Telit2market No 6-11 English_

Preview:

DESCRIPTION

Telit newsletter June 2011

Citation preview

Telit Communications PLC I telit2market international I Issue 06 I May 2011 I www.telit.com

ISSUE

06 11

telitTelit World Customer Applications >> 57

2marketThe Telit m2m MagazineDeutsche Telekom International m2m Partner Portal >> 126

Beecham Research Towards Internet Everywhere >> 110

Telits Motorola M2M Acquisition A Further Success Gene > 12 >

Innovation and Passion: The Basis for Successby Oozi Cats >> 04

Interviews with: Reports by:Korean Communications Commission >> 38 KT, Korea >> 42 Magneti Marelli, Italy >> 104 China Telecom >> 106 Connected Development, USA >> 112 Robert Madelin, European Commission >> 92 Antonio Calmon, Kaitech Consulting and Flavio Sakai, Continental Brazil >> 95 Prof. Dr. Axel Sikora, DHBW Lrrach, Germany >> 99 Dr. Roman Friedrich, Booz & Company, Europe >> 102

2

06I11 CONTENT03 TELITInTro Chicco Testa, Chairman of the Board Telit Communications PLC Oozi Cats, CEO Telit Communications PLC Alexander Sator, Board of Directors >> Most companies would confidently claim Telit Communications PLC portfolio to have their product control, regardless of whether underYossi Moscovitz, COO Telit Communications PLC they provide products or services. We believe, however, that most companies Dominikus Hierl, dont knowTelit Communicationsall, which CMO their portfolio at PLC probably sounds rather odd, but its true. Gideon Rogovsky, CEO Telit Wireless Solutions Israel First of all, lets think about what a product actually is. People would usually consider a14 TELITcompETEncE product to be something a company manufactures, processes, or refines and then goes R&D Challenge and Chance on to sell for a profit, thereby contributing to Automotive R&D Team increase the corporate value. And in this 2011 Telit Quality indeed respect, companies do Challengeknow their The Telit well. After all, they products quite Technical Forum have sales teams, product and service management, key account organizations, and they under20 TELITproducTs take market research, supply chain analysis, costing and much more. direct Leading Change through The departments New Product Development portfolio involved in the product research and development, purchasing, pro Re-evolution in Remote Control duction, sales make up a companys core via GSM functions. These departments also have the Cellular Product Range Cellular Product Range MOT by Telit The New Telit ISM-Band Product Family The Telit Combined Wireless Offer for the Internet of Things GPRS to Wireless M-Bus and Universal ISM Gateway Short Range Products

TELITLIvIng

TELIT2MArKET 06|11

44 TELITgLobaL Telit EMEA: Telit Communications Year in a Nutshell Telit North America Update Telit Latin America: Blossom the Seeds of Success Telit APAC Update most members sitting on the board. So, yes, companies do take their product portfolio seriously; in fact, theres nothing a company 48 TELITgrEEn takes more seriously than its product port Tracking Imperial Eagles in the Balkans folio. That is, if youre looking at a product from this traditional point of view.

116 TELITsaLEs Telits Sales Force Two is Better than One when Talking about Customer Focus

118 TELITcompETEncEcEnTEremissions Competence Centers Telit or when we reward them for contributing to apprenticeship programs. Technology Evolution and the And, of course, when communication crises Challenges of LTE Module Integration develop into company crises and pose real threat to corporate value.

50 TELITworLdBut you can also take another perspective m2m Connectivity for Elevators and consider all that a company generates as Going Wireless The Future of GSM output to be its product. From this perspecTechnology in the Metering Market tive, a mechanical engineering companys Customer include machines, the waste portfolio would Applications water generated during the production process and even the apprentices under training. 92 TELITExpErTTaLk And, of course, communication. Particularly Interview Its Robert Madelin, communication.withan output that no comInformation Society and Media pany can avoid. (European Commission) Interview with Antonio Calmon, Fromproducttooutput Kaitech Consulting sociopolitical perFrom an economic and and Flavio Sakai, Continental Brazil spective, this does indeed make sense and is reflected in processes and structures for Interview with Prof. Dr. Axel Sikora, instance, when we talkBaden-WrttemDuale Hochschule about companies financial responsibilities for their CO 2 berg, Germany Interview with Dr. Roman Friedrich, Booz & Co. GmbH

122 TELITprEssNowadays, it is essential that companies Global Communication for a focus on their output. Long gone are the days Global Brand when customers, employees, partners, NGOs, Successful Communication governments, the financial community and through all Channels the media were only interested in a companys products in the traditional sense. When it comes to evaluating a company, even in 126 TELITparTnErshIps economic terms, greater importance is now Deutsche Telekom launches being attached to its entire output, especially International m2m Partner Portal to its communication. m2m Solution Factory Successful Networking with Deutsche companies It is therefore high time that Telekom Sprint is the One Trusted Partner move from product management to output for m2m management. Essentially, this means that they need to manage all elements of their output portfolio proactively and profession130 TELITLIvIng ally and view them as core functions that Treat Communication as a Core drive corporate value. Product

104TELITmarkET Holistic Vision for Sustainable Mobility Facilitating Low-carbon Economy through The Internet of Things Towards Internet Everywhere Whats driving Growth in m2m for 2011 and beyond?

