsewich, CEOPhone (561-922-7475)[email protected]
Briquettes
Karr Group Co.14500 Roscoe Blvd. Ste 203Panorama City, CA 91402 USKevin Talwar, Sales DirectorPhone (805-479-5565) | Fax (805-479-5565)[email protected]
2016 Biomass Industry Directory | 31
www.cratos.us.com
Biomass Conveyor Systems Ash handling and fuel delivery
Lehra Energy Resources Pvt LtdLehra near Dehlon District Ludhiana PunjabLudhiana , 141118 INDIAHardeep Singh Ubhi, Executive Director Phone (00919815771137) | Fax (01612885137)[email protected]
Dedicated Energy Crops
Genera Energy Inc167 Tellico Port RoadVonore, TN 37803 USSam Jackson, VP, Business DevelopmentPhone (423-884-4110)[email protected]
Pellets
Curran Renewable Energy, LLC20 Commerce DriveMassena, NY 13662 USKelli Curran, Marketing ManagerPhone (315-769-2000)[email protected]
Golden Peanut and Tree NutsP.O. Box 186Headland, AL 36345 USBeverly Warrington, Director, Hull & Fiber ProductsPhone (334-693-0011) | Fax (334-693-0112)[email protected]
Lewis & Raulerson1759 State StreetWaycross, GA 31501 USMike Cifranic, Sales EngineerPhone (912-282-0975) | Fax (912-285-3283)[email protected]
ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
ProPellet, LLC807 Broadway Street NE, Suite 185Minneapolis, MN 55413 USKathy Osborne, Business Development ManagerPhone (612-616-7409)[email protected]
Wood Chips
CDW Consultant GroupP.O. Box 923Bloomington, TX 77951 USCharles White, Managing MemberPhone (361-237-9339) | Fax (210-800-9993)[email protected]
M-E-C Company4401 Belle Oaks Drive,Suite 210Charleston, SC 29405 USStephen Rice, COOPhone (620-325-2673) | Fax (620-325-2678)[email protected]
Feedstock Supply
Feedstock Supply Briquettes
Legal Services
Attorney
Conn Maciel Carey5335 Wisconsin Avenue, NWSuite 660Washington, DC 20015 USEric J. Conn, Chair, OSHA Practice GroupPhone (202-715-6244) | Fax (202-827-7903)[email protected]
Davis Brown Law Firm215 10th Street, Suite 1300Des Moines, IA 50309 USBill Hanigan, AttorneyPhone (515-288-2500) | Fax (515-243-0654)[email protected]:/www.davisbrownlaw.com
Husch Blackwell LLP13330 California StSuite 200Omaha, NE 68154 USDavid Gardels, PartnerPhone (402-964-5027)[email protected]
Potomac Law Group, PLLC6225 Hampstead Ct.Port Tobacco, MD 20677 USNeil Belson, Of Counsel and Chair of Life Sciences PracticePhone (240-416-7239) | Fax (301-392-9806)[email protected]://www.potomaclaw.com/attorney-profiles/neil-belson/
Algae and Cellulose DryingAlgae and Cellulose Dryinggyinyingygae and Cellulond Celluloseuloseeaaa DDe Dosseselosee Dryryulol oseulose Drse DAlg eaaaa sosod Ced CAlggAAlga ee and CeAlgae and CeCellulose DDDDD y ngDrryi ggng
Woody Biomass DryingWoody Biomass Drying
Torrefaction & CharcoalTorrefaction & Charcoalaal
32 | 2014 Biomass Industry Directory
2016 Biomass Industry Directory | 33
Legal Services Attorney
Legal Services
Schnader Harrison Segal & Lewis LLPSuite 2700 Fifth Avenue Pl.120 Fifth AvenuePittssburgh , PA 15222 USMegan Harmon, PartnerPhone (412-577-5200)[email protected]
Business
LLJ Consulting & Business Development16675 Market AvenueCologne, MN 55322 USLarry Johnson, OwnerPhone (952-466-3363)[email protected]
Zhengzhou Victor Machinery Co LtdWenhua Roand and Sanquan RoadZhengzhou, CHINAJames Duan, SalesmanPhone (008637156747890)[email protected]://victormachinez.com/
Permit & License
Alcohol Tax Consultants, Inc.P.O. Box 1595Madison Square StationNew York, NY 10159 USMatt Zuckerman Phone (917-771-9906)[email protected]
Material Handling & Storage
Conveyor-Belt
4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa
Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35
ProcessBarron2770 Welborn St.Pelham, AL 35124 USCliff Moss, VP and Director of Materials Handling DivisionPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
Conveyor-Drag
Sigma Thermal, Inc4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53
AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]
DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]
ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
RUD Chain Inc.PO Box 367Hiawatha, IA 52233 USMike Mews, North American Sales ManagerPhone (319-375-3224)| Fax (319-214-0003)[email protected] OUR AD ON PAGE 31
Sukup Manufacturing Co.PO Box 6771555 255th St.Sheffield, IA 50475-0677 USJohn Hanig, Bin Sales DirectorPhone (641-892-4222)| Fax (641-892-4629)[email protected]
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
Conveyor-Enclosed
Hudco Industrial Products, Inc.3100 Morgan RoadBessemer, AL 35022 USBryant Allen, General ManagerPhone (800-247-9908)[email protected]://www.hudcoinc.com/SEE OUR AD ON PAGE 34
34 | 2016 Biomass Industry Directory
“The Most Efficient Belt Conveyor in the World, is also the Cleanest and most Reliable.”
Biomass Engineering & Equipment1457 Sunday DriveIndianapolis, IN 46217 USTim Brown, Product SpecialistPhone (317-522-0864) | Fax (317-346-0811)[email protected]
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
Conveyor-Mechanical
ASGCO “Complete Conveyor Solutions”301 Gordon StreetAllentown, PA 18102 USAaron Gibbs, PresidentPhone (610-821-0216) | Fax (610-778-8991)[email protected] OUR AD ON PAGE 39
Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35
RUD Chain Inc.PO Box 367Hiawatha, IA 52233 USMike Mews, North American Sales ManagerPhone (319-375-3224) | Fax (319-214-0003)[email protected] OUR AD ON PAGE 31
Stock Equipment Company16490 Chillicothe RoadChagrin Falls, OH 44023 USSusan Wiltshire, Technical WriterPhone (440-543-6000) | Fax (440-543-5944)[email protected]://www.schenckprocess.com/stockequipment
Vecoplan, LLCPO Box 7224High Point, NC 27264 USYuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 16
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
Conveyor-Pneumatic
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Conveyor-Screw
Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53
Material Handling & Storage Conveyor - Enclosed
Material Handling & Storage
2016 Biomass Industry Directory | 35
Material Handling & Storage
Material Handling & Storage Conveyor - Screw
DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748)Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821)Fax (800-554-4040)[email protected]
ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 55
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790)Fax (559-591-5728)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040)Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
Cranes-Overhead
Processbio A/SPO Box 34 Romeo, MI 48065 USJorgen Lyngso, American RepresentativePhone (586-255-7075)[email protected]
Dryer - Conveyor
CPM Wolverine Proctor, LLC251 Gilbraltar RoadHorsham, PA 19044 USChris Law, Industry ManagerPhone (215-443-5200)Fax (215-443-5206)[email protected] OUR AD ON PAGE 37
General Kinematics5050 Rickert Rd.Crystal Lake, IL 60014 USDick Reeves, Industry Director - Resource RecoveryPhone (815-455-3222)Fax (815-455-2285)[email protected]
Dryer - Rotary Drum
Uzelac Industries, Inc.6901 Industrial LoopGreendale, WI 53129 USMichael Uzelac, PresidentPhone (414-529-0240)[email protected]
www.uzelacind.com
Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575)Fax (660-263-2526)[email protected] OUR AD ON PAGE 32
Material Handling & Storage Dryer - Rotary Drum
Material Handling & Storage
Astec, Inc.4101 Jerome AvenueChattanooga, TN 37407 USMalcolm Swanson, PresidentPhone (423-867-4210)Fax (423-867-4636)[email protected] OUR AD ON PAGE 72
Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810)Fax (412-788-9822)[email protected]
The Dupps Company548 North Cherry Street Germantown, OH 45327 USRichard Weeks, SalesPhone (937-855-6555)[email protected]
Elevator-Bolts
4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa
Elevator-Buckets
4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa
TAPCO Inc.225 Rock Industrial Park DriveSt. Louis, MO 63044 USYassine Abbad, International Sales ManagerPhone (314-739-9191)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040)Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
Loading-Equipment
Astec Bulk Handling Solutions86470 Franklin BoulevardEugene, OR 97405 USConor Brogan, Technical Sales ManagerPhone (800-314-4656)[email protected]
BOOTH 1131
2016 Biomass Industry Directory | 37
DYNATEK Loading Systems200 North Harrison StNorth Prairie, WI 53153 USGary Kuehneman, Director of Marketing & SalesPhone (262-392-2162) | Fax (262-392-2984)[email protected]
SAMSON Materials Handling Ltd.Gemini House, Cambridgeshire Business Park1 Bartholomew’s WalkEly, Cambridgeshire, CB74EA ENGLANDMalcolm Youll, Managing DirectorPhone (441353665001) | Fax (441353666734)[email protected]
Railcar-Moving
Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810) | Fax (412-788-9822)[email protected]
Railcar-Parts
Greenfield Products2979 167th St.Hazel Crest, IL 60429 USBill Healy, SalesPhone (708-336-3254)[email protected]://www.greenfieldpi.com/
Scale-Bulk Weigh
CompuWeigh Corporation50 Middle Quarter Rd.Woodbury, CT 06798 USTim Ciucci, V.P. of Sales & MarketingPhone (906-235-5221) | Fax (203-262-9400)[email protected]
Scale-Software
ALDATA Software203, 211 Pembina Ave.Hinton, AB T7V 2B3 CANANDAMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)[email protected]
Screens-Disc
Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Your Partner in Productivity
Material Handling & Storage Loading-Equipment
Material Handling & Storage
38 | 2016 Biomass Industry Directory
Material Handling & Storage Screens-Disc Scalping
Material Handling & Storage
Screens-Disc Scalping
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Screens-Fines
EBM Manufacturing1014 Sherwood RdNorfolk, NE 68701 USTiffany Palmer, Director of Sales & MarketingPhone (877-370-4948) | Fax (402-371-9117)[email protected] OUR AD ON PAGE 41
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Screens-Other
ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22
Komptech Americas10855 Dover Street, Suite 1000Westminster, CO 80021 USBrandon Lapsys, VP of Sales & OperationsPhone (303-669-5637)[email protected]
Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Screens-Trommel
Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Specialty Parts and Equipment
BEDESCHI AMERICA INC3275 W. Hillsboro BlvdSuite 312Deerfield Beach, FL 33442 USTom Turano, V.P.Phone (954-602-2175) | Fax (954-602-5390)[email protected]
Price LogPro, LLC 400 Aviation Plaza, Suite BHot Springs, AR 71913 USJosh Krauss, Vice President of SalesPhone (800-826-7803) | Fax (501-844-4474)[email protected]
2016 Biomass Industry Directory | 39
Material Handling & Storage Stockyard Equipment
Stockyard Equipment
Astec Bulk Handling Solutions86470 Franklin BoulevardEugene, OR 97405 USConor Brogan, Technical Sales ManagerPhone (800-314-4656)[email protected]
FMW Industrieanlagen GmbH3207 Lake Forest Dr.Augusta, GA 30909 USWalter Lampp, North American ManagerPhone (706-829-3337) | Fax (706-733-4115)[email protected]
SCHADE Lagertechnik GmbHBruchstrasse 1Gelsenkirchen, North Rhine-Westphaua 45883 GERMANYKarl-Heinz Fiegenbaum, Managing DirectorPhone (4920950316122)Fax (4920950316188)[email protected]
Storage - Bins
Javo International1900 Cobb International BlvdSuites G & HKennesaw, GA 30152 USJay Honeycutt, North American Account ManagerPhone (770-428-4491) | Fax (770-424-6635)[email protected]
Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 36
AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]
Material Handling & Storage
2016 Biomass Industry Directory | 41
Material Handling & Storage
Material Handling & Storage Screens-Bins
Chief Industries Agri/Industrial4400 East 39th StreetKearney, NE 68848 USLiz McGowan, Marketing AssistantPhone (308-238-2781)[email protected]
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Sukup Manufacturing Co.PO Box 6771555 255th St.Sheffield, IA 50475-0677 USJohn Hanig, Bin Sales DirectorPhone (641-892-4222) | Fax (641-892-4629)[email protected]
