View
487
Download
0
Category
Preview:
Citation preview
Development of Diagnostic Tools and Vaccines for Aquatic Animals
Symposium on Agricultural Biotechnologies, 15-17 February 2016
Alexandra (Sandra) Adams Institute of Aquaculture
University of Stirling, Scotland, UK
Institute of AquacultureInstitute of Aquaculture
Outline Introduction Climate change and aquaculture Development of diagnostics tests Vaccine development Final thoughts & conclusions
Fish Disease -disease is considered a major constraint to aquaculture production globally Bacterial Fungal Viral Parasitic
Photograph courtesy of Peter Dixon, CEFAS
Control of disease is complex:Pathogen detection, disease diagnosis, treatment, prevention and general health management
Climate Change and Aquaculture Alters risk of disease-pathogen distribution-pathogen prevalence-pathogen virulence
Impact will vary (+ve and –ve)
-Climatic regionstropicalsub-tropicaltemperate-Different environmentsfreshwatermarinebrackishwater
Some examples of climate sensitive diseases
Disease TypeEpizootic Ulcerative Syndrome-EUS)
Koi herpes virus disease (KHVD) Viral Encephalopathy & Retinopathy
Fish Ectoparasites
Streptococcus infections
White Spot Disease (WSD) Infectious Myonecrosis White tail disease
Shrimp AHPND
Fish fungal disease
Fish viral diseaseFish viral disease
Fish parasitic diseases
Fish bacterial disease
Shrimp viral diseaseShrimp viral diseaseShrimp viral disease
Shrimp bacterial disease
Climate Change and Aquaculture Climate change will affect movement and spread of diseases
Need to have in place-Relevant rapid diagnostic tests-Appropriate vaccines to prevent diseases
Amoebic Gill Disease-no vaccine
Furunculosis-effective vaccine
Rapid Diagnosis Speed of pathogen detection important- to prevent spread of disease
Significant progress in development of rapid methods to detect pathogens
- adaption and optimisation of clinical and veterinary methods for use in aquaculture
Diagnostic Tests-Detection of Pathogens Screening:
presumably healthy individuals
Diagnostics test: diseased animals
WHERE? In infected fish clinically & sub-
clinically
In the environment
DETECTION OF PATHOGENS HOW?Morphological/Traditional Methods -culture and histology
Immunological Methods
Molecular Methods
Combination of Methods A combination of methods is often required for a definitive diagnosis of disease Good sample collection is important Selection of the methods depends on a variety of factors -- each method has its merits and disadvantages
Which methods should be applied in aquaculture?
Methods need to be robust yet sensitive!
Challenges Accuracy Specificity Sensitivity Speed Technical complexity Cost Availability Robust Affordable Requirements differ: lab versus field
Examples of novel technologies with potential for use in aquaculture
Immunoassays Molecular tests Other technologies
Lateral Flow Device (LFD)- Immunochromatography
User-friendly formatVery specificVery sensitive Very rapidLong-term stability over a wide range of temperaturesRelatively inexpensive to make
ISAV Rapid KitSensitivity = PCR
-ve
+ve
ISAV Rapid Test Kit MethodISAV Rapid Test Kit Method
Nanotechnology- magnetic beads (coated with antibody) rotate under a magnetic- this gives a signal - when the pathogen binds to the beads they form clusters
ImmunoMagnetic Reduction (IMR)-Larger, clustered magnetic beads cannotrotate very well and therefore the signal is reduced
Examples of Molecular Tests-Real-time qPCR in the field
Mobile PCR-Genesig q16 on-site qPCR diagnostics
Isothermal amplification Nucleic acid amplification at a single temperature o More suitable for use in the field LAMP – Loop-mediated isothermal amplification Other formats (NASBA, RPA etc..) Assays developed for many livestock pathogens
Other TechnologiesMALDI TOF MSID of protein profiles Need cultureRapid and low cost analysisDatabase for aquaculture?