IMPrINT telit2market: The global magazine for clients and partners of Telit Wireless Solutions Published by: Oozi Cats, CEO Telit Communications PLC Chief Editor: Alexander Bufalino, VP Global Marketing Concept and Design: Pantos Werbeagentur GmbH, www.pantos.de Copyright: by Telit Communications S.p.A. Circulation: 67,000 annual reader Service: TelitToMarket@telit.com

38 TELITsTory Gearing Up Towards a Smart Environment Service Enablement Services: Catalyst for Change in m2m An Outline of the m2m Business and Strategy at KT

115 TELITdIsTrIbuTIon Telit Around The World

EMEA Telit Communications S.p.A. Via Stazione di Prosecco, 5/B, 34010 Sgonico (Trieste), Italy Ph: + 39 040 4192 200, Fax: +39 040 4192 289 TelitToMarket@telit.com, www.telit.com

North America Telit Wireless Solutions Inc. 3131 RDU Center Drive, Suite 135, Morrisville, NC 27560, USA Ph: +1 888 846 9773, Fax: +1 888 846 9774 northamerica@telit.com, www.telit.com

Latin America Telit Wireless Solutions Inc. Rua Cunha Gago, 700 cj 81, Pinheiros, So Paulo SP, 05421001, Brazil Ph: +55 11 2679 4654, Fax: +55 11 2679 4654 latinamerica@telit.com, www.telit.com

APAC Telit Wireless Solutions Co. Ltd., APAC 12th floor, Shinyoung Securities Building, 34-12, Yeouido-dong, Yeongdeungpo-gu Seoul, 150-884, Korea Ph: +82 2 368 4600, Fax: +82 2 368 4606 TelitAPAC@telit.com, www.telit.com

TELIT2MARKET 06|11

TELITINTRO

3

+++News+++Telit introduces worldwide smallest 3.75G penta-band module for industrial and consumer applications +++ RedtailTelematicstapsTelitforautomotiveassettracking+++PomdevicesmHealthsolutionSonambaconnects seniorstocaregiversusingTelitmodule+++JanusRemoteCommunicationsannouncesPTCRBcertificationfor theirnewGSM/GPRSPlug-InTerminus +++ TelitcompletesacquisitionofMotorolaSolutionsm2mmodules businessunit +++ Telitsfuture-proofHEmoduleseriesoffersextensivefunctionality +++ Telitdevelopstesting platformforeCALLapplications +++ WorldssmallestGSM/GPRSmoduleTelitsGE865-QUADinNAVIGON's70 PremiumLiveembedded +++ TelitlaunchesworldsfirstOnlineTechnicalSupportForumform2m +++ Telitm2m modulepowersnewCDMAterminalfromJanusremotecommunications +++ CoyoteSystemexpandsitsuseofthe worldssmallestGSM/GPRSmodule +++ Telitsupportssmartmeteringinitiativeswithenergy-efficient,wireless M-Busmodule +++ TelitexpandsitsportfoliowithmodulesfirsttimeusingLCCcastellationpackaging +++ New Walsh Wireless usage-based car insurance device fueled by Telit cellular module +++ Telit starts to distribute directlyinGauteng,SouthAfrica +++ Telitsgloballycompatible3GCellularModuleearnscertificationonAT&Ts NationwideWirelessNetwork +++ TelittechnologycertifiedtoconnectsmartdevicesovertheVerizonwireless network +++ TelitandTobehavestruckadealontheproductionofthesmallesttrackingdeviceintheworld +++

Dear Reader, 2010 has been a year of recovery for the global economy, and the m2m market was no exception. Within this context, we have maintained focus on continued organic revenue growth which we have increased by 48.2% over the 2009 mark with significant improvement in operating and net profitability levels, resulting in net profit of $7.6 million. The transfer of manufacturing to China was substantially concluded by the beginning of 2010 and provided us with the competitiveness and flexibility needed to support continued revenue growth and increase in market share. The m2m market is growing fast and continuously. New segments are regularly emerging and existing ones expanding; new application areas surface requiring innovative technologies, and new technical possibilities are bringing additional applications in their wake. Telit can and will continue to rise to the demands from this permanent cycle. Our investments in research and development, production and quality assurance will continue in the future to secure the innovative power and strong performance that are distinguishing features of a successful global player. We expect to maintain organic growth in addition to growth expected from the acquisition of Motorolas m2m business unit, completed in Q1 2011 and which should enable us to improve our operating and net profit margins beyond the 2010 levels. These factors are all underpinned by a further fundamental aspect of our company: a highly motivated, extremely committed team characterized by outstanding loyalty and reliability. Telit has from the outset been built on the pillar that its human capital represents one of its most decisive competitive factors. We look to 2011 and beyond with great excitement as we continue to gain market share in our bid to achieve our strategic goal becoming the number 1 supplier to the m2m market.