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Storage - Other
Javo International1900 Cobb International BlvdSuites G & HKennesaw, GA 30152 USJay Honeycutt, North American Account ManagerPhone (770-428-4491) | Fax (770-424-6635)[email protected]
Warren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Storage - Silos
Dome Technology 4946 North 2900 EastIdaho Falls, ID 83401 USLane Roberts, Business Development ManagerPhone (208-227-1485)[email protected]
DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
Sukup Manufacturing Co.PO Box 6771555 255th St.Sheffield, IA 50475-0677 USJohn Hanig, Bin Sales DirectorPhone (641-892-4222) | Fax (641-892-4629)[email protected]
Storage – Silo Reclaimer
Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35
Continental Conveyor Ltd.470, St. Alphonse Street SouthPO Box 729Thetford Mines, QC G6G 3V8 CANADABrian Lynn, Vice PresidentPhone (418-338-4682) | Fax (418-338-4751)[email protected]
Jeffrey Rader, a brand of TerraSource Global215 Parkway East, Suite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
42 | 2016 Biomass Industry Directory
Material Handling & Storage Trailer - Moving Floor
Material Handling & Storage
Trailer - Moving Floor
Hallco Industries Inc.PO Box 505Tillamook, OR 97141 USRicardo Aguinaga, VP of Sales and MarketingPhone (503-842-8746)[email protected]
Transportation - Rail
AIRMATIC INC284 Three Tun RdMalvern, PA 19355-3981 USTerry Dougherty, Customer Support SpecialistPhone (800-332-9770) | Fax (215-331-9770)[email protected]
Truck Receiving/Dumpers
Airoflex Equipment6001 49th St. SouthMuscatine, IA 52761 USAndy Christy, SalesPhone (563-264-8066) | Fax (651-631-2539)[email protected]
Astec Bulk Handling Solutions86470 Franklin BoulevardEugene, OR 97405 USConor Brogan, Technical Sales ManagerPhone (800-314-4656)[email protected]
Columbia Industries, LLC5775 NW Wagon WayHillsboro, OR 97124 USJoe Canova, VP Sales & MarketingPhone (503-531-0600) | Fax (503-531-0601)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
Vibration Equipment
Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]
Biodiesel Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385)Fax (701-746-5367)[email protected]
Biomass Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203 US Customer ServicePhone (866-746-8385)Fax (701-746-5367)[email protected]
Ethanol Producer Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385)Fax (701-746-5367)[email protected]
Pellet Mill Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385)Fax (701-746-5367)[email protected]/pellet-mill-magazine
Media - Publications
Process Equipment & Services Air Pollution Control
Process Equipment & Services
Air Pollution Control
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]
Atlantic Combustion Technologies2 Tupper BlvdAmherst, NS B4H 4J5 CANADADavid Digdon, VP Global Business DevelopmentPhone (902-667-2808)[email protected] OUR AD ON PAGE 3
Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]
Babcock Power Environmental5 Neponset StreetWorcester, MA 01615 USJennifer Pasquariello, Director Marketing & Communications Phone (864-949-2917)[email protected]/products/environmental/babcock-power-environmentalSEE OUR AD ON PAGE 7
Dustex LLC100 Chastain Center Blvd. NW, Suite 195Kennesaw, GA 30144 USDarlene Huggins, VP, Business DevelopmentPhone (770-429-5575) | Fax (770-429-5556)[email protected]
Ecospray Technologies S.r.l.5 Thawmont DriveSewickley, PA 15143 USJo Ann Pacinelli, Senior Partner & Business Development ManagerPhone (412-427-0133) | Fax (412-741-8386)[email protected]
McGill AirClean LLC1777 Refugee RoadColumbus, OH 43207 USJerry Childress, National Sales ManagerPhone (614-829-1350) | Fax (614-445-8759)[email protected]
Monitor Tech Corporation661 N. James Rd.Columbus, OH 43219 USRobert Mullowney, CEOPhone (614-231-0500) | Fax (614-231-0555)[email protected] OUR AD ON PAGE 49
Tenmat LimitedAshburton Road WestTrafford ParkManchester, M17 1RU ENGLANDJoshua Cullen, Technical Sales EngineerPhone (00441619552425)Fax (00441618727596)[email protected]
Biogas-Capture
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094)Fax (201-529-0252)[email protected]
Loci Controls, Inc.28 Dane StreetSomerville, MA 02143 USShaun Bamforth, Director of Business DevelopmentPhone (954-325-0210)[email protected]
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]
44 | 2016 Biomass Industry Directory
Process Equipment & ServicesBiogas-Purification
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094)Fax (201-529-0252)[email protected]
Greenlane Biogas208 - 4288 Lozells AvenueBurnaby, BC V5A 0C7 CANADARicardo Hamdan, Business DevelopmentPhone (778-788-0774)[email protected]
Biogas-Storage
JDV Equipment Corporation1 Princeton AveDover, NJ 07801 USSean King, VPPhone (973-366-6556)Fax (973-366-3193)[email protected] OUR AD ON PAGE 52
RIX Industries4900 Industrial WayBenicia, CA 94510 USDave Savidge, Director of Industrial and Commercial CompressorsPhone (707-745-7112)[email protected] OUR AD ON PAGE 43
Boilers - Control Agents
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2
Boilers - Direct Fired
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
Process Equipment & Services Biogas-Purification
2016 Biomass Industry Directory | 45
Process Equipment & Services
Process Equipment & Services Biogas-Purification
Process Equipment & ServicesAFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286)Fax (717-763-1066)[email protected]
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629)Fax (218-253-4409)[email protected] OUR AD ON PAGE 40
Boilers - Firetube
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Webco Industries9101 W 21st StreetSand Springs, OK 74063 USJene Harmon, Marketing DIrectorPhone (918-245-2211)Fax (918-246-7053)[email protected]
Boilers - Fluidized Bed
Valmet, Inc.3440 Toringdon WaySuite 300Charlotte, NC 28277 USKerry Flick, Director, TechnologyPhone (704-541-1453)[email protected]
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Outotec Energy Products3568 W Industrial LoopCoeur d’Alene, ID 83815 USKent Pope, Director of Business DevelopmentPhone (208-765-1611) | Fax (208-765-0503)[email protected]
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
Boilers - Hot Water
AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 40
Boilers - Parts & Service
Boiler Tube Company of America506 Charlotte HighwayLyman, SC 29365 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/boiler-tube-co-of-america SEE OUR AD ON PAGE 7
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Riley Power Inc.5 Neponset StreetWorcester, MA 01615-0040 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/riley-power-incSEE OUR AD ON PAGE 7
Boilers - Solid Fuel
GARN Wood Heating3425 33rd Ave. NEMinneapolis, MN 55418 USMartin Lunde, PE, PresidentPhone (612-326-1100)[email protected]
Process Equipment & Services Boilers - Direct Fired
46 | 2016 Biomass Industry Directory
FLAMEX® systems can be customized to address the
fire hazards inherent in your process:Spark Detection & Suppression to eliminate sparks emanatingfrom rotary dryers andhammermills.
Automatic Deluge Systems fordust collectors, bins and silos.
“Hot Particle” Detectors to detect overheated pelletsfrom pelletizers and coolers.
High Speed Abort Gatesand Backdraft Dampers for material handling andclean air ducting.
Let us help you lower risks, increase productivity and comply with regulations.
Process Equipment & Services Boilers - Solid Fuel
Process Equipment & Services
Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23
ACT Bioenergy30 Commerce Park DriveSchenectady, NY 12305 USLarry Farrelly, PresidentPhone (518-344-7490)[email protected]
AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]
AgFuel Energy Systems90 Route 171P.O. Box 875Woodstock, CT 06281 USAmanda Simoneau, Director of Marketing and Business DevelopmentPhone (860-928-0703)[email protected]
AHONA - Alternative Heating of North America1614 County Highway 16Burlington Flats, NY 13315 USNathan Schoellig, DirectorPhone (607-643-6122)[email protected]
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629)Fax (218-253-4409)[email protected] OUR AD ON PAGE 40
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
SmokeLess Heat LLC2020 Cornwall RdLebanon, PA 17042 USDean Zook, OwnerPhone (717-389-0083) Fax (717-273-2248)[email protected]
2016 Biomass Industry Directory | 47
Process Equipment & Services Boilers - Steam
Process Equipment & Services
Boilers - Steam
Babcock Power Services5 Neponset StWorcester, MA 01615-0040 USJennifer Pasquariello, Director Marketng & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/babcock-power-services-incSEE OUR AD ON PAGE 7
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (2293463545)[email protected] OUR AD ON PAGE 2
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Wellons2525 W Firestone LaneVancouver, WA 98660 USSalesPhone (360-750-3500)Fax (360-750-3400)[email protected]
Boilers - Waste Heat Recovery
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (2293463545)[email protected] OUR AD ON PAGE 2
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
RCBC Global Inc.15 Pine Dr.Mills River, NC 28759 USDoug King, Marketing DirectorPhone (828-696-2111)Fax (828-696-2191)[email protected]
Cargo Inspection and Sampling
Control Union (U.S.A.), Inc.115 James Drive WestSuite 150Saint Rose, LA 70087 USDaniel O’Rourke, PresidentPhone (504-468-5485)[email protected]
48 | 2016 Biomass Industry Directory
Process Equipment & Services Centrifuges
Centrifuges
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]
CIP
Pick Heaters, Inc.730 S. Indiana Ave.PO Box 516West Bend, WI 53095 USSales Dept.Phone (262-338-1191)Fax (262-338-8489)[email protected]
Cleaning
Atlantic Combustion Technologies2 Tupper BlvdAmherst, NS B4H 4J5 CANADADavid Digdon, VP Global Business DevelopmentPhone (902-667-2808)[email protected] OUR AD ON PAGE 3
Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]
Combustion Equipment
Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53
Detroit Stoker Company1510 East First StreetMonroe, MI 48161 USTim Loviska, Director - Contract SalesPhone (734-241-9500)Fax (734-241-7126)[email protected] OUR AD ON PAGE 44
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
Round for a Reason LLC11698 395th AveColumbia, SD 57433 USAndrew Murray, MemberPhone (605-396-2431)[email protected]
Compressed Air Systems
RIX Industries4900 Industrial WayBenicia, CA 94510 USDave Savidge, Director of Industrial and Commercial CompressorsPhone (707-745-7112)[email protected] OUR AD ON PAGE 43
Condensors
Thermal Engineering Int’l (USA)10375 Slusher DriveSanta Fe Springs, CA 90670 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineering SEE OUR AD ON PAGE 7
Control Systems
Sigma Thermal, Inc4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53
4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa
Process Equipment & Services
2016 Biomass Industry Directory | 49
Process Equipment & Services Control Systems
Process Equipment & Services
Biomass Controls, LLC99 Canal StreetPO Box109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-928-0712)[email protected]
NDC Technologies8001 Technology BlvdDayton, OH 45424 USJay Luis, Marketing Communications ManagerPhone (937-233-9935)[email protected] OUR AD ON PAGE 48
VIC-Vecoplan Integrated Controls5708 Uwharrie RoadArchdale, NC 27263 USTodd Carswell, VP of Technical ServicesPhone (336-861-6070)[email protected] OUR AD ON PAGE 16
Control Systems - Distributed
Valmet 2750 Morris RoadLansdale, PA 19446 USDarryl Haag, Director, Energy SolutionsPhone (267-421-9770)[email protected]/industries-we-serve/energy/
Distillation & Dehydration Systems
Vogelbusch USA, Inc.1810 Snake River RoadKaty, TX 77449-7747 USDan Mahon, Vice PresidentPhone (713-461-7374)[email protected]
Dust Control - Baghouses
AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]
Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]
BWF Envirotec, USA1800 Worldwide BlvdHebron, KY 41048 USLarry Brown, Sales ManagerPhone (859-282-4550) | Fax (859-282-4555)[email protected]
Scientific Dust Collectors4101 W. 126th StreetAlsip, IL 60007 USAndrew Rutherford, Sales ManagerPhone (708-597-7090) | Fax (708-597-0313)[email protected]
Western Pneumatics, Inc.PO Box 21340Eugene, OR 97402 USBruce Livesay, Vice PresidentPhone (541-461-2600) | Fax (541-461-2606)[email protected]
Dust Control - Inertial Separators
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Dust Control - Unit Collectors
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Latta Equipment Co330 E. Hebron St.Charlotte, NC 28273 USMike Brown, OwnerPhone (704-752-7944)[email protected] http://www.lattaequipment.com/
ProcessBarron2770 Welborn StreetPelham, AL 35124 USPhillip Gore, Product ManagerPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
Dust Control - Wet Scrubbers
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
50 | 2016 Biomass Industry Directory
Process Equipment & Services Energy Management
Process Equipment & Services
Energy Management
Hydroflex Systems, IncPO Box 296Hummelstown, PA 17043 USCathleen Kaiser, Co-OwnerPhone (717-480-4200)[email protected]
Active Energy Coalswitch LimitedMwalden Business ParkBath House RoadCardigan, Ceredigion, SA43 1JY UKChas Fritz, CEOPhone (2398516304)[email protected]
Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]
Environmental Testing
Monitor Tech Corporation661 N. James Rd.Columbus, OH 43219 USRobert Mullowney, CEOPhone (614-231-0500) | Fax (614-231-0555)[email protected] OUR AD ON PAGE 49
Fans
AirPro Fan & Blower Co.PO Box 543Rhinelander, WI 54501 USKeith White, Sales EngineerPhone (715-365-3267)[email protected]
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
ProcessBarron2770 Welborn StreetPelham, AL 35124 USAllen Ray, Director of Air HandlingPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
Filters
CLARCOR Industrial Air11501 Outlook Street, Suite 100Overland Park, KS 66210 USTim Stark, Director Aftermarket SalesPhone (816-313-4955)[email protected]
Fire Protection
FLAMEX, Inc.4365 Federal DriveGreensboro, NC 27410 USAllen Wagoner, PresidentPhone (336-299-2933) | Fax (336-299-2944)[email protected]/SEE OUR AD ON PAGE 46
GreCon Spark Detection15875 SW 74th Ave.Tigard, OR 97224 USTerry Franklin, Technical Sales DirectorPhone (503-641-7731) | Fax (503-641-7508)[email protected]/spark-detection/SEE OUR AD ON PAGE 47
Firefly ABTextilgatan 31Stockholm, 12030 SWEDENMikael Jidenius, Area Sales ManagerPhone (4684492500) | Fax (4684492501)[email protected]
2016 Biomass Industry Directory | 51
Geltech Solutions1460 Park Lane South, Suite 1Jupiter, FL 33458 USMatt Struzziero, Director of Sales & Strategic OperationsPhone (800-924-4874) | Fax (561-427-6182)[email protected] OUR AD ON PAGE 50
Industrial Fire Prevention LLCPO Box 2046118 E. Hancock St.Milledgeville, GA 31059 USJeffrey Nichols, PresidentPhone (770-266-7223) | Fax (770-266-7223)info@industrialfireprevention.comwww.IndustrialFirePrevention.com
Furnaces
Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53
AgFuel NorthEast, LLC99 Canal StreetPO Box 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-928-0703)[email protected]
Energy Unlimited Inc.P.O. Box 74855 Highway YZDodgeville, WI 53533 USDave Lundell, ForemanPhone (608-935-9119) | Fax (608-935-0008)[email protected]
Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 40
Tulikivi U.S.Inc.172 South Pantops Dr, Suite BCharlottesville, VA 22911 USPäivi Saarelainen, Sales and Marketing ManagerPhone (800-843-3473)[email protected]
Generator-Diesel / Biodiesel
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
National Electric Coil800 King AvenueColumbus, OH 43212 USSteve Jeney, VP Marketing/SalesPhone (614-488-1151) | Fax (614-488-8892)sendinfo@national-electric-coil.comwww.national-electric-coil.com
Generator-Natural Gas / Biogas
National Electric Coil800 King AvenueColumbus, OH 43212 USSteve Jeney, VP Marketing/SalesPhone (614-488-1151) | Fax (614-488-8892)sendinfo@national-electric-coil.comwww.national-electric-coil.com
Process Equipment & Services
Process Equipment & Services Fire Protection
52 | 2016 Biomass Industry Directory
Process Equipment & Services Generator-Steam Turbine
Process Equipment & Services
Generator-Steam Turbine
Elliott Group901 North Fourth StreetJeannette, PA 15644 USTom Brown, Communications ManagerPhone (724-527-2811)[email protected]
National Electric Coil800 King AvenueColumbus, OH 43212 USSteve Jeney, VP Marketing/SalesPhone (614-488-1151) | Fax (614-488-8892)sendinfo@national-electric-coil.comwww.national-electric-coil.com
Vogt Power International13551 Triton Park BoulevardSuite 2000Louisville, KY 40223 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-recovery-systems/vogt-power-internationalSEE OUR AD ON PAGE 7
Heat Exchangers-Direct Contact
Hydroflex Systems, Inc.PO Box 296Hummelstown, PA 17043 USCathleen Kaiser, Co-OwnerPhone (717-480-4200)[email protected]
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Pick Heaters, Inc.730 S. Indiana Ave.PO Box 516West Bend, WI 53095 USSales Dept.Phone (262-338-1191) | Fax (262-338-8489)[email protected]
Heat Exchangers-Phase-Change
AMSEnergy Corp.1111 Bear Creek PikeColumbia, TN 38401 USMichael Sams, President & CEOPhone (615-852-8412)[email protected]
Heat Exchangers-Shell & Tube
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Thermal Engineering Int’l (USA)10375 Slusher DriveSanta Fe Springs, CA 90670 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 7
2016 Biomass Industry Directory | 53
Process Equipment & Services
Process Equipment & Services Heat Exchangers-Waste Heat Recovery Unit
Heat Exchangers-Waste Heat Recovery Unit
Sigma Thermal, Inc4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Hoppers
DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
Instrumentation
Aplus Finetek Sensor, Inc.1741 Industrial Drive, Unit #3Sterling, IL 61081 USJoe Lewis, SalesPhone (815-632-3132) | Fax (815-716-8464)[email protected]
Control Instruments Corp.25 Law DriveFairfield, NJ 07004 USBob Nutting, National Sales ManagerPhone (973-575-9114) | Fax (973-575-0013)[email protected]
Monitor Tech Corporation661 N. James Rd.Columbus, OH 43219 USRobert Mullowney, CEOPhone (614-231-0500) | Fax (614-231-0555)[email protected] OUR AD ON PAGE 49
Laboratory Equipment
Applied Rigaku Technologies, Inc.9825 Spectrum DriveAustin, TX 78717 USRobert Bartek, PresidentPhone (512-225-1796) | Fax (512-633-1797)[email protected]
HEMCO Corporation711 South Powell RoadIndependence, MO 64056 USJerry Schwarz, Marketing / AdvertisingPhone (800-779-4362)Fax (816-796-3333)[email protected]
• Biomass HydrdrauaulicSystem
• Air-cooled Fuel Feeders
• Air-cooled Thermal Fluid Heat Dumps
Consider retrofi�ing your existing system with modifications or equipment upgr ades to increase your process efficiency and to take advantage of improved energy savings.
• Fuel Storage and Reclaim
• Fuel Feed Conveying Equipment
• Fuel Feeders and Metering Bins
• Thermal Oil Radiant Heaters
• Thermal Oil Convection Heaters
• Ash Conveyors
• Grate Bars
• Multi-Clones
• Fans
• Dampers
• Expansion Joints
• Thermal Fluid Heat Dumps
• Thermal Fluid Pumps
• Controls and Control Devices
• Electrical/ Functional Safety Engin.
• Combustion Control Systems
• Basic Process Control Systems (BPCS)
• Safety Instrumented Systems
• Field Support-Programming and Training
Process Equipment & Services Labratory Equipment
Process Equipment & ServicesIndustrial Sonomechanics, LLC479 W 146th St., Ground FloorNew York, NY 10031 USIva Gyurgina, Customer Relations and Marketing ManagerPhone (646-580-4676)[email protected]://sonomechanics.com/
Team Biogas23551 Rose Quartz DrPerris, CA 92570-7440 USMark Hintz, Sales ConsultantPhone (425-422-5970)Fax (866-593-3679)[email protected]
Laboratory Services
Biomass Energy Lab1641 Sigman RoadConyers, GA 30012 USTammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]
Timber Products Inspection1641 Sigman RoadConyers, GA 30012 USTammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]
Celignis LimitedT1-014 Tierney Building, University of LimerickLimerick, L111 IRELANDDaniel Hayes, DrPhone (353894555582)[email protected]
ClearStak, LLC99 Canal StreetPO Box 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-237-8245)[email protected]
R W HEIDEN ASSOCIATES LLC1026 New Holland AvenuePO Box 5001Lancaster, PA 17601 USRichard Heiden, Chief Science and Technology OfficerPhone (717-299-6860)Fax (717-299-6868)[email protected]
Lubricants
Ayalytical Instruments2701 W. Fulton St., #5SChicago, IL 60612 USJuan Ayala, Managing DirectorPhone (312-476-9292)[email protected]
Schaeffer’s Specialized Lubricants102 Barton StreetSt. Louis, MO 63104 USSteve Rober, National Sales ManagerPhone (314-865-4100)Fax (314-865-4107)[email protected]
Maintenance Services
Sigma Thermal, Inc.4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 36
TGR Industrial Services1127 S Lewis AveTulsa, OK 74104 USGary Mathis, Advanced NDT ManagerPhone (918-629-2735)Fax (918-584-5598)[email protected]
Marine Surveying
Control Union (U.S.A.), Inc.115 James Drive WestSuite 150Saint Rose, LA 70087 USDaniel O’Rourke, PresidentPhone (504-468-5485)[email protected]
2016 Biomass Industry Directory | 55
Mixers/Agitators
DustMASTER Enviro Systems190 Simmons Ave.Pewaukee, WI 53012 USScott Adams, Product ManagerPhone (262-691-3100)Fax (262-691-3184)[email protected] OUR AD ON PAGE 58
SUMA America855 North Wood Dale RoadSuite AWood Dale, IL 60191 USEugene Smith, Sales Application EngineerPhone (847-427-7880)Fax (630-354-6840)[email protected]
Moisture Analyzers
GreCon Moisture Meters15875 SW 74th AveTigard, OR 97224 USMarshall LLoyd, SalesPhone (503-641-7731)Fax (503-641-7508)[email protected]://www.grecon-us.com/measurement/infrared-moisture-meter/SEE OUR AD ON PAGE 47
Operations & Maintenance (O&M)
Morrow Renewables, LLCPO Box 61447Midland, TX 79711 USLuke Morrow, PresidentPhone (432-563-0447)[email protected]
Atlantic Combustion Technologies2 Tupper BlvdAmherst, NS B4H 4J5 CANADADavid Digdon, VP Global Business DevelopmentPhone (902-667-2808)[email protected] OUR AD ON PAGE 3
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
REBL Refractories Evaluations Laboratory, ULC#109, 8484 162nd StreetSurrey, BC V4N 1B4 CANADABryce Jardine, Regional ManagerPhone (778-578-7551) | Fax (778-578-7571)[email protected]
Pipe
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Pipe-Fittings
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Proco Products, Inc.2431 N. Wigwam DriveStockton, CA 95205 USRob Coffee, VP Sales & MarketingPhone (209-943-6088) | Fax (209-943-0242)[email protected]
Pipe-Flanges
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Process Equipment & Services Mixers/Agitators
Process Equipment & Services
• Process & Plant Feasibility Studies• Foundation & Structural Design• Plant Layout & Equipment Specifications• Site Supervision & Start-up Equipment Procurement & Installation
Biomass and Wood Pellet Plant Specialist
Rainsville, Alabama866-354-PASS (72277)[email protected]
No matter what you’re processing – chemicals, food, pharmaceuticals, biomass, wood products – if it produces dusts or powders, there’s a high probability you have an explosion risk. All it takes to interrupt your plant productivity is a combustible material, oxygen and an ignition source. For more than six decades, IEP Technologies has provided the right explosion protection solution for every type of process application. From cyclone separators and dust collectors to milling equipment and dryers. We can analyze your challenge, design a protection system and surround you with 24/7 service and support. Protecting your plant starts with knowing your explosion risk.
