Presentation format4 posttranslational modification in cell adhesion and migration
Preview:
Citation preview
- 1. Posttranslational modification in cell adhesion and
migration with emphasis on acetylation Dipl.-Ing. Birgit Kastberger
Department of Cellular Physiology and Metabolism, University
Medical Center, University of Geneva Oral exam: November 7,
2014
- 2. Cell Extracellular matrix (ECM) Integrins are involved in
cell adhesion and migration provide a link from the ECM to the
actin cytoskeleton a b1A Harvard University, BioVisions-The Inner
Life Of A Cell, 2011 Integrins Actin
- 3. adaptor and b1A integrin PTMs are involved in cell adhesion
& migration Filopodial contacts first contact with ECM
spreading Lamellipodia adhesion, maturation, signalling Focal
adhesions ECM remodelling Fibrillar adhesions W. Hu et al, Plos
One, 2014, Geiger, et al., Nature Reviews Molecular Cell Biology,
2001 Fibrillar adhesions: phospho-Tyrosine, Tensin Tensin Focal
adhesions: phospho-Tyrosine pTyr integrins weblike/remodeling actin
adaptor proteins bundled/contractile actin stress fibres
- 4. b1A integrin tail is phosphorylated and acetylated
Extracellular domain: 21-728 aa Transmembrane domain: 729-751 aa
Cytoplasmic tail: 752-798 aa 1A
LLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK What role do PTMs
play? PP P PPP Ac
- 5. Over 200 distinct covalent PTMs diversify the proteome KL
Vermillion et al, JCB, 2014; Prabakaran et al, Wiley P., 2012,
Thermo Scientific: post-translational-modification Most frequent
PTMs experimentally observed Khoury et al., Sci. Rep. 1, 2014
(2011) P h o s p h o ry la tio n A c e ty la tio n M e th y la tio
n O th e rs P P P P Ac Ac Me AcAc
- 6. 3 examples of more widely studied reversible PTMs :
phosphorylation t1/2=20min Donor: ATP Kinase Phosphatase x Okadaic
acid, H2O2 x Imatinib, Dasatinib, Staurosporin EGF, PDGF
experimental phosphoryl. frequencynorm to aa frequ. pY/pT/pS: 1/1/4
+PO4 -3 provoke charge modification Kinases > high Kd for ATP
> makes them operate close to independently from ATP
concentrations Arena et al, CMLS, 2005; S. Prabakaran et al., Wiley
Periodicals, 2012 phosphorylation modulates activity conformation
docking sites
- 7. Phosphorylation in cell adhesion and migration: Cofilin K.
Rottner et al 2011 Curr. Opin. Cell Biol; Y. Zhang, Genes Dev,
2012, Mizuno, Cellular Signalling, 2013; Moriyama, Genes Cells,
1996; Nagai et al, Genes & Cancer, 2012; Harvard University,
BioVisions-The Inner Life Of A Cell, 2011 Cofilin pSer3 inactive
Cofilin does not bind actin (phospho mimic S3D mutation) 1 integrin
triggers downstream phosphorylation of pSer3 in Cofilin pSer3
active Cofilin binds to actin found at the leading edge of mobile
cells is required for directional migration severs actin filaments
Cofilin active Cofilin Ser-3 P inactive Ser-3 dephospho mimic S3A
mutant > cell migration and invasiveness invading astrocytoma
brain cancer cell number through the matrigel-precoated membrane
activity regulated by phosphorylation > local K/P
concentration
- 8. 3 examples of widely studied reversible PTMs: methylation S.
Prabakaran et al., Wiley Periodicals, 2012; S. Lanouette et al,
Mol. Syst. B., 2014, Vermillion et al, JCB, 2014 Methyl Donor: SAM
Lysine Methyl-Transferase (HMT) t1/2= very stable GSK J4 HCl x only
small mass change protein stability modulates interactions between
protein/DNA, protein/protein: docking site no change of positive
charge crosstalks with PTMs x Demethylase (HDM) Mono- Di-
Tri-methylation hydrogen bond formation not erasable by hydrolysis
but via oxidative conversion > into hydrolytically labile imine
methylation Competitive inhibitors for SAM: Trifluoroacetate salt,
UNC0631 each methyl group > hydrophobicity of hydrophilic
Lys
- 9. Lysine-Methylation in cell adhesion and migration:
elongation factor 1-a1 (EF1a1) methylation is required for neural
crest migration K.L. Vermillion et al, JCB, 2014 IF Control chicken
embryo no change in neural crest migration (at somite 9 stage)
EF1a1 binds to the actin cytoskeleton at the leading edge of
migratory neural crest cells Sox10: Protein specifically present in
migrating neural crest cells GFP GFP GFP GFP 6x di-/tri-methylated
K (found by MS) to methylation resistant A EF1a1 prevents or
promotes actin polymerization (conc. dep.) methylation resistant
EF1a1 expression > cell migration distance
- 10. 3 examples of more widely studied reversible PTMs:
acetylation t1/2= 1-60min Acetyl transferase (HAT) or equilibrium
reaction Deacetylase (HDAC) Glucose, EtOH x SBHA, TSA, SAHA
Anacardic acid Resveratrol, SRT-501 (are well tolerated in humans)
Lundby et al, Cell Reports, 2012; Friis et al, Nucleic Acids
Research 2009; Walsh et al, Angew. Chem. Int. Ed., 2005; Okanishi
et al, J. proteome research, 2013; S. Prabakaran et al., Wiley
Periodicals, 2012 Lys-e amine acetylation neutralizes its positive
charge alters hydrogen bonds alters stability docking site hampers
electrostatic interaction increases hydrophobicity of hydrophilic
Lys tissue-type acetylation pattern cell compartment specific Lys
acetylation x Donor: AcCoA
- 11. Lysine is the most heavily modified amino acid Lys
acetylation blocks other PTMs lengthens proteins lifetime (e.g.