Enrico Testa Chairman of the Board Telit Communications PLC

flexibility

e ormancerforcom tronovaterf owstrong p mance s inng p ive p e r ower innovative pgrowthss competitiveneted team

ted team highly motiva

venes i y

growth

4

TELITINTRO

TELIT2MARKET 06|11

INNOVATIONANDPASSION:THEBASISFORSUCCESS.

Oozi Cats, CEO Telit Communications PLC

>> Welcometothe6thissueoftelit2market. I am happy to report about an important strategic milestone that depicts the impressive development of Telit during thepastfewyearsandatthesametime representstheimportantbasisforTelit's successfulfuture:thetake-overofm2m modules from Motorola Solutions and theircompleteintegrationintotheTelit productandperformancerange.

Marketshare2009

Marketshare2010

Sagem 2,9% Enfora 5,0% SIM 4,2%

Others 16,4 Motorola m2m 4,8% Telit 12,4%

Rest of market 78%

Telit 22%

17,2%Sierra Wireless 26,3 Cinterion 28%

Source: Beecham Research, August 2010

Source: Own Research, August 2010

With the acquisition of the m2m division of Motorola, Telit now owns a market share of approximately 22% according to the latest market studies conducted by Beecham Research, determined based on values as of December 31, 2010. Consequently, Telit is part of the three global leaders on the m2m market, jointly accounting for an estimated market share of 70%. This impressively increased market significance is an important prerequisite for the successful implementation of our plans to boost growth on the m2m market in the future. We not only achieve noticeable synergy effects with respect to our cost structure, but also possess extensive research and development capacities, allowing us to offer our customers a broader product portfolio and more comprehensive support for the long-term. In other words, the role of Telit on the m2m market is expected to gain further significance during the next few years. First, however, I would like to address a number of other important developments and events that took place at Telit during the past few months.

TELIT2MARKET 06|11

TELITINTRO

5

Revenues($mil)199.5(*) 200 180 160 140 120 100 80 60 40 22.8 20 0 2005 2006 2007 2008 2009 2010 2011 37.8 88.8 86.9 71.5 131.7

(*) Market expectation based on analysts' forecast (April 2011)

ModulesRevenue

li Te

4 t+

8%

Strong past. Even stronger future. Contrary to the global decline in the m2m industry, we ended 2008-9 on a positive note with 24% growth, creating a solid base for 2010 with sales of $132 million representing organic growth of 48%. And a continuing organic growth is what we strive for the next years, additional to growth that will come from acquisitions. Offering services is another important strategic step for Telit. The continuous corporate growth throughout the past years helped Telit achieve the critical size that allows us to assume a significant role also in this segment. The quantity of sold modules and as a result the number of cellular devices respectively of subscribers is now large enough to make the cooperation very lucrative for mobile network operators. Telit will become a very interesting player in this sector, being able to offer connectivity as well as backend services and value added services such as remote network management and FOTA in the future.

Setting standards with successful products.January 2010

M ellular m2mC

Mar ke odules

% t+20,2

Our products are the main pillar of our sustainable success. Virtually no other than Source: Beecham Research, August 2010 the m2m market is growing at an equal pace, developing new fields of With respect to the year 2011, we are already application and demanding new product so- able to demonstrate our innovative power lutions. Telit has been effective in facing these with two new modules. The HE863 family new challenges making use of the resulting provides 3.75G wireless data connectivity, opportunities with equal success, driven combining access to HSPA networks, GSM, amongst other things by American and GPRS and EDGE services with a standalone European laws within the scope of climate A-GPS receiver in a compact ball-grid-array protection treaties. With the new ME50 module form factor. One of the great advantages the smallest and most powerful product on is the feature scalability: Many product the wireless M-bus market Telit is setting variants are available, all featuring the same clear standards. Together with the GE865 form factor, available with or without voice module launched in the spring of 2009 still and/or without GPS and in addition with the smallest GSM/GPRS quadband module in different pairs of HSPA band support. With the world Telit is the only company offering the HE910 module, Telit is launching the a perfect product combination for automatic smallest m2m module in the world with meter reading applications, effectively de- 5-band HSPA+ on the market. Full global fending its position as one of the technological coverage is provided in a single package, leaders on the m2m market. eliminating the need to swap the device for

December 2010

6

TELITINTROchannels in 2010. Almost nothing is more valuable for a company than feedback both positive and negative from customers and decision makers to recognize trends and needs, optimize product developments and obtain an adequate feel for changes on the market. Therefore, Telit will continue the intensive use of Twitter, Facebook, LinkedIn etc. extensively, continuously and globally. Successfully global. Globally successful.HE910