Let’s develop a solution for you
Call the IEP engineering experts with the most experience in explosion protection at 1-855-793-8407 or visit IEPTechnologies.com.
P R O T E C T I N G T H E W O R L D ’ S P R O C E S S E S A G A I N S T E X P L O S I O N
Process Equipment & Services Safety
Process Equipment & Services
Safety
IEP Technologies417-1 South StreetMarlborough, MA 01752 USJohn Shea, Vice President - Marketing & Business DevelopmentPhone (855-793-8407) | Fax (508-485-3115)[email protected] OUR AD ON PAGE 56-57
Seals
Towertech Cooling System Pvt.Ltd103-B, Synergy Tower, Near Vodafone House,Corporate RoadPrahlad Nagar, Ahmedabad, Gujarat 380015 ISPhone (917940397842)[email protected]://www.towertechglobal.com/
Sensors
4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa
Aplus Finetek Sensor, Inc.1741 Industrial Drive, Unit #3Sterling, IL 61081 USJoe Lewis, SalesPhone (815-632-3132) | Fax (815-716-8464)[email protected]
Monitor Technologies LCC44W320 Keslinger RoadElburn, IL 60119 USGreg DeRudder, Director of SalesPhone (630-365-9403)[email protected]
optek-Danulat, Inc.N118W18748 Bunsen DrGermantown, WI 53022 USJoe Ferrelli, Product SpecialistPhone (888-901-4288)[email protected]
Separators
Ecohog LtdQuarry RoadCarrickmore, Omagh BT79 9JX UKColleen McDermott, MrsPhone (02880761295)[email protected]
Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]
No matter what you’re processing – chemicals, food, pharmaceuticals, biomass, wood products – if it produces dusts or powders, there’s a high probability you have an explosion risk. All it takes to interrupt your plant productivity is a combustible material, oxygen and an ignition source. For more than six decades, IEP Technologies has provided the right explosion protection solution for every type of process application. From cyclone separators and dust collectors to milling equipment and dryers. We can analyze your challenge, design a protection system and surround you with 24/7 service and support. Protecting your plant starts with knowing your explosion risk.
Let’s develop a solution for you
Call the IEP engineering experts with the most experience in explosion protection at 1-855-793-8407 or visit IEPTechnologies.com.
P R O T E C T I N G T H E W O R L D ’ S P R O C E S S E S A G A I N S T E X P L O S I O N
Separators-Magnetic
Ecohog LtdQuarry RoadCarrickmore, Omagh BT79 9JX UKColleen McDermott, MrsPhone (02880761295)[email protected]
ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22
Master Magnetics747 S. Gilbert St.Castle Rock, CO 80104 USJim Madsen, Sales ManagerPhone (888-293-9399)[email protected]
Tank Equipment
Hydroflex Systems, Inc.PO Box 296Hummelstown, PA 17043 USCathleen Kaiser, Co-OwnerPhone (717-480-4200)[email protected]
VOC Scrubbers
Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Wastewater Treatment
ADI Systems Inc.370 Wilsey RoadFredericton, NB E3B 6E9 CANADAShannon Grant, PresidentPhone (1-506-452-7307)[email protected]
Babcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]
Process Equipment & Services Separators-Magnetic
Process Equipment & Services
Project Development & Finance Business Plans
Business Plans
BBI International Project Development308 Second Avenue North, Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385) | Fax (701-746-5367)[email protected]
Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23
Debt FinancingCHP VenturesKemp House152 Old City RdLondon. England, EC1V 2NX UKRoger Willmott, DirectorPhone (442081339554)[email protected]
SLS Financial Services200 S, O’Connell StreetSuite 400Marshall, MN 56258 USKennedy Gilbertson, National Account ManagerPhone (605-444-1106) | Fax (605-271-7133)[email protected]
Syntek Resource Corporation2143 18th Avenue CourtGreeley, CO 80631 USSandra Robnett, Chm/CEOPhone (970-356-9004) | Fax (970-356-9004)[email protected]
Due Diligence
BBI International Project Development308 Second Avenue North, Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385) | Fax (701-746-5367)[email protected]
Arc5 Environmental Consulting LLC20 Rockwood LnGroton, MA 01450 USDavid Minott, PresidentPhone (978-877-7719)[email protected]
Luminate, LLC1801 BroadwaySuite 1620Denver, CO 80202 USMichael Robinson, President & CEOPhone (303-860-7627) | Fax (303-860-7647)[email protected]
PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]
Project Development & Finance
2016 Biomass Industry Directory | 59
Project Development & Finance
Project Development & Finance Due Diligence
Feasibility Studies
BBI International Project Development308 Second Avenue North, Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385) | Fax (701-746-5367)[email protected]
EcoEngineers300 East Locust Street, Suite 313Des Moines, IA 50309 USKathy MacBeth, Director of Sales & MarketingPhone (515-309-1279)[email protected] OUR AD ON PAGE 54
Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24
PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]
Process and Storage Solutions3446 County Road 90Rainsville, AL 35986 USDonald Land, Co-OwnerPhone (866-354-7277) | Fax (256-638-1839)[email protected] OUR AD ON PAGE 55
RSG - Resource Systems Group, Inc.55 Railroad RowWhite River Junction, VT 05001 USJohn Hinckley, DirectorPhone (802-295-4999)[email protected]
Insurance
HUB International New England, LLC formerly FieldEddy InsurancePO Box 70996 Shaker RdEast Longmeadow, MA 01028 USTeresa Petit de Mange, Vice PresidentPhone (413-233-2108) | Fax (413-733-3191)[email protected]
Marsh & McLennan Agency1001 Haxall Point, Suite 800Richmond, VA 23219 USGeorge Phillips, Sr. Vice presidentPhone (804-915-5630)[email protected]
Investors
New Canaan Capital Mgmt LLC. Post Office Box 94831344 Crayton Road Naples , FL 34101 USJeffrey Weisz , Managing Member Phone (239-919-8825) | Fax (917-957-9703)[email protected]
Mergers & Acquisitions
Maas Companies Inc.P. O. Box 7127Rochester, MN 55903-7127 USTyler Maas, Director of Sales & MarketingPhone (507-285-1444) | Fax (507-285-0034)[email protected]
Owner Representation
PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]
Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24
Permitting-Air
Arc5 Environmental Consulting LLC20 Rockwood LnGroton, MA 01450 USDavid Minott, PresidentPhone (978-877-7719)[email protected]
RSG - Resource Systems Group, Inc.55 Railroad RowWhite River Junction, VT 05001 USJohn Hinckley, DirectorPhone (802-295-4999)[email protected]
Permitting-Other
RSG - Resource Systems Group, Inc.55 Railroad RowWhite River Junction, VT 05001 USJohn Hinckley, DirectorPhone (802-295-4999)[email protected]
Risk Management
Wildephor Consulting Services, LLC481 N Santa Cruz Ave #280Los Gatos, CA 95030 USW. David Featherman, PE, PrincipalPhone (510-845-0016)[email protected]
Site Selection
BBI International Project Development308 Second Avenue North, Suite 304Grand Forks, ND 58203 USCustomer ServicePhone (866-746-8385) | Fax (701-746-5367)[email protected]
Software-Accounting
TRAXPayroll - Online Payroll Services740 Alfred Nobel DriveHercules, CA 94547 USSales/AdminPhone (866-611-5410) | Fax (510-964-9322)[email protected]
Technology Assessment
ENVINT Consulting2233 Ch St AntoineLaval, QC H7R6C7 CANADAMartin Tampier, MrPhone (450-627-1003)[email protected]
ICF International1725 Eye Street NWWashington, DC 20006 USStacy Noblet, Senior ManagerPhone (202-862-1147)[email protected]
Pure Dwelling LLCP.O. Box 863Sun Prairie, WI 53590 USGregory Brown, PrincipalPhone (608-630-0225)[email protected]
Research & Development Government
Make a world of difference with your career.