p53) XJ Yang, Mol. Cell., 2008
- 12. 18 human HDAC enzymes classified into 4 groups based on
yeast homology Kelly et al, Ashley Publications, 2002; Kim et al,
Am J Transl Res, 2011; Sadoul et al, J. Biomed. and Biotech., 2011;
Grant, Academic Press, p89, 2012; Michishita et al, MBC, 2005 HDACs
class III SIRT 1/2cytop/3/4/5/6/7 NAD+ ubiquitously expressed high
expression in brain, testis HDACs class I 1/2/3cytop/8cytop Zn2+
ubiquitously expressed TSA HDACs class II IIa:
4cytop/5cytop/7cytop/9cytop IIb: 6cytop/10cytop Zn2+ predominant in
heart, smooth muscle, brain, kidney TSA HDACs class IV 11cytop Zn2+
predominant in heart, smooth muscle, brain, kidney TSA
- 13. Acetylation can mingle with other PTMs to form complex
regulatory programs XJ Yang, Mol. Cell., 2008; Rao et al, BMC
Bioinformatics, 2013; Z. Lu et al, Plos One, 2011; Latham et al,
Nat Struct Mol Biol, 2007 46.0% of studied Ac-Lys are predicted to
have an effect on phosphorylation sites: creation/destruction of a
phosphorylation site alterations in kinase binding Z. Lu et al,
Plos One, 2011 #ofalteredphosphorylationsites Distance from K-Ac
Distance distribution of altered phosphorylation site to K-Ac (Q)
in silico perturbation of the microenvironment through substitution
of Lys (K) (+) with Glu (Q) (neutral), mimicking a neutral
Ac-Lys
- 14. autophagy amino acid degradation Acetyl-CoA: the crossroads
of fat, sugar and protein catabolism J. Patel et al., Nutrition
& Metabolism, 2011; Choudhary et al, Nature reviews, 2014;
Wellen et al, Nature reviews, 2012; Mario et al, cell press, 2014
acetate can be produced by deacetylation reactions ethanol
metabolism in the liver by bacteria in the colon Citrate-Shuttle
nutrient starvation > depletes AcCoA provokes autophagy caloric
intake elevates Acetyl-CoA concentrations acetyl-CoA concentration
influences HAT activity overall acetylation level
- 15. 2 examples of protein acetylation in cell adhesion and
migration: a-tubulin acetylation reduces cell motility XJ Yang et
al, cell press, 2008; Joo et al, nature communications, 2014;
Glozak, science direct, 2005; Harvard University, BioVisions-The
Inner Life Of A Cell, 2011 welkescience Microtubles - and -tubulin
dimers form long, hollow cylinders component of cytoskeleton
platforms for intracellular transport (secretory vesicles,
organelles) Microtubules Deacetylation: HDAC6, SIRT2 microtubule
acetylation reduces cell migration increased stability microtubule
acetylation found at leading edge prone to depolymerization HDAC6
>microtubule acetylation > cell migration speed
- 16. 2 examples of protein acetylation in cell adhesion and
migration: Cortactin acetylation reduces cell motility X. Zhang et
al, Cell Press, 2007; Y. Zhang et al, Oncogene, 2009; XJ Yang et
al, cell press, 2008; Kirkbridge et al, Cell Adhesion and
Migration, 2011;p ; Harvard University, BioVisions-The Inner Life
Of A Cell, 2011 Cortactin Cortactin cytoplasmic, monomeric
regulates branched actin assembly & stabilization at leading
edge abnormally expressed in many human tumours overexpression >
invasiveness and migration depletion > impairs cell migration
Acetylation: p300 Deacetylation: HDAC6 and Sirt1 deacetylated
cortactin cells migrate faster translocates to cell periphery actin
binding high levels of SIRT1 observed in tumours hyperacetylated
cortactin (up to 10 residues) translocation to the cell periphery
association with actin cell motility
- 17. Drug effects on cell acetylation state and disease: HDAC
inhibitors Singh et al, ERAT, 2010; Choudhary et al, Science, 2009;
Wikipedia: SAHA, 2014; stocan.weebly.com, 2014;
penn-medicine-lung-transplant.blogspot.ch, 2014 SAHA (Vorinostat)
FDA approved treatment for cutaneous T-cell lymphoma (CTCL)
anti-cancer drug with low toxicity competes with Zn2+ > blocks
active site of HDACs affects growth/survival of tumor cells overall