TELIT2MARKET 06|11

mandatory in all new cars were already felt in the previous year. This boom continued in 2010 and is expected to persist this year too. Please read page 95 onward for an interesting extensive interview with a specialist about this topic. An additional thrust for the m2m market is expected to emerge in connection with the "fiscal printer law". According to this law, any cash registers issuing receipts to customers must be connected to the government's tax collections agencies. The first devices equipped with Telit modules will be officially commissioned this year. The operating profit of Telit for 2010 was also extremely positive in our fourth region, APAC. In Korea, Telit has been the market leader since 2006. In 2010, it achieved an additional upswing thanks to an initiative from the Korean government. The Korean Communications Commission established the program "m2m Roadmap" aimed at making Korea a leading information and communications technology location. This allowed Telit to intensify its collaboration with the government. Amongst other things, Telit secured the supply of the Korean Meteorological Administration. They are working to provide accurate weather forecasts by means of widely used measuring stations, equipped with the BCM-865 module. The business development in China was extremely positive again in the past year. The sales have doubled compared to 2009. The launch of our GE865-DUAL module on the market, presented to more than 100 engineers within the scope of an event in Shenzhen at the end of the year generated a buzz. With this product, the smallest GSM/GPRS surfacemounted module on the market, Telit offers

GE864-GPS ME50-868

different frequencies and countries, and the LGA package provides an ultra-low profile for your integrated solution and reduces costs, especially for high-volume applications. Added value performances. It is one thing to develop innovative and powerful products. We believe that providing customers with additional support and comprehensive service is also part of a company that strives to be successful in the future and to maintain its leading role on the market. Therefore, Telit has established the Telit Technical Forum last year. It connects system integrators, developers and partner companies around the world on an online platform where everybody can ask questions, discuss them and obtain assistance from Telit global technical support teams. Already more than 700 members in more than 55 countries benefit from this Telit support channel. For us, this demonstrates that the demand for powerful offers exceeding the actual module is very high and constantly rising. Success factor customer focus. The dialog with our customers continues to be and has always been a key aspect of our actions. We are convinced that the dialog with customers, users, prospective clients and any other target groups is one of the essential competitive factors for sustainable success of a company. For this reason, special attention was paid to the expansion of the communication across all important social media

The year promised to be successful for EMEA as early as in the spring of 2010. The commitment of our sales team along with the constant support from our technical and engineering teams helped us make big strides forward. For example, in April we announced the delivery of the two millionth GE864 module. Shortly afterward, the decision was made to equip the new Audi A8 with the Telit module UC864-E-AUTO. These outstanding achievements motivated the entire organization to forge ahead with the development and realization of new, innovative and successful products during the remainder of the year, together with expanding the R&D units in Trieste, Cagliari, Sophia Antipolis, Tel-Aviv and Seoul. This has created an ideal basis for future growth. Furthermore, 2010 was an extremely successful year for our organization in North America. Major growth was achieved mainly in the commercial vehicle telematics, buy-here, paythere and pay-as-you-drive auto insurance markets. Please read the chapter "Telit World" for detailed information about applications our customers Consumer Safety Technology, Danlaw, iMetrik and Redtail developed and successfully launched on the market in this segment. The successful business development of the past years continued in Latin America in 2010. On the one hand, the m2m market continues to grow across all segments and on the other hand, this development was strongly supported especially in Brazil with legal regulations. Positive effects of the automotive law that makes theft prevention

www.telit.com/twitter www.telit.com/facebook www.telit.com/linkedin www.telit.com/xing

www.telit.com/techforum

TELIT2MARKET 06|11

TELITINTROful enhancement of our product portfolio. The continuation of the Motorola products will therefore be guaranteed for as long as their manufacture is feasible from a technical point of view. On the other hand, Telit now boasts a significantly improved R&D qualification. With the integration of the newly added, highly skilled R&D team in Tel Aviv, Telit now has a total of five R&D locations worldwide. This once again emphasizes our focus on the further development of trendsetting cellular and short-range modules. Aiming at the future. We are very well aware of the significance of the acquisition of the Motorola m2m division for Telit as well as the entire m2m market. Our responsibility for the new colleagues is our priority in this context and the rapid integration of the entire team into the Telit family is very important to us. Within this context, the further optimization of our organizational structure therefore plays an essential role. Yossi Moscovitz takes over as the President of Telit Wireless Solutions. In strategic issues he will primarily be supported by Golan Haver, VP m2m Strategy. The responsibility for the areas of Global Quality, Global IT and SAP Integration lies with COO Mathi Gurusamy, who is an experienced and skilled specialist in these fields. The key field of Research and Development will be led by Sandro Spanghero, Global VP R&D. This includes, among other things, the new R&D Center, the company's fifth, located in Tel Aviv and the contribution of Danny Israeli as well as the newly established organizational area "Automotive R&D, headed by Massimiliano Lonzar. As CMO, Dominikus Hierl heads the areas of Sales, Marketing, Global Product Management as well with Telit RF the Short Range division, and as Global VP Mike Ueland in addition to North America is also responsible for the area of Value Added Services. The previous VP Telit APAC, Gideon Rogovsky, now takes over as CEO Telit Wireless Solutions Israel and thus has overall responsibility for the integration of the Motorola m2m division in the Telit organization. All other management positions remain unchanged. So we can guarantee the perfect combination of new spirit and solid continuance. The positive effects on the company's performance are just one aspect. Also in light of our new customers, the smooth transition is our ultimate goal. We want to guarantee the continuing availability of Motorola products, but also convince and inspire them about Telit's innovative capability and efficiency.