Earn a Master’s or Graduate Certi�cate in Renewable Energy, and gain the technical expertise and project development skills to drive clean energy initiatives. With our online bioenergy program, you can learn about:
crop production
ecology
engineering
fermentation
genetics
harvesting
value chain systems modeling
Learn more at worldcampus.psu.edu/biomass
Government
Kentucky Division of Biofuels500 Mero Street, 6th FloorFrankfort, KY 40601 USTim Hughes, DirectorPhone (5025647192) | Fax (502-564-7406)[email protected]/biofuels/Pages/default.aspx
Private
AgriKinetics LtdTrigate HouseHagley Road WestBirmingham, B68 0NP UKDavid Stone, DirectorPhone (441212225090)[email protected]://agrikinetics.com
American Science and Technology1367 W. Chicago Ave.Chicago, IL 60642 USAli Manesh, PresidentPhone (312-433-3800) | Fax (312-433-3807)[email protected]
Biomass Energy Enhancements597 N. 1250 W., Suite #4Centerville, UT 84014 USChas Fritz, CEOPhone (239-851-6304)[email protected]
Cellulose Pilot and Processing Lab6445 Packer Dr.Wausau, WI 54401 USEric Singsaas, DirectorPhone (715-340-2591)[email protected]
FPInnovations570 Saint-Jean BlvdPointe-Claire, QC H9R3J9 CANADAJennifer Ellson, Senior Communications SpecialistPhone (514 630-4100)[email protected]
Refined BioProducts1718 Pine StreetStevens Point, WI 54481 USJohn Leschke, New Business DevelopmentPhone (715-869-7866)[email protected]
University
Iowa State University BioCentury Research Farm1041 Food Sciences Bldg.Ames, IA 50011-1061 USKevin Keener, DirectorPhone (515-294-0160) | Fax (515-294-6261)[email protected]
Penn State Biomass Energy Center249 Ag Engineering BuildingUniversity Park, PA 16802 USTom Richard, DirectorPhone (814-863-0291) | Fax (814-863-1031)[email protected] OUR AD ON PAGE 60
Research & Development
2016 Biomass Industry Directory | 61
AD INDEX
2016 International Biomass Conference & Expo 14
Agra Industries 26
Andritz Feed & Biofuel A/S 22
ASGCO 39
Astec, Inc. 72
Atlantic Combustion/CoMate 3
Babcock Power 7
Basic Machinery Co., Inc. 35
BBI International Project Development 61
Biotech Energy 25
Columbia Specialty Company, Inc. 27
Continential Biomass Industries, Inc. 19
CPM Global Biomass Group 20
CPM Wolverine Proctor, LLC 37
D3 Max 71
Detroit Stoker Company 44
DustMASTER Enviro Systems 58
EBM Manufacturing 41
EcoEngineers 54
RUD Chain 31
Schaeffer Manufacturing Co. 51
Sigma Thermal, Inc. 53
TerraSource Global (Jeffrey Rader) 36
The Pennsylvania State University 60
Turboden S.r.l. 28
Vecoplan LLC 16
Vulcan Systems 32
West Salem Machinery Col 38
Wolf Material Handling Systems 29
WoodMaster 40
FLAMEX Inc. 46
Geltech Solutions 50
GreCon, Inc. 47
Hudco Industrial Products, Inc. 34
Hurst Boiler & Welding Co. Inc. 2
IEP Technologies 56-57
Indeck Power Equipment Co. 42
International Bioenergy Conference & Exhibition Society
33
JDV Equipment Corporation 52
Mid-South Engineering Company 24
MonitorTech Corporation 49
NDC Technologies Ltd 48
NSF International 17
Process and Storage Solutions 55
ProcessBarron 30
Rawlings Waste Wood Recovery Systems 18
Renewable Energy Consultations LLC 23
RIX Industries 43
62 | 2016 Biomass Industry Directory
Company Index
4B Components Ltd.625 Erie AvenueMorton, IL 61550 USJohnny Wheat, PresidentPhone (309-698-5611)[email protected]/usa
AABC Machinery (Anyang Best Complete Machinery Engi19F, Suite B, Global Trade Mansion, Wenfeng AvenueAnyang, Henan 455000 CHINATina Lee, General ManagerPhone (863725965148)[email protected]://www.pellet-machine.com/
ACT Bioenergy30 Commerce Park DriveSchenectady, NY 12305 USLarry Farrelly, PresidentPhone (518-344-7490)[email protected]
Active Energy Coalswitch LimitedMwalden Business ParkBath House RoadCardigan, Ceredigion, SA43 1JY UKChas Fritz, CEOPhone (2398516304)[email protected]
ADI Systems Inc.370 Wilsey RoadFredericton, NB E3B 6E9 CANADAShannon Grant, PresidentPhone (1-506-452-7307)[email protected]
Advanced Biofuels USA507 North Bentz StreetFrederick, MD 21701 USJoanne Ivancic, Executive DirectorPhone (301-644-1395)[email protected]
AFS Energy Systems420 Oak StreetPO Box 170Lemoyne, PA 17043 USJay Clark, Vice PresidentPhone (717-763-0286) | Fax (717-763-1066)[email protected]
AGCO Corporation4205 River Green ParkwayDuluth, GA 30096 USGlenn Farris, Segment Strategy Manager, Biomass/IndustrialsPhone (770-662-0256)[email protected]
AgFuel Energy Systems90 Route 171P.O. Box 875Woodstock, CT 06281 USAmanda Simoneau, Director of Marketing and Business DevelopmentPhone (860-928-0703)[email protected]
AgFuel NorthEast, LLC99 Canal StreetPO BOX 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-928-0703)[email protected]
AGRA Industries1211 West Water StreetMerrill, WI 54452 USPat Hinner, PresidentPhone (800-842-8033)[email protected] OUR AD ON PAGE 26
AgriKinetics LtdTrigate HouseHagley Road WestBirmingham, B68 0NP ENGLANDDavid Stone, DirectorPhone (441212225090)[email protected]://agrikinetics.com
AHONA - Alternative Heating of North America1614 County Highway 16Burlington Flats, NY 13315 USNathan Schoellig, DirectorPhone (607-643-6122)[email protected]
AIRMATIC INC.284 Three Tun RdMalvern, PA 19355-3981 USTerry Dougherty, Customer Support SpecialistPhone (800-332-9770) | Fax (215-331-9770)[email protected]
Airoflex Equipment6001 49th St. SouthMuscatine, IA 52761 USAndy Christy, SalesPhone (563-264-8066) | Fax (651-631-2539)[email protected]
AirPro Fan & Blower Co.PO Box 543Rhinelander, WI 54501 USKeith White, Sales EngineerPhone (715-365-3267)[email protected]
Alaska Structures9024 Vanguard Drive #101Anchorage, AK 99507 USAlaska Structures, InquiryPhone (907-344-1565)[email protected]://alaskastructures.com
Alberici Constructors, Inc.8800 Page Ave.Saint Louis, MO 63114 USVictoria Fleddermann, Director of Business DevelopmentPhone (314-733-2256)[email protected]
Alcohol Tax Consultants, Inc.P.O. Box 1595Madison Square StationNew York, NY 10159 USMatt Zuckerman, Phone (917-771-9906)[email protected]
ALDATA Software203, 211 Pembina Ave.Hinton, AB T7V 2B3 CANADAMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)[email protected]
American Science and Technology1367 W. Chicago Ave.Chicago, IL 60642 USAli Manesh, PresidentPhone (312-433-3800) | Fax (312-433-3807)[email protected]
AMSEnergy Corp.1111 Bear Creek PikeColumbia, TN 38401 USMichael Sams, President & CEOPhone (615-852-8412)[email protected]
ANDRITZ5405 Windward Parkway Suite 100WAlpharetta, GA 30004 USDave Evans, Area Sales ManagerPhone (770-640-2431)[email protected] OUR AD ON PAGE 22
ANDRITZ FEED AND BIOFUEL336 West PennMuncy, PA 17756 USMike Curci, Capital Sales Manager BiomassPhone (850-557-7674) | Fax (770-640-2521)[email protected]://www.andritz-sprout.com/SEE OUR AD ON PAGE 22
Aplus Finetek Sensor, Inc.1741 Industrial Drive, Unit #3Sterling, IL 61081 USJoe Lewis, SalesPhone (815-632-3132) | Fax (815-716-8464)[email protected]
Apollo Equipment2062 20th Ave. S.E.Largo, FL 33771 USWayne Brown, Executive Vice PresidentPhone (503-585-1442) | Fax (727-585-3499)[email protected]
Applied Rigaku Technologies, Inc.9825 Spectrum DriveAustin, TX 78717 USRobert Bartek, PresidentPhone (512-225-1796) | Fax (512-633-1797)[email protected]
APT Consulting Group Co., Ltd.3/1 Muang Thong Thani Bldg. C7Popular Road, BangpootPakgret, Nonthaburi, 11120 THAILANDJohn Diecker, Managing DirectorPhone (6624025235)[email protected]
Arc5 Environmental Consulting LLC20 Rockwood LnGroton, MA 01450 USDavid Minott, PresidentPhone (978-877-7719)[email protected]
ASGCO “Complete Conveyor Solutions”301 Gordon StreetAllentown, PA 18102 USAaron Gibbs, PresidentPhone (610-821-0216) | Fax (610-778-8991)[email protected] OUR AD ON PAGE 39
ASI Industrial1300 Minnesota AveBillings, MT 59101 USRobert Hamlin, PresidentPhone (406-245-6231) | Fax (406-245-6236)[email protected]
Astec Bulk Handling Solutions86470 Franklin BoulevardEugene, OR 97405 USConor Brogan, Technical Sales ManagerPhone (800-314-4656)[email protected]
Astec, Inc.4101 Jerome AvenueChattanooga, TN 37407 USMalcolm Swanson, PresidentPhone (423-867-4210) | Fax (423-867-4636)[email protected] OUR AD ON PAGE 72
Atlantic Combustion Technologies2 Tupper BlvdAmherst, NS B4H 4J5 CANADADavid Digdon, VP Global Business DevelopmentPhone (902-667-2808)[email protected] OUR AD ON PAGE 3
Ayalytical Instruments2701 W. Fulton St. #5SChicago, IL 60612 USJuan Ayala, Managing DirectorPhone (312-476-9292)[email protected]
BBabcock & Wilcox MEGTEC830 Prosper StreetDe Pere, WI 54115 USKathy Brugman, Sales & Marketing SpecialistPhone (920-337-1582)[email protected]
Babcock Power Environmental5 Neponset StreetWorcester, MA 01615 USJennifer Pasquariello, Director Marketing & Communications Phone (864-949-2917)[email protected]/products/environmental/babcock-power-environmentalSEE OUR AD ON PAGE 7
Babcock Power Services5 Neponset StWorcester, MA 01615-0040 USJennifer Pasquariello, Director Marketng & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/babcock-power-services-incSEE OUR AD ON PAGE 7
Basic Machinery Company1220 Harold Andrews RoadSiler City, NC 27344-0688 USEd ONeil, Director of Business DevelopmentPhone (919-200-3435)[email protected] OUR AD ON PAGE 35
A
2016 Biomass Industry Directory | 63
Company Index
BEDESCHI AMERICA INC3275 W. Hillsboro BlvdSuite 312Deerfield Beach, FL 33442 USTom Turano, V.P.Phone (954-602-2175) | Fax (954-602-5390)[email protected]
Biochar Now, LLC1907 Gail CtLoveland, CO 80537 USJames Gaspard, EVP Business DevelopmentPhone (970-622-8071)[email protected]
BIOFerm Energy Systems440 Science DriveSte 300Madison, WI 53711 USWhitney Beadle, Marketing CommunicationsPhone (608-229-6504)[email protected]
BIOGAS Equity 2, Inc.130 Eleanor Dr.Woodside, CA 94062 USMike Muller, COOPhone (650-283-9555)[email protected]
Biomass Controls, LLC99 Canal StreetPO BOX 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-928-0712)[email protected]
Biomass Energy Enhancements597 N. 1250 W., Suite #4Centerville, UT 84014 USChas Fritz, CEOPhone (239-851-6304)[email protected]
Biomass Energy Lab1641 Sigman RoadConyers, GA 30012 USTammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]
Biomass Engineering & Equipment1457 Sunday DriveIndianapolis, IN 46217 USTim Brown, Product SpecialistPhone (317-522-0864) | Fax (317-346-0811)[email protected]
Biomass Thermal Energy Council1211 Connecticut Ave NW#650Washington, DC 20036 USJoel Stronberg, Executive DirectorPhone (202-596-3974) | Fax (202-223-5537)[email protected]