DNA sequencing
Control significant diseases Save costs Reduce concerns over residue levels and
environmental impacts Reduce the need for antibiotics and
chemicals Reduce problems with antibiotic resistance
Vaccines
7 NorwegianNorwegianSalmonSalmonProduction, Production, Use of Pure Antibiotics and theUse theEffectEffectofofVaccinesVaccines010203040506019811982198319841985198619871988198919901991199219931994199519961997199819992002001200220032004USE of antibiotics (MT)050100150200250300350400450500550600650Salmon production (1,000 MT)Vibriosis vaccineFurunculosis vaccineOil-basedFurunc. vaccineCombination vaccines
From: Fish Vaccination – A brief overview. Dr Marian McLoughlinFrom: Fish Vaccination – A brief overview. Dr Marian McLoughlin
Antibiotic usage has Antibiotic usage has reduced by 99.5%reduced by 99.5%
Atlantic salmon production in Scotland
AnnuallyIn Scotland ~20 million trout and ~40 million
salmon vaccinated Globally ~90 million trout and 418 million
salmon vaccinated
Increase in commercially available vaccines
BUT there are still diseases where no are vaccines available
AND some existing vaccine do not perform well
Fish Vaccines
Safety Cost-effectiveness Long term protection Serotypic/genetic variation of the pathogen Time-/age when fish most susceptible to disease Species Route of administration Method of vaccine preparation
Primary considerations
Types of Vaccine• Inactivated whole cell• Adjuvanted• Sub-unit• Recombinant• Live attenuated• Synthetic (peptide)• DNA vaccines
Development cost
Not an easy to develop a vaccine-need to identify protective antigens-like finding a needle in a haystack!
Identification and inclusion of all important serotypes/genotypes
In vivo expression & immuno-proteomics
Epitope mapping Reverse vaccinology DIVA vaccines?
Approaches for the Identification of Protective Antigens in Fish Vaccine Development
Case Study 1: Whole cell vaccineRainbow Trout Fry Syndrome (RTFS)-caused by Flavobacterium psychrophium
Need a vaccine that protects against the many different field isolates BUT…-difficult because F. psychrophilum very heterogeneous-fry are susceptible to infection so necessary to develop immersion or oral vaccine to provide protection at small size
Rowena Hoare, Thao Ngo, Kerry Bartie, Sung-Ju Jung, Alexandra Adams
Species identification
Biochemical tests
Antibiotic susceptibility testing: disc diffusion, MIC
Serotyping
Genetic characterisation
CHARACTERISATION
Case Study 2: Recombinant vaccine Aeromonas hydrophila
• Gram negative, opportunistic bacterium• Affects variety of fish species world wide• Difficult to develop a vaccine because of
antigenic diversity
• Immunoproteomics approach taken after growing bacteria under different
conditions
Outer membrane profiles of different
A. hydrophila isolates
VACCINE DEVELOPMENT
Virulence studiesVirulence studies(Artificial infection)
AEROMONAS HYDROPHILA (14 STRAINS)
Immunological Analysis (Antibody response)
Protein profile analysis bacteria grown in vitro/in vivo)
Identification of common potential antigens by 2D electrohoresis and WB
Recombinant vaccine production
Analysing the protection of antigen in fish against A. hydrophila
CUMULATIVE PERCENTAGE MORTALITY OF CARP FOLLOWING VACCINATION AND CHALLENGE-protection against challenge by different A. hydrophila isolates
98140
Fish Nodavirus Infects the central nervous system of
fish (eg sea bass, sea bream) Small (25-34 nm) icosahedral, single
stranded viruses with positive sense RNA genome
CASE STUDY 3 - Epitope Mapping
Costa, J.Z.; A. Adams; J.E. Bron; K.D. Thompson; W.G. Starkey and R.H. Richards Identification of B-cell epitopes on the betanodavirus capsid protein Journal of Fish Diseases 30 (7), pp 419-426, 2007