7

the perfect module for mobile applications and high-volume manufacturing across all industries in the low unit price segment. To be able to meet the large demand in China in the future and to ensure optimal customer focus, Telit has now established offices in Shenzhen and Shanghai with a total of ten employees. The solidification of our relationship with our manufacturer BYD in China is certainly one of the most strategically relevant aspects. By awarding BYD the "Telit Strategic Supplier 2010 award, the outstanding achievements associated with the development of the production were honored as much as the reliable and mutually successful cooperation. This appreciation was reasonably expressed with a visit from a Telit delegation at the BYD headquarters in early December and the festive conferral of the award during a celebration. Focusing on strengths. The past year has especially shown how much a dynamic market such as the m2m market can change and with which new developments whether technical or of a structural nature it can suddenly generate new situations. This may tempt some enterprises to advance into new sectors and to develop completely new business fields. In contrast, Telit has always been pursuing the clear strategy of focusing on the development and production of modules and offering services that represent a meaningful and especially value adding supplement to these modules. As a result, Telit is the only global player on the m2m market fully focusing on its core competencies, continuing to expand its strengths and as a result standing on a strategically and technically efficient foundation. Our achievements prove that we are on the right track and we will continue to pursue this track consistently and confidently in the future. The recent acquisition of the Motorola m2m division has therefore been a logical step for Telit. On the one hand, it results in a meaning-

Additional noticeable changes are expected on the m2m market in the near future. They are due to technical and demand-related reasons as well as economic, political or even environmental circumstances. We may sense or at least realize early what the future holds, but we cannot predict it accurately. Telit has been very well prepared for new situations in the past. With our new size, our innovative spirit, our passion for new things and not lastly our extensive know-how, we will have the required power to remain one of the most successful m2m enterprises in the future. AtTelitweareveryproudoftheachieteam of seasoned m2m experts, adding their expertise and resources an all operational levels to Telit. Staying true to our product strategy of consistency and long-term product availability, the newly acquired Motorola m2m product portfolio will be continued; product support will be even improved. Telit will invest the necessary resources to make customers using Motorola products in their solution successful in the market for existing and new designs. Telits leverage from the substantially larger business size assists us with regard to managing suppliers and EMS partners, while product certifications are all to be finalized as planned. As the market continues to grow, Telits market share continues to rise. According to market research, in 2010 the total m2m market was about 900 million dollars in size. The combined market share from Telit and Motorola m2m represented approximately 20% of that total. This marks a huge jump from the 12% the year before and gets us very close to our two main competitors presenting strong evidence that we are indeed heading for global leadership in the market. Telit is currently offering the broadest product portfolio in the m2m space, supporting different cellular and short-range wireless technologies for the global markets. In order to create additional growth opportunities for the company, we identified the enhanced value of bundling our first-tier products with relevant services around m2m, enabling customers to implement m2m systems in a much quicker and more efficient way. We are confident that this strategy will give us the push to become the absolute market leader in the global m2m space within a very short time. This new stature in strength translates into additional benefits for all our customers, as we continue to pledge our ever-growing expertise and support capabilities to make them successful in the global market. > I am pleased to announce that Motorolas m2m Solutions division and Telit have united and are now officially operating as one entity. This new structure unites two market leaders in the m2m Wireless Industry serving various vertical markets such as automotive, AMR, security, and others. Together, we are uniquely positioned to provide the m2m market with a full portfolio of modules supporting all cellular wireless technologies: GSM/GPRS, EDGE, CDMA and HSPA. The combined company will operate as Telit Israel with offices in Tel Aviv. Acquiring the Motorola m2m division has brought about a unique opportunity for Telit to open an R&D center in Israel. The Motorola m2m team brings extensive knowledge, experience and professionalism needed to elevate this journey into a success story. As always, our goal is to continue delivering innovative, high-quality products to our current combined markets. To accomplish this, we will adhere to the established product roadmaps for our existing vertical market solutions while simultaneously exploring opportunities to provide customers with additional value for existing and new market segments. We are confident we have done the utmost to ensure our business relations with our partners continue as before. In the event that there are any unforeseen issues after the conclusion of the transition, contingency plans have been put in place which provide for quick matter resolution. We would like to thank you very much for your trust as we look forward to continuing cooperation. About Motorola Motorola, Inc. has been at the forefront of communication inventions for over 80 years and is leading a wave of innovations that enables people, government

and enterprises to be more connected. Motorolas wide-ranging portfolio of technologies and solutions span a range from consumer wireless handsets and in-home digital entertainment devices to government and public safety mission-critical systems and enterprise mobility products worldwide. In 2009, Motorola (NYSE: MOT) generated revenues of US $22 billion. About Motorola m2m Solutions Motorola m2m Solutions, part of the greater Motorola, specializes in the design, development, integration, evaluation, and deployment of m2m applications worldwide, serving largescale customers such as: Continental, BMW, Harman-Becker Automotive, Tyco Safety Products, Essence Security and SmartSync Smart Grid Intelligence. Motorolas m2m division has been considered industry leader with over 12 years experience in m2m product development and a reputation of long standing partnerships with carriers worldwide, enabling quicker expedition of approvals by AT&T, Verizon, T-Mobile, Telefonica, Vodafone, Orange, and many others. In addition, the organization brings over 9 years of experience in the automotive arena working with 12 automotive manufacturers including Continental, BMW, and Volvo. Telit will continue working hard to earn its customers business, and I want to personally thank you for your loyalty and support. I would like also to use this opportunity to welcome all the new employees that joined Telit Israel and to wish them a long, rewarding, and fruitful career at Telit. > Talking about technology is always