Bionomic Industries777 Corporate DriveMahwah, NJ 07430 USLinda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Biotech Energy54 Echo Place Unit 1Williston, VT 05495 USBrad Noviski, Vice President EngineeringPhone (802-658-0956) | Fax (802-660-8904)[email protected] OUR AD ON PAGE 25
Bliss Industries, LLC1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601 USChad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]
Boiler Tube Company of America506 Charlotte HighwayLyman, SC 29365 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/boiler-tube-co-of-americaSEE OUR AD ON PAGE 7
BWF Envirotec, USA1800 Worldwide BlvdHebron, KY 41048 USLarry Brown, Sales ManagerPhone (859-282-4550) | Fax (859-282-4555)[email protected]
CCasey Industrial, Inc.1400 West 122nd Ave., Ste 200Westminster, CO 80234 USTom Lepak, Vice PresidentPhone (720-974-2659)[email protected]
CDW Consultant GroupP.O. Box 923Bloomington, TX 77951 USCharles White, Managing MemberPhone (361-237-9339) | Fax (210-800-9993)[email protected]
Celignis LimitedT1-014 Tierney Building, University of LimerickLimerick, L111 IRELANDDaniel HayesPhone (353894555582)[email protected]
Cellulose Pilot and Processing Lab6445 Packer Dr.Wausau, WI 54401 USEric Singsaas, DirectorPhone (715-340-2591)[email protected]
Chief Industries Agri/Industrial4400 East 39th StreetKearney, NE 68848 USLiz McGowan, Marketing AssistantPhone (308-238-2781)[email protected]
CHP VenturesKemp House152 Old City RdLondon. England, EC1V 2NX UKRoger Willmott, DirectorPhone (442081339554)[email protected]
CLARCOR Industrial Air11501 Outlook Street, Suite 100Overland Park, KS 66210 USTim Stark, Director Aftermarket SalesPhone (816-313-4955)[email protected]
ClearStak, LLC99 Canal StreetPO BOX 109Putnam, CT 06260 USMadilyn Smith, Corporate CounselPhone (860-237-8245)[email protected]
CNFbiofuel5038 Salida BlvdPO Box 1316Salida, CA 95368 USJohn Paoluccio, PresidentPhone (209-545-1663) | Fax (209-545-3533)[email protected]
CNFbiofuel.comColumbia Industries, LLC5775 NW Wagon WayHillsboro, OR 97124 USJoe Canova, VP Sales & MarketingPhone (503-531-0600) | Fax (503-531-0601)[email protected]
Columbia Specialty Co, Inc.5875 Obispo AveLong Beach, CA 90805 USGreg Stuck, Shop ManagerPhone (562-634-6425) | Fax (562-408-2914)[email protected] OUR AD ON PAGE 27
CompuWeigh Corporation50 Middle Quarter Rd.Woodbury, CT 06798 USTim Ciucci, V.P. of Sales & MarketingPhone (906-235-5221) | Fax (203-262-9400)[email protected]
Conn Maciel Carey5335 Wisconsin Avenue NWSuite 660Washington, DC 20015 USEric J. Conn, Chair, OSHA Practice GroupPhone (202-715-6244) | Fax (202-827-7903)[email protected]
Continental Biomass Industries (a Terex brand)22 Whittier St.Newton, NH 03858 USArt Murphy, Marketing ManagerPhone (603-382-0556)[email protected] OUR AD ON PAGE 19
Continental Conveyor Ltd.470, St. Alphonse Street SouthPO Box 729Thetford Mines, QC G6G 3V8 CANADABrian Lynn, Vice PresidentPhone (418-338-4682) | Fax (418-338-4751)[email protected]
Control Instruments Corp.25 Law DriveFairfield, NJ 07004 USBob Nutting, National Sales ManagerPhone (973-575-9114) | Fax (973-575-0013)[email protected]
Control Union (U.S.A.), Inc.115 James Drive WestSuite 150Saint Rose, LA 70087 USDaniel O’Rourke, PresidentPhone (504-468-5485)[email protected]
Control Union Certifications150 North University DriveSuite 210Plantation, FL 33324 USRobert Demianew, Regional DirectorPhone (954-900-2087)[email protected]://controlunion.com/en
CPM Global Biomass Group181 Davis Johnson Dr, Suite JRichland, MS 39218 USTim Gilbert, Sales ManagerPhone (601-932-9080) | Fax (601-932-9081)[email protected] OUR AD ON PAGE 20
CPM Wolverine Proctor, LLC251 Gilbraltar RoadHorsham, PA 19044 USChris Law, Industry ManagerPhone (215-443-5200) | Fax (215-443-5206)[email protected] OUR AD ON PAGE 37
Curran Renewable Energy, LLC20 Commerce DriveMassena, NY 13662 USKelli Curran, Marketing ManagerPhone (315-769-2000)[email protected]
DDavis Brown Law Firm215 10th Street, Suite 1300Des Moines, IA 50309 USBill Hanigan, AttorneyPhone (515-288-2500) | Fax (515-243-0654)[email protected]:/www.davisbrownlaw.com
Detroit Stoker Company1510 East First StreetMonroe, MI 48161 USTim Loviska, Director - Contract SalesPhone (734-241-9500) | Fax (734-241-7126)[email protected] OUR AD ON PAGE 44
DI PIÙ - Sunomi LLCP.O. Box 347Plainfield, VT 05667 USGiordano Checchi, PresidentPhone (802-454-9310)[email protected]
Dome Technology 4946 North 2900 EastIdaho Falls, ID 83401 USLane Roberts, Business Development ManagerPhone (208-227-1485)[email protected]
64 | 2016 Biomass Industry Directory
Company Index
Dustex LLC100 Chastain Center Blvd. NW, Suite 195Kennesaw, GA 30144 USDarlene Huggins, VP, Business DevelopmentPhone (770-429-5575) | Fax (770-429-5556)[email protected]
DustMASTER Enviro Systems190 Simmons Ave.Pewaukee, WI 53012 USScott Adams, Product ManagerPhone (262-691-3100) | Fax (262-691-3184)[email protected] OUR AD ON PAGE 58
DYNATEK Loading Systems200 North Harrison StNorth Prairie, WI 53153 USGary Kuehneman, Director of Marketing & SalesPhone (262-392-2162) | Fax (262-392-2984)[email protected]
EEBM Manufacturing1014 Sherwood RdNorfolk, NE 68701 USTiffany Palmer, Director of Sales & MarketingPhone (877-370-4948) | Fax (402-371-9117)[email protected] OUR AD ON PAGE 41
EcoEngineers300 East Locust Street, Suite 313Des Moines, IA 50309 USKathy MacBeth, Director of Sales & MarketingPhone (515-309-1279)[email protected] OUR AD ON PAGE 54
Ecohog LtdQuarry RoadCarrickmore, Omagh BT79 9JX IRELANDColleen McDermottPhone (02880761295)[email protected]
Ecospray Technologies S.r.l.5 Thawmont DriveSewickley, PA 15143 USJo Ann Pacinelli, Senior Partner & Business Development ManagerPhone (412-427-0133) | Fax (412-741-8386)[email protected]
Elliott Group901 North Fourth StreetJeannette, PA 15644 USTom Brown, Communications ManagerPhone (724-527-2811)[email protected]
Energy Unlimited Inc.P.O. Box 74855 Highway YZDodgeville, WI 53533 USDave Lundell, ForemanPhone (608-935-9119) | Fax (608-935-0008)[email protected]
Enginuity Worldwide651 E Commerce RoadMexico, MO 65255 USNancy Heimann, President, CEOPhone (573-567-4417)[email protected]
ENVINT Consulting2233 Ch St AntoineLaval, QB H7R 6C7 CANADAMartin Tampier, MrPhone (4506271003)[email protected]
Equinox LLC4255 43rd Ave SFargo, ND 58104 USKyle Althoff, PresidentPhone (303-910-6052)[email protected]
FFagen, Inc.501 W Hwy 212Granite Falls, MN 56241 USRick Cantor, VP - Business DevelopmentPhone (864-627-0060) | Fax (320-564-3324)[email protected]
Firefly ABTextilgatan 31Stockholm, 12030 SWEDENMikael Jidenius, Area Sales ManagerPhone (4684492500) | Fax (4684492501)[email protected]
First Environment, Inc.91 Fulton StreetBoonton, NJ 07005 USKristy Cerullo, Marketing/Proposal ManagerPhone (973-334-0003) | Fax (973-334-0928)[email protected]
FLAMEX, Inc4365 Federal DriveGreensboro, NC 27410 USAllen Wagoner, PresidentPhone (336-299-2933) | Fax (336-299-2944)[email protected]/SEE OUR AD ON PAGE 46
FMW Industrieanlagen GmbH3207 Lake Forest Dr.Augusta, GA 30909 USWalter Lampp, North American ManagerPhone (706-829-3337) | Fax (706-733-4115)[email protected]
Forest Concepts, LLC3320 West Valley Hwy NAuburn, WA 98001 USMike Perry, CEOPhone (253-333-9663) | Fax (253-833-2639)[email protected]
FPInnovations570 Saint-Jean BlvdPointe-Claire, QB H9R 3J9 CANADAJennifer Ellson, Senior Communications SpecialistPhone (514-630-4100)[email protected]
GGARN Wood Heating3425 33rd Ave. NEMinneapolis, MN 55418 USMartin Lunde, PE, PresidentPhone (612-326-1100)[email protected]
Geltech Solutions1460 Park Lane South, Suite 1Jupiter, FL 33458 USMatt Struzziero, Director of Sales & Strategic OperationsPhone (800-924-4874) | Fax (561-427-6182)[email protected] OUR AD ON PAGE 50
GEMCO Energy MachinerySuite B,4/F Jinhao Business Bld.,Renmin Rd.,Anyang,Henan,P.R.CHenan, 455000 CHINAyanooka yang, Pellet Mill ManufacturerPhone (008603725965148)Fax (008603725951936)[email protected]://www.gcmec.com
Genera Energy Inc167 Tellico Port RoadVonore, TN 37803 USSam Jackson, VP, Business DevelopmentPhone (423-884-4110)[email protected]
General Kinematics5050 Rickert Rd.Crystal Lake, IL 60014 USDick Reeves, Industry Director - Resource RecoveryPhone (815-455-3222) | Fax (815-455-2285)[email protected]
Global Sustainable Products, Inc.4879 Magnolia RoadMarianna, FL 32448 USJoe Busby, PresidentPhone (850-209-1331)[email protected]
Golden Peanut and Tree NutsP.O. Box 186Headland, AL 36345 USBeverly Warrington, Director, Hull & Fiber ProductsPhone (334-693-0011) | Fax (334-693-0112)[email protected]
GreCon Moisture Meters15875 SW 74th AveTigard, OR 97224 USMarshall LLoyd, SalesPhone (503-641-7731) | Fax (503-641-7508)[email protected]://www.grecon-us.com/measurement/infrared-moisture-meter/SEE OUR AD ON PAGE 47
GreCon Spark Detection15875 SW 74th Ave.Tigard, OR 97224 USTerry Franklin, Technical Sales DirectorPhone (503-641-7731) | Fax (503-641-7508)[email protected]/spark-detection/SEE OUR AD ON PAGE 47
Green Energy of FL12429 Colony Preserve DrBoynton Beach, FL 33436 USJeff Balsewich, CEOPhone (561-922-7475)[email protected]
Green Star Gasifiers, LLC127 Dishman Ln, Suite B-1Bowling Green, KY 42101 USChris Jeffries, PresidentPhone (270-904-4964) | Fax (270-721-0134)[email protected]
Greenfield Products2979 167th St.Hazel Crest, IL 60429 USBill Healy, SalesPhone (708-336-3254)[email protected]://www.greenfieldpi.com/
Greenlane Biogas208 - 4288 Lozells AvenueBurnaby, BC V5A 0C7 CANADARicardo Hamdan, Business DevelopmentPhone (778-788-0774)[email protected]
HH.T. PROF Clean Tech575 N. Patterson Ave.Suite 444Winston-Salem, NC 27101 USTodd Porter, PresidentPhone (770-420-7440) | Fax (770-420-7440)[email protected]/clean-tech.htm
Hallco Industries Inc.PO Box 505Tillamook, OR 97141 USRicardo Aguinaga, VP of Sales and MarketingPhone (503-842-8746)[email protected]
HEMCO Corporation711 South Powell RoadIndependence, MO 64056 USJerry Schwarz, Marketing / AdvertisingPhone (800-779-4362) | Fax (816-796-3333)[email protected]
Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106 USDavid Phillips, Marketing & Communications ManagerPhone (412-788-9810) | Fax (412-788-9822)[email protected]
Hoffmann, Inc.6001 49th St. SouthMuscatine, IA 52761 USPaul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)[email protected]
HUB International New England, LLC formerly FieldEddy InsurancePO Box 70996 Shaker RdEast Longmeadow, MA 01028 USTeresa Petit de Mange, Vice PresidentPhone (413-233-2108) | Fax (413-733-3191)[email protected]
2016 Biomass Industry Directory | 65