MVRKGEKKLAKPPTTKAANPQPRRRANNRRRSNRTDAPVSKASTVTGFGRGTNDVHLSGMSRISQAVLPAGTGTDGYVVVDATIVPDLLPRLGHAARIFQRYAVETLEFEQPMCPANTGGGYVAGFLPDPTDNDHTFDALQATRGAVVAKWWESRTVRPQYTRTLLWTSSGKEQRLTSPGRLILLCVGNNTDVVNVSVLCRSVRLSVPSLETPEETTAPIMTQGSLYNDSLSTNDFKSILLGSTPLDIAPDGAVFQLDRPLSIDYSLGTGDVDRAVYWHLKKFAGNAGTPAGWFRWGIWDNFNKTFTDGVAYYSDEQPRQILLPVGTVCTRVDSEN
Betanodavirus coat protein sequenceBetanodavirus coat protein sequence
MVRKGEKKLAKPPTTKAANPQPRRRANNRRRSNRTDAPVSKASTVTGFGRGTNDVHLSGMSRISQAVLPAGTGTDGYVVVDA-- Pep 1 --- -- Pep 2 -- -- Pep 3 --- -- Pep 4 --- -- Pep 5 --- -- Pep 6 --- -- Pep 7 --- Overlapping peptidesOverlapping peptides
The peptides are the linked to fluorescent beads
Each bead is slightly different and can be identified
Epitope Mapping
PepScanPepScan
Antibodies were incubated with the Antibodies were incubated with the bead-peptidebead-peptide
Bio-Plex system Bio-Plex system
Samples were read with the dual laser set of the Bio-Plex Samples were read with the dual laser set of the Bio-Plex systemsystem
Data exported to Data exported to Excell and Excell and analysedanalysed
Synthetic peptides were coupled to the Synthetic peptides were coupled to the fluorescent beadsfluorescent beads
Bead-peptide-Ab was incubated with Bead-peptide-Ab was incubated with reporter molecule (ab conjugated with reporter molecule (ab conjugated with
PE)PE)
0
250
500750
1000
1250
1500
M F
IPolyclonal Antibodies
0500
1000150020002500300035004000
M F
I
5G10 3B10 4A12 4C3
0
500
1000
1500
2000
2500
M F
I
SB 1 SB2 SB3 SB4 SB7 SB9 SB10 SB15 SB17
Mouse, rabbit and Mouse, rabbit and fish ab recognised fish ab recognised
peptide 20peptide 20
Peptide 3 is Peptide 3 is recognised just recognised just by mouse and by mouse and
rabbit rabbit
All species reveal high recognition of the region between peptide 19-21
Sea bass has high binding to peptides
15-16, 10 and 1
Epitope Mapping Results Amino acid sequence
of the ‘epitope’ (part of the molecule) that binds to Nodavirus-specific fish antibody
Region 191-202 is the Region 191-202 is the major immunogenic major immunogenic domain for Nodavirusdomain for Nodavirus
-relies on the combined use of immunological and genomic information to identify relevant protein antigens
Cellular immunity: identification of the epitopes recognized by CD4+ T cell or CD8+ T cells can be utilized in ‘‘reverse’’ as a tool to identify new antigensCarbohydrate antigens?
CASE STUDY 4: Reverse Vaccinology
UOS: Sean Monaghan, Carol McNair, Randolph Richards, James
Bron & Sandra Adams
CommercialisationRoute from research to commercialisation can be long and expensive
Many vaccines developed through research but not taken forward or ‘stuck in the pipeline’-this needs to be addressed.
Conclusions and challenges Potential for development of novel rapid diagnostic
tests for lab and field use Many methods for vaccine development, but very
difficult for parasite diseases Still challenges e.g. understanding mucosal
immunity Route from research to commercialisation can be
long and expensive
Final thoughts Climate change will affect the movement and spread of
diseases in the aquatic environment – need relevant rapid tests and vaccines in place.
Not possible to develop vaccines against all diseases. In some cases vaccines too expensive to use Thus, alternatives to vaccines also need to be considered so
that antibiotic and chemical usage does not increase. Continued education and training is also important -some
regions of the world do not currently have wide acceptance of the use of vaccines as a fish health control method.
TAcknowledgementsAll involved in case studies
Recommended