Sandro Spanghero, global VP R&D Telit Communications PlC

challenging and sometimes dangerous but for an IT company it is a mandatory and obvious requirement. At Telit we are accustomed to analyzing mature and new technologies using a particular magnifying glass: the requirements of m2m.Looking at communication technologies from this point of view it is possible to perceive some differentiation factors that are not present in consumer products. An example of this peculiarity pertains to the GSM/GPRS technology. It is very well known that this communication standard specified in the 1980s is so fully mature that it begs the question: why continue investing in it? This rationale whereas quite legitimate for consumer products with the exception of some emerging countries is not applicable to our market segment. Even now in 2011, more than 20 years after the market introduction of GSM technology, the m2m world finds itself focusing substantial effort in 2/2.5G devices and applications, with carriers pledging to continue maintaining their existing infrastructure for this generation of cellular technology for years and years to come. And this

is the reason why Telit started the development of the so called V2 platform in 2008, launching the first product in that platform in 2009, later completing the migration of the roadmap and also adding new products based on the GL865 form factor. This platform will now extend the life of GPRS products in the Telit portfolio to GE864-QUAD 2016 and beyond. Automotive V2 But the implementation of a new platform is not only motivated by new component introduction, it is much more than that. As per our strategy, V2 products have maintained all features present in our previous platforms while several new features and optimizations that were not possible to be offered in the previous Lite platform have been added in V2. One such new feature that immediately comes to mind is idle current consumption, which is a very relevant parameter for several m2m applications: this value has been reduced by about 40%. Another is the implementation of Release 4 of the 3GPP protocol

layer which imposes much more severe control over the emitted power from the mobile station. Relevant developments, specific for the automotive grade products based on the V2 platform include the implementation of an in-band modem feature subject of a specific white paper available in the Telit web site, and VDA certification, level 2A. The pie diagram in Figure 1 shows the results of the different audio parameters measured in a controlled test environment using standard components for the audio path and using only the echo cancellation parameters embedded into the GE864 Quad Automotive V2. These two features will allow customers to develop low cost e-call applications without using sophisticated external components providing the required flexibility for tuning the application to successfully pass stringent automotive industry requirements. However, these very important activities in GPRS technology are not in any way compromising development work related to 3G platforms. It is clear that whereas GPRS is still the main technology used by the m2m market, the trend is that in the next five years this will

Figure 1: VDA -2A Audio test results

Figure 2: Module shipment by technology

(Source: ABI Research)

TELIT2MARKET 06|11

TELITCOMPETENCE

15

HE863

HE910 world's smallest 5-band HSPA+ module.

market introduction of the new HE863 variants, a new HSPA Automotive platform that will be introduced in 2013 an updated EVDO product mainly for US market and a new low-cost CDMA platform for global markets. In parallel the R&D team in Trieste, Italy has from the beginning of 2010 been involved in the alignment of the Telit AT interface and features across the different cellular platforms 2G and 3G, and in the development of the new HE910, that will once again, become the markets smallest module in its category. In 2011 Telit will definitely confirm its leadership not only in 2.5G product offerings but also in 3G and 3G+ as a result of its long term investments and commitment. A different R&D approach is required for short range communications devices. Telit has two groups working with this technology area. The first is located in Sophia Antipolis, France. This team because of its platform expertise has responsibility over short range products using ZigBee, M-Bus, IEEE802.15.2, and our proprietary protocol. The other team, located in Cagliari, Italy, is in charge of the work to integrate short range and cellular technologies into applications and gateways which bridge local short range to cellular. These two teams will be integrated into sharing responsibility for offering complete solutions from sensor to internet. change. As can be gleaned from the ABI Research graph on shipments by technology in Figure 2, GPRS volumes remain almost flat in the next five years, while market growth comes from different technologies, mainly WCDMA but also EVDO and then LTE. It is clear that 3Gs real market introduction will be propelled by specific segments such as automotive where Telit is already supplying the UC864 E Auto and the UC864 AWS Auto for European and North America markets respectively but many others will follow. For this reason Telit R&D investments into 3G platforms are growing, already representing more than 50% of the total departmental budget. The R&D team located in Seoul, Korea, that focused from the beginning on WCDMA and CDMA products is in charge of maintaining the UC864 and CC864 platforms, but also the Because there are many aspects in the deployment and implementation of communication systems which make them much more complex than the simple cellular, requiring deep understanding of different technologies from the device as well as the network point of view and also in this case the investments that Telit continues its commitment, reaffirming its willingness to continue playing as the leader in m2m. > A new team focused on the automotive market has been created in the Telit organization with the purpose of enhancing support and services targeted at this strategic segment. This new team will report to the global R&D organization and will be focused on the various aspects of compliance with the stringent automotive market requirements.