Company Index
Hudco Industrial Products, Inc.3100 Morgan RoadBessemer, AL 35022 USBryant Allen, General ManagerPhone (800-247-9908)[email protected]://www.hudcoinc.com/SEE OUR AD ON PAGE 34
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738 USJeff Hurst, Director, Sales & MarketingPhone (2293463545)[email protected] OUR AD ON PAGE 2
Husch Blackwell LLP13330 California StSuite 200Omaha, NE 68154 USDavid Gardels, PartnerPhone (402-964-5027)[email protected]
Hydroflex Systems, Inc.PO Box 296Hummelstown, PA 17043 USCathleen Kaiser, Co-OwnerPhone (717-480-4200)[email protected]
IICF International1725 Eye Street NWWashington, DC 20006 USStacy Noblet, Senior ManagerPhone (202-862-1147)[email protected]
ICS, Inc. PO Box 13158Grand Forks, ND 58208-3158 USDavid Dangerfield, Project DevelopmentPhone (701-775-8480) | Fax (701-775-8479)[email protected]
IEP Technologies417-1 South StreetMarlborough, MA 01752 USJohn Shea, Vice President - Marketing & Business DevelopmentPhone (855-793-8407) | Fax (508-485-3115)[email protected] OUR AD ON PAGE 56-57
Impact Bioenergy Inc.1001 NW 167th StShoreline, WA 98177 USJan Allen, PresidentPhone (206-250-3242)[email protected]
Indeck Power1111 Willis AvenueWheeling, IL 60090 USPat Gallen, Business Development DirectorPhone (847-541-8300)[email protected] OUR AD ON PAGE 42
Industrial Fire Prevention LLCPO Box 2046118 E. Hancock St.Milledgeville, GA 31059 USJeffrey Nichols, PresidentPhone (770-266-7223) | Fax (770-266-7223)info@industrialfireprevention.comwww.IndustrialFirePrevention.com
Industrial Sonomechanics, LLC479 W 146th St., Ground FloorNew York, NY 10031 USIva Gyurgina, Customer Relations and Marketing ManagerPhone (646-580-4676)[email protected]://sonomechanics.com/
International Bioenergy Conference & Exhibition PO Box 1421323 5th AvePrince George, BC V2L 4R9 CANADACam McAlpine, PresidentPhone (250-961-6611)[email protected]/SEE OUR AD ON PAGE 33
International Generator Technical CommunityPO Box 370Columbus, OH 43215 USJane Hutt, Webmaster and Site ManagerPhone (360-515-7861)webmaster@generatortechnicalforum.orgwww.powerplanttechnicalforum.org
Iowa State University BioCentury Research Farm1041 Food Sciences Bldg.Ames, IA 50011-1061 USKevin Keener, DirectorPhone (515-294-0160) | Fax (515-294-6261)[email protected]
ISC Companies12905 Highway 55 WestMinneapolis, MN 55441 USLindsay Distel, MarketingPhone (763-559-0033) | Fax (763-519-1574)[email protected]
JJavo International1900 Cobb International BlvdSuites G & HKennesaw, GA 30152 USJay Honeycutt, North American Account ManagerPhone (770-428-4491) | Fax (770-424-6635)[email protected]
JDV Equipment Corporation1 Princeton AveDover, NJ 07801 USSean King, VPPhone (973-366-6556) | Fax (973-366-3193)[email protected] OUR AD ON PAGE 52
Jeffrey Rader, a brand of TerraSource Global215 Parkway EastSuite ADuncan, SC 29334 USTed Gentile, General ManagerPhone (864-476-6748) | Fax (864-476-7510)[email protected]/bmSEE OUR AD ON PAGE 36
KKarr Group Co.14500 Roscoe Blvd. Ste 203Panorama City, CA 91402 USKevin Talwar, Sales DirectorPhone (805-479-5565) | Fax (805-479-5565)[email protected]
Kent Industrial Co., Ltd.No.17, Dou-Kung 9th Rd., Dou Liu Expanded Industrial Park, Dou Liu City,Yun Lin Hsien, 640 TWSteve Lien, Sales ManagerPhone (88655575356) | Fax (88655575136)[email protected]://www.surface-grinder-kentind.com/
Kentucky Division of Biofuels500 Mero Street, 6th FloorFrankfort, KY 40601 USTim Hughes, DirectorPhone (5025647192) | Fax (502-564-7406)[email protected]/biofuels/Pages/default.aspx
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 USMike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Komptech Americas10855 Dover Street, Suite 1000Westminster, CO 80021 USBrandon Lapsys, VP of Sales & OperationsPhone (303-669-5637)[email protected]
LLatta Equipment Co330 E. Hebron St.Charlotte, NC 28273 USMike Brown, OwnerPhone (704-752-7944)[email protected] http://www.lattaequipment.com/
Legacy Building Solutions 19500 County Rd 142South Haven, MN 55382 USJenniefer Halverson, Business ResourcePhone (320-258-0500)jhalverson@legacybuildingsolutions.comwww.legacybuildingsolutions.com/industries/waste-recycling/
Lehra Energy Resources Pvt LtdLehra near Dehlon District Ludhiana PunjabLudhiana, 141118 INDIAHardeep Singh Ubhi, Executive Director Phone (00919815771137)Fax (01612885137)[email protected]
Lewis & Raulerson1759 State StreetWaycross, GA 31501 USMike Cifranic, Sales EngineerPhone (912-282-0975) | Fax (912-285-3283)[email protected]
LLJ Consulting & Business Development16675 Market AvenueCologne, MN 55322 USB, OwnerPhone (952-466-3363)[email protected]
LM Machinery and Equipment, LLC401 Liberty Ave. Three Gateway Center, Suite 1651Pittsburgh, PA 15222 USWladimiro Labeikovsky, PresidentPhone (412-608-8528) | Fax (412-904-7530)[email protected]://www.lm-machinery.net/
Loci Controls, Inc.28 Dane StreetSomerville, MA 02143 USShaun Bamforth, Director of Business DevelopmentPhone (954-325-0210)[email protected]
Luminate, LLC1801 BroadwaySuite 1620Denver, CO 80202 USMichael Robinson, President & CEOPhone (303-860-7627) | Fax (303-860-7647)[email protected]
MM-E-C Company4401 Belle Oaks Drive,Suite 210Charleston, SC 29405 USStephen Rice, COOPhone (620-325-2673) | Fax (620-325-2678)[email protected]
Maas Companies Inc.P. O. Box 7127Rochester, MN 55903-7127 USTyler Maas, Director of Sales & MarketingPhone (507-285-1444) | Fax (507-285-0034)[email protected]
Maine Pellet Fuels Association 97A Exchange StreetSuite 305Portland, ME 04101 USWilliam Bell, Executive DirectorPhone (207-752-1392)[email protected]
Marsh & McLennan Agency1001 Haxall Point, Suite 800Richmond, VA 23219 USGeorge Phillips, Sr. Vice presidentPhone (804-915-5630)[email protected]
Master Magnetics747 S. Gilbert St.Castle Rock, CO 80104 USJim Madsen, Sales ManagerPhone (888-293-9399)[email protected]
McGill AirClean LLC1777 Refugee RoadColumbus, OH 43207 USJerry Childress, National Sales ManagerPhone (614-829-1350) | Fax (614-445-8759)[email protected]
66 | 2016 Biomass Industry Directory
Company Index
McGill AirClean LLC1777 Refugee RoadColumbus, OH 43207 USJerry Childress, National Sales ManagerPhone (614-829-1200) | Fax (614-445-8759)[email protected]
Mid-South Engineering1658 Malvern AvenueHot Springs, AR 71901 USMark Culpepper, Vice PresidentPhone (501-321-2276) | Fax (501-624-4214)[email protected] OUR AD ON PAGE 24
Miron Construction Co., Inc.1471 McMahon DriveNeenah, WI 54956 USDan Goymerac, Vice President Industrial Business DevelopmentPhone (920-969-7004) | Fax (920-969-7393)[email protected]
Monitor Tech Corporation661 N. James Rd.Columbus, OH 43219 USRobert Mullowney, CEOPhone (614-231-0500) | Fax (614-231-0555)[email protected] OUR AD ON PAGE 49
Monitor Technologies LCC44W320 Keslinger RoadElburn, IL 60119 USGreg DeRudder, Director of SalesPhone (630-365-9403)[email protected]
Morbark, Inc. 8507 S. Winn Rd, PO Box 1000Winn, MI 48896 USMichael Stanton, Regional Sales ManagerPhone (800-831-0042) | Fax (989-866-2280)[email protected]
Morrow Renewables, LLCPO Box 61447Midland, TX 79711 USLuke Morrow, PresidentPhone (432-563-0447)[email protected]
NNational Electric Coil800 King AvenueColumbus, OH 43212 USSteve Jeney, VP Marketing/SalesPhone (614-488-1151) | Fax (614-488-8892)sendinfo@national-electric-coil.comwww.national-electric-coil.com
NDC Technologies8001 Technology BlvdDayton, OH 45424 USJay Luis, Marketing Communications ManagerPhone (937-233-9935)[email protected] OUR AD ON PAGE48
New Canaan Capital Mgmt LLC. Post Office Box 94831344 Crayton Road Naples, FL 34101 USJeffrey Weisz, Managing Member Phone (239-919-8825) | Fax (917-957-9703)[email protected]
New Holland Agriculture500 Diller AvenueNew Holland, PA 17557 USJarrod Angstadt, Manager, Growth Initiatives, Biomass & SpecialtyPhone (281-687-9159) | Fax (281-763-2632)[email protected]/na
Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750 USGrant Gagner, Commercial Sales ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 40
NSF International789 N. Dixboro RoadAnn Arbor, MI 48105 USJamie Bush, Business Development Manager - SustainabilityPhone (734-827-5668)[email protected] OUR AD ON PAGE 17
OOlson Search International, Inc.PO Box 3127Redmond, WA 98073 USJon Olson, PresidentPhone (800-985-5191) | Fax (406-756-5154)[email protected]
optek-Danulat, Inc.N118W18748 Bunsen DrGermantown, WI 53022 USJoe Ferrelli, Product SpecialistPhone (888-901-4288)[email protected]
Outotec Energy Products3568 W Industrial LoopCoeur d’Alene, ID 83815 USKent Pope, Director of Business DevelopmentPhone (208-765-1611) | Fax (208-765-0503)[email protected]
PPenn State Biomass Energy Center249 Ag Engineering BuildingUniversity Park, PA 16802 USTom Richard, DirectorPhone (814-863-0291) | Fax (814-863-1031)[email protected] OUR AD ON PAGE60
Pick Heaters, Inc.730 S. Indiana Ave.PO Box 516West Bend, WI 53095 USSales Dept., SalesPhone (262-338-1191) | Fax (262-338-8489)[email protected]
Potomac Law Group, PLLC6225 Hampstead Ct.Port Tobacco, MD 20677 USNeil Belson, Of Counsel and Chair of Life Sciences PracticePhone (240-416-7239) | Fax (301-392-9806)[email protected]://www.potomaclaw.com/attorney-profiles/neil-belson/
PPS Group LLC 4717 Grand Ave. Suite 300Kansas City, MO 64112 USLou Gonzales, PresidentPhone (816-627-0606) | Fax (816-531-2195)[email protected]
Precision Energy Services 8172 N Wayne Dr.Hayden, ID 83835 USMike Oswald, President Phone (208-772-4457)[email protected]://www.pes-world.com/
Precision Injection-Multiplas Enginery Co., Ltd.No.65, Technology 7th Road, Hwa-Ya Technology Park,Taoyuan, 33333 TAIWANApple Wang, Marketing SpecialistPhone (88633180090) | Fax (88633975498)[email protected]://www.injection-molding-machines.com/
Price LogPro, LLC. 400 Aviation Plaza, Suite BHot Springs, AR 71913 USJosh Krauss, Vice President of SalesPhone (800-826-7803) | Fax (501-844-4474)[email protected]
Process and Storage Solutions3446 County Road 90Rainsville, AL 35986 USDonald Land, Co-OwnerPhone (866-354-7277) | Fax (256-638-1839)[email protected] OUR AD ON PAGE 55
ProcessBarron2770 Welborn St.Pelham, AL 35124 USCliff Moss, VP and Director of Materials Handling DivisionPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
ProcessBarron2770 Welborn StreetPelham, AL 35124 USCliff Moss, Vice PresidentPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
ProcessBarron2770 Welborn StreetPelham, AL 35124 USAllen Ray, Director of Air HandlingPhone (205-663-5330)[email protected] OUR AD ON PAGE 30ProcessBarron2770 Welborn StreetPelham, AL 35124 USPhillip Gore, Product ManagerPhone (205-663-5330)[email protected] OUR AD ON PAGE 30