protein acetylation provokes tumour selective pro-apoptotic gene
pro-survival gene HDAC-1 gastric cancer lung cancer HDAC-5/10 HDAC
inhibitors are anticancer drugs cell cycle
arrest/apoptosis/autophagy metastasis/angiogenesis acetylation
mediated p53 activation > p53s half life SAHA HDACs are often
deregulated in cancer
- 18. Drug effects on cell acetylation state and disease: Glucose
Miller et al, MBoC, 2014; Choudhary et al; Nature reviews, 2014
SIRT1 consequences of high glucose conditions for adhesion/matrix
increase integrin cell adhesion stimulate FN polymerization
diabetics > higher plasma glucose concentrations > may entail
greater overall protein acetylation E.g. diabetic nephropathy comes
with ECM expansion glucose restriction provokes glucose production
from fatty acids > maintains blood glucose levels SIRT1 >
acetylation of proteins? high concentrations of glucose acetyl-CoA
levels overall protein acetylation fatty acid production
- 19. Drug effects on cell acetylation state and disease: EtOH
Blythe et al, alcoholism: Clinical and Experimental research, 2010;
Kannarkat, Journal of Hepatology, 2006; Lieberman et al, Wolters
Kluwer, 2012 3 male rats fed 5 weeks with 36% ETOH containing diet
Arrows: 2 fold or greater increase of acetylation Acetyl-CoA livers
EtOH metabolism EtOH transformed into acetate (liver) > acetate
metabolized to AcCoA Anti-acetyl Lysine antibody of rat livers
highly reactive with Lys not toxic treatment chronic liver disease
> overall acetylation HDAC activator Resveratrol attenuates
fatty liver in alcohol-exposed mice chronic EtOH consumption
provokes liver protein hyperacetylation (3x ): tubulin, actin,
cortactin, p53 key factor in liver injury mitochondrial
dysfunction, altered protein trafficking after EtOH withdrawal >
acetylation remains 0.04 endogenous EtOH in human blood bacterial
fermentation caloric intake > 0.06 EtOH exposure to cells >
protein acetylations, phosphorylations, methylations
- 20. Conclusion: cell adhesion and migration are crucial for
organisms structural organization embryogenesis body growth body
function immune responses repair after injury constant dynamics
tissue remodelling tissue renewal (adults cell age: 7-10 years)
maintain body structure connective tissue epithelial tissue allow
cell movement matrix modelling adhesion making/breaking Spalding et
al, Cell, 2005; Alberts, 2008 Cell-Matrix adhesions: via integrins
Cell migration: via cytoskeleton PTMs drive integrin function PTMs
drive the function of cofilin, a-tubulin, cortactin, EF1a1 Cell
adhesion and migration are essential for the structure and
maintenance of multicellular organisms & PTMs are involved in
their regulation
- 21. Thank you for your attention! Now its time for
questions..
- 22. PTMs crosstalking evidence: the p53 example DNA damage>
p53 activation via methylation-acetylation-phosphorylation cascade
Lys372 methylation required for p53 acetylation Lys370 and Lys372
acetylation on p53 change DNA binding specificity forms docking
sites for transcriptional co-activators enhances nuclear
localization impairs methylation, ubiquitination > p53 half-life
impacts on phosphorylation of Ser371 contributes to p53
stabilization cell cycle arrest through targeted protein expression
Acetyltransferases (HAT): p300 Deacetylases (HDACs) : HDAC1, HDAC3,
SIRT1, SIRT7 p53-transcription factor, tumour suppressor very
unstable may be ac, p, m, ub,.. gene mutated in 50% of human
cancers (eg Lys 120) in nucleus/cytoplasm at low levels (unstressed
cells) activated p53 protein induces cell-cycle arrest/apoptosis
mice with 7xKR mutations at the C-term including Lys370/372: viable
and phenotypically normal Patel et al, Nutrition & Metabolism,
2011; XJ Yang et al, Cell, 2008; Walsh et al, Angew. Chem., 2005;
Ashcroft, et al Mol. Cell. Biol., 1999