Different groups inside this new department will provide their support to the different phases of development. One group will be focused on field testing and software validation with particular attention to those features demanded by automotive integrators in addition to a much deeper analysis of interoperability of the modules with the different network operators. Another group will be focused on the so called Reliability Validation which include PPAP testing and verification, HALT testing and so on. A third group will offer first and second level of technical support and will respond directly to our automotive customers developers to support integrators

in the design phase. Finally, a fourth group will be focused on all issues related to the interactions among different functions inside the company including R&D, purchasing, quality, test engineering, and others. The aim of this group will be to schedule and harmonize activities of these different departments managing toward total satisfaction in response to the demands coming from these customers. This is just the beginning. Most probably, in the 2012 issue of the magazine, we will be reporting back to you the results and experiences in a much more detailed article. > Telits quality challenge for 2011 is to prepare and implement an adequate approach to support the companys business growth scenario. By the middle of 2010 it was clear that Telit was looking at a growth trend to result in a definite increase in the complexity of operations. To support this, the quality department is implementing new procedures and rules based on simplicity and clarity with the objective of establishing relationships among the various company processes and to proactively align each resource involved in business processes. This means that in the near future, changes will take place on how functions approach their activities so as to establish new workflows characterized by open-mindedness and creative attitudes.The Telit quality department currently implements an interdisciplinary self-improving program to make all corporate processes more adaptive, optimizing all efforts, and keeping them synchronized towards the global mission of our m2m business. A definition that encapsulates this concept well states that quality is the on-going process of building and sustaining relationships by assessing, anticipating, and fulfilling stated and implied needs, where such needs belong to five different players. The most important one is the market and customer who expects products and services delivered with all needed requirements, on time and well supported. For such mission, the following Telit functional areas are involved: Top management creating a vision for the company, providing guidance to the busi-

ness, addressing the mission statements with sustainability and profitability requirements; Research and Development continuously evolving the companys technology portfolio, designing products and services to be more competitive; Operations manufacturing m2m devices free of defects, in compliance with requirements from different market segments particularly smart-metering and automotive; Sales providing Telit customers with high quality technology offerings and solutions customized to fit specific and different requirements.

Intellectual Property, and standardization, which are very close to top managements vision statement definition, and have the ability to inject innovation in all company processes; Long-term project planning, also used for allowing participation in public bid calls. Long term projects are developed according to the companys business vision and are designed to support Research and Development strengthen its know-how assets; Quality audit modeling, as applied with customers and markets, is also used in support of the execution started after the above mentioned public bid calls applications. Project planning in the framework of public bid calls is quite a relevant asset of to the quality mission, which goes a long way to ensure competitiveness for the companys business. Over the past five years, there have been many success stories with different projects developed also with the European Community. These include the Emily and Euridice projects, with MiSE the Italian Ministero dello Sviluppo Economico that was fundamental in the establishment of the Telit R&D Center in Cagliari; the effort with the local Friuli Venezia Giulia Region administration which strengthened the knowledge assets of Telits most important R&D Center in Trieste. In order to address our expected growth, an important new R&D project is ready to be implemented, with activities set for the next

Figure 1: Telit macro-areas

An efficient relationship among these functions requires a dynamic approach both fluid and forthright. In such a multi-articulated scenario, quality has to balance the different roles with assignments of procedures and rules to allow them to cope with the increased complexity. In this scope quality manages through different methods:

18

TELITCOMPETENCE

TELIT2MARKET 06|11

Top management Business Vision and Company mission Creativity Intellectual Assets

Design FMEA, 8D; International Material Data System (IMDS); Reliability and Failure analysis; and lot traceability. Telit quality is not just about inspection, process control, material selection. It covers the all elements involved in delivering products and services and in order to achieve the 2011 challenge, quality intends to strengthen the implementation of design for manufacturing (DFM) to simplify the manufacturing process, minimizing risk.

growth Know-howProcedure and Proces Control Sales and Customers marketFigure 2: Quality growth driven a challenge for Telit

Standard and Qualification Compliance R&D and operation

four years. So from qualitys responsibility and perspective the function will continue to observe and provide measurements and feedback to better steer the fantastic growing business of m2m implementing procedures for employees, customers, and external resources, with the main objective of changing the work culture accordingly. Telits quality philosophy is to facilitate the adoption of a responsible and active approach, based on the premise that whoever is directly involved with an issue holds the most in-depth knowledge of said issue and is in the best position to produce the best resolution to it. In support to its mission, Telit quality has consolidated quality assets that have been in effect for a long time, and that are continuously improved: ISO 9001 certification extended to the corporate level. In particular with respect to R&D laboratories ensuring that R&D labs, located in different areas and devoted to different technology segments, apply the same rules and methods in their activities; ISO 14001 certification in effect at the Trieste facility covering compliance with environmental and Green practices for eco-friendly design and manufacturing; Quality uniformity which aims to maintain production from all contract manufacturers at equivalent quality levels. This is assured by continuous and constant control on production processes, with resident quality teams,

and by quality procedures and methods that ensure that components, manufacturing processes, testing and programming phases are the same in all manufacturing plants located in the different geographical areas. Most of Telits contract manufacturers are compliant with automotive grade manufacturing requirements as established by the ISO TS 16949 certification process. That dovetails with Telit R&Ds design processes for automotive segment, with implementation of the Production Part Approval Process (PPAP); Process and