Processbio A/SPO Box 34 Romeo, MI 48065 USJorgen Lyngso, American representativePhone (586-255-7075)[email protected]
Proco Products, Inc.2431 N. Wigwam DriveStockton, CA 95205 USRob Coffee, VP Sales & MarketingPhone (209-943-6088) | Fax (209-943-0242)[email protected]
ProPellet, LLC807 Broadway Street NE, Suite 185Minneapolis, MN 55413 USKathy Osborne, Business Development ManagerPhone (612-616-7409)[email protected]
Pure Dwelling LLCP.O. Box 863Sun Prairie, WI 53590 USGregory Brown, PrincipalPhone (608-630-0225)[email protected]
RR W HEIDEN ASSOCIATES LLC1026 New Holland AvenuePO Box 5001Lancaster, PA 17601 USRichard Heiden, Chief Science and Technology OfficerPhone (717-299-6860) | Fax (717-299-6868)[email protected]
Rawlings Waste Wood Recovery SystemsPO Box 4485Missoula, MT 59806 USJohn Rawlings, PresidentPhone (406-728-6182) | Fax (406-728-7957)[email protected] OUR AD ON PAGE 18
RCBC Global Inc.15 Pine Dr.Mills River, NC 28759 USDoug King, Marketing DirectorPhone (828-696-2111) | Fax (828-696-2191)[email protected],com
RCBC Global Inc.401 North Main St. Suite 201Hendersonville, NC 28792 USDoug King, VP MarketingPhone (828-696-2111)[email protected]
REBL Refractories Evaluations Laboratory, ULC#109, 8484 162nd StreetSurrey, BC V4N 1B4 CANADABryce Jardine, Regional ManagerPhone (778-578-7551) | Fax (778-578-7571)[email protected]
Refined BioProducts1718 Pine StreetStevens Point, WI 54481 USJohn Leschke, New Business DevelopmentPhone (715-869-7866)[email protected]
2016 Biomass Industry Directory | 67
Company Index
Renewable Energy Consultants, LLCPO Box 41Beavertown, PA 17813 USBob Rice, President/CEOPhone (570-765-2020)[email protected] OUR AD ON PAGE 23
Riley Power Inc.5 Neponset StreetWorcester, MA 01615-0040 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/riley-power-incSEE OUR AD ON PAGE 7
RIX Industries4900 Industrial WayBenicia, CA 94510 USDave Savidge, Director of Industrial and Commercial CompressorsPhone (707-745-7112)[email protected] OUR AD ON PAGE 43
Rotex Global1230 Knowlton StreetCincinnati, OH 45223 USAustin Kephart, Marketing ManagerPhone (513-541-1236)[email protected]
Round for a Reason LLC11698 395th AveColumbia, SD 57433 USAndrew Murray, MemberPhone (605-396-2431)[email protected]
RR Renewable Energy23 Lafayette StRumson, NJ 07760 USGeorge Saintonge, PresidentPhone (732-768-7007) | Fax (732-741-2087)[email protected]
RSG - Resource Systems Group, Inc.55 Railroad RowWhite River Junction, VT 05001 USJohn Hinckley, DirectorPhone (802-295-4999)[email protected]
Rubb Buildings Inc.1 Rubb LaneSanford, ME 04073 USChuck Auger, Marketing ManagerPhone (207-324-2877)[email protected]
RUD Chain Inc.PO Box 367Hiawatha, IA 52233 USMike Mews, North American Sales ManagerPhone (319-375-3224) | Fax (319-214-0003)[email protected] OUR AD ON PAGE 31
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427 USWalter Zurawick, Industrial Business Development SolutionsPhone (941-408-4294)[email protected]
SSAMSON Materials Handling Ltd.Gemini House, Cambridgeshire Business Park1 Bartholomew’s WalkEly, Cambridgeshire, CB74EA GBMalcolm Youll, Managing DirectorPhone (441353665001)Fax (441353666734)[email protected]
SCHADE Lagertechnik GmbHBruchstrasse 1Gelsenkirchen, 45883 DEKarl-Heinz Fiegenbaum, Managing DirectorPhone (4920950316122) Fax (4920950316188)[email protected]
Schaeffer’s Specialized Lubricants102 Barton StreetSt. Louis, MO 63104 USSteve Rober, National Sales ManagerPhone (314-865-4100) | Fax (314-865-4107)[email protected] OUR AD ON PAGE
Schnader Harrison Segal & Lewis LLPSuite 2700 Fifth Avenue Pl.120 Fifth AvenuePittssburgh , PA 15222 USMegan Harmon, PartnerPhone (412-577-5200)[email protected]
Scientific Dust Collectors4101 W. 126th StreetAlsip, IL 60007 USAndrew Rutherford, Sales ManagerPhone (708-597-7090) | Fax (708-597-0313)[email protected]
Sigma Thermal, Inc4875 Deen RoadMarietta, GA 30065 USEric Dessecker, Executive Vice PresidentPhone (770-427-5770)[email protected] OUR AD ON PAGE 53
Simplyfeye Softwares Pvt LtdFlat S1, 2nd Floor, 8-3-970Srinagar ColonyHyderabad, 500073 INAnshuman Bansal, DirectorPhone (914042217057)[email protected]://www.simplyfeye.com
SLS Financial Services200 S., O’Connell StreetSuite 400Marshall, MN 56258 USKennedy Gilbertson, National Account ManagerPhone (605-444-1106) | Fax (605-271-7133)[email protected]
Smart E2 Solutions14 Edgewood RoadRumson, NJ 07760 USGeorge St.Onge, Director of Business DevelopmentPhone (732-768-7007) | Fax (732-758-1169)[email protected]
SmokeLess Heat LLC2020 cornwall RDLebanon, PA 17042 USDean Zook, OwnerPhone (717-389-0083) | Fax (717-273-2248)[email protected]
Stock Equipment Company16490 Chillicothe RoadChagrin Falls, OH 44023 USSusan Wiltshire, Technical WriterPhone (440-543-6000) | Fax (440-543-5944)[email protected]://www.schenckprocess.com/stockequipment
Sukup Manufacturing Co.PO Box 6771555 255th St.Sheffield, IA 50475-0677 USJohn Hanig, Bin Sales DirectorPhone (641-892-4222) | Fax (641-892-4629)[email protected]
SUMA America855 North Wood Dale RoadSuite AWood Dale, IL 60191 USEugene Smith, Sales Application EngineerPhone (847-427-7880) | Fax (630-354-6840)[email protected]
Syntek Resource Corporation2143 18th Avenue CourtGreeley, CO 80631 USSandra Robnett, Chm/CEOPhone (970-356-9004) | Fax (970-356-9004)[email protected]
TTAPCO Inc.225 Rock Industrial Park DriveSt. Louis, MO 63044 USYassine Abbad, International Sales ManagerPhone (314-739-9191)[email protected]
Team Biogas23551 Rose Quartz DrPerris, CA 92570-7440 USMark Hintz, Sales ConsultantPhone (425-422-5970) | Fax (866-593-3679)[email protected]
TEi Construction Services170 Tucapau RdDuncan, SC 29334 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/tei-construction-services-incSEE OUR AD ON PAGE 7
Tenmat LimitedAshburton Road WestTrafford ParkManchester, M17 1RU ENGLANDJoshua Cullen, Technical Sales EngineerPhone (00441619552425)Fax (00441618727596)[email protected]
TGR Industrial Services1127 S Lewis AveTulsa, OK 74104 USGary Mathis, Advanced NDT ManagerPhone (918-629-2735) | Fax (918-584-5598)[email protected]
The Dupps Company548 North Cherry Street Germantown, OH 45327 USRichard Weeks, SalesPhone (937-855-6555)[email protected]
Thermal Engineering Int’l (USA)10375 Slusher DriveSanta Fe Springs, CA 90670 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 7
Three-esVia Libertà 105Lazzate, 20824 ITALYMarco Soldo, ManagerPhone (00390296328225) | Fax (00390296320029)[email protected]
Timber Products Inspection1641 Sigman RoadConyers, GA 30012 USTammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]
Towertech Cooling System Pvt.Ltd103-B, Synergy Tower, Near Vodafone House, Corporate Road,Prahlad Nagar, 380015 INDIAPhone (917940397842)[email protected]://www.towertechglobal.com/
TRAXPayroll - Online Payroll Services740 Alfred Nobel DriveHercules, CA 94547 USSales/AdminPhone (866-611-5410) | Fax (510-964-9322)[email protected]
Tulikivi U.S.Inc.172 South Pantops Dr, Suite BCharlottesville, VA 22911 USPäivi Saarelainen, Sales and Marketing ManagerPhone (800-843-3473)[email protected]
68 | 2016 Biomass Industry Directory
Company Index
Turboden Srl628 Hebron Avenue, Suite 400Glastonbury, CT 06033 USIlaria Peretti, Manager, Sales & Business Development North AmericaPhone (860-881-0281)[email protected] OUR AD ON PAGE 28
UUEM1818 S. Australian Ave. Suite 110West Palm Beach, FL 33409 USNina Kshetry, Project ManagerPhone (561-294-0138) | Fax (561-683-2996)[email protected]
Uzelac Industries, Inc.6901 Industrial LoopGreendale, WI 53129 USMichael Uzelac, PresidentPhone (414-529-0240)[email protected]
VValmet 2750 Morris RoadLansdale, PA 19446 USDarryl Haag, Director, Energy SolutionsPhone (267-421-9770)[email protected]/industries-we-serve/energy/
Valmet, Inc.3440 Toringdon WaySuite 300Charlotte, NC 28277 USKerry Flick, Director, TechnologyPhone (704-541-1453)[email protected]
Vecoplan Midwest4005 Earnings WayNew Albany, IN 47150 USBill Miller, Chief Operating OfficerPhone (812-923-4992)[email protected] OUR AD ON PAGE 16
Vecoplan, LLCPO Box 7224High Point, NC 27264 USYuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 16
Vermeer1210 Vermeer Rd EastPella, IA 50219 USJay Van Roekel, Biomass Business ManagerPhone (641-628-3141)[email protected]
VIC-Vecoplan Integrated Controls5708 Uwharrie RoadArchdale, NC 27263 USTodd Carswell, VP of Technical ServicesPhone (336-861-6070)[email protected] OUR AD ON PAGE 16
Virtus Equipment340 Commerce Drive Unit BCrystal Lake, IL 60014 USThomas Breslin, PresidentPhone (815-477-2100)[email protected]
Vogelbusch USA, Inc.1810 Snake River RoadKaty, TX 77449-7747 USDan Mahon, Vice PresidentPhone (713-461-7374)[email protected]
Vogt Power International13551 Triton Park BoulevardSuite 2000Louisville, KY 40223 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-recovery-systems/vogt-power-internationalSEE OUR AD ON PAGE 7
Vulcan Systems1414 Riley Industrial Dr., PO Box 98Moberly, MO 65270 USPreston Whitney, Vice President of Business DevelopmentPhone (660-263-7575) | Fax (660-263-2526)[email protected] OUR AD ON PAGE 32
WWarren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618 USRandy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Webco Industries9101 W 21st StreetSand Springs, OK 74063 USJene Harmon, Marketing DIrectorPhone (918-245-2211) | Fax (918-246-7053)[email protected]
Wellons2525 W Firestone LaneVancouver, WA 98660 USSalesPhone (360-750-3500) | Fax (360-750-3400)[email protected]
West Salem Machinery Co.PO Box 5288665 Murlark Ave NWSalem, OR 97304 USDesmond Smith, Vice President, Sales/MarketingPhone (800-722-3530)[email protected] www.westsalem.comSEE OUR AD ON PAGE 38
Western Pneumatics, Inc.PO Box 21340Eugene, OR 97402 USBruce Livesay, Vice PresidentPhone (541-461-2600) | Fax (541-461-2606)[email protected]
Wildephor Consulting Services, LLC481 N Santa Cruz Ave #280Los Gatos, CA 95030 USW. David Featherman, PE, PrincipalPhone (510-845-0016)[email protected]
Wisewood, Inc2409 N. Kerby Ave. Portland, OR 97227 USMeagan Nuss, Project Development CoordinatorPhone (503-706-6187) | Fax (503-715-0483)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330 USLynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 29
ZZhengzhou Victor MachineryCo LtdWenhua Roand and Sanquan Road Zhengzhou ChinaJames Duan, salesmanPhone (008637156747890)[email protected]://victormachinez.com/