Telit has also recently added another achievement to its competitiveness arsenal: accreditation according to the Annex V R&TTE Directive of R&D testing laboratories with respect to measurement instruments and methods. Such accreditation allows Telit quality to autonomously issue CE declaration of conformity resulting from our own R&D lab measurement reports. This achievement is absolutely important to qualify the company, and its ability to deploy to market innovative and competitive m2m technologies to be used by the Telit customers in their successful business. > Services >> Technical Forum and register. Attend to the discussions and contribute your valuable experience to the growth of the m2m community. > The idea to create a Technical Forum

and to publish it on the Telit web site had been in our minds for a long time. The outcome we were looking for was to put in contact individuals who live daily in the m2m world to share experiences, to discuss open or already closed issues to enrich the development process, to gather ideas and needs for integration of new applications based on the technologies that Telit provides, to drive new integrators and developers toward simpler integration processes, and why not to celebrate the successes of our customers.This dream finally became a reality in 2010. Telit launched the Technical Support Forum in October and it has been a great success from the very start. The open forum format offers an invaluable technical knowledge database on everything concerning m2m. The most viewed articles range from general discussions like Transmission of DTMF tones to specific challenges such as Sending SMS while keeping an active socket connection.

www.telit.com/techforum

20

TELITPrOduCTs

TELIT2MARKET 06|11

ThRough neW PRoDuCT DeVeloPmenT

leADIng ChAnge

marco Contento, manager, Product management emeA

>> Always on the forefront of technology,

Telit expands its portfolio with the introduction of new 3.5g modules in BgA packages, and 2.5g modules in lCC castellation.The development of new modules, with different mounting technologies and featuring a new cellular technology, is a dynamic response to market demand and to the availability of new chipsets. Applications not feasible only a few years ago have become common place thanks in part to advances in size reduction and package design. From car telematics and fleet management to intelligent metering and consumer applications, each segment imposes its own set of individual demands on the modules electronic package. However, despite the fact that the silicon vendors continue increasing the level of integration of silicon chip technologies, it will be some time before the latest 3.5G and LTE wireless technologies can be integrated in size and packaging comparable to those of the current 2.5G products. In this context, Telit has developed three new products the HE863, the HE910 and the GL865-DUAL. The HE863 The HE863 module enables highvolume m2m applications with advanced capabilities leveraging the 3G HSPA technology while minimizing development time. With dimensions of only 31.4 x 41.4 x 2.9 millimeters, the HE863 is the first Telit 3G module to be offered in the BGA form factor, suitable for medium to high volume applications. The HE863 features a 3GPP Release 6 stack, with HSPA connectivity in two bands, and with throughput of 7.2Mbps in

downlink and 5.7Mbps in uplink. It also supports quad-band GSM / GPRS and EDGE class 33, in 850, 900, 1800, and 1900MHz. The HE863 will be offered in three regional variants, with different combinations of 3G bands and regulatory approvals depending on the region. The product, which features a 6Mbps high-speed serial port, as well as a high speed USB 2.0 port, will be available in data-only and /or data, voice, standalone and assisted GPS. The HE910 The HE910, the world's smallest LGA m2m module featuring 5-band HSPA+, is the perfect 28,2mm solution for consumer applications requiring wireless connectivity on the move. Thanks to support for all five 3G network bands (i.e. 850, 900, 1700, 1900, and 2100 MHz) the HE910 provides mobility virtually without borders. Furthermore, the HE910 includes features such as HSDPA 14.4 Mbps (Cat 10), HSUPA 5.7 Mbps (Cat 6) and Quad-band EGPRS Class 33 (i.e. 850, 900, 1800, and 1900 MHz). Due to its low profile LGA package and advanced connectivity features, the HE910 is ideally suited for mobile computing devices such as PDAs, smart-phones, tablet PCs, and consumer electronics in general, both for business and personal use. The HE910 can also optionally be provided with integrated high-sensitivity AGPS for indoor fixes and simultaneous GPS with voice and data. The GL865 The GL865-DUAL, which is the first Telit 2.5 module in LCC (Leadless Chip Carrier) castellation packaging,

has been introduced to expand the offering of 2.5G products in surface-mount technology but in different packaging. Its ultra-small form factor makes this module perfect for mobile applications scaling from low to high volumes across all industries. Key application areas include battery powered devices for medical monitoring equipment, for tracking of people, animals and assets. The GL865-DUAL module (LCC castellation package technology) is a surface-mount component, having metalized pads on all sides of the package. This kind of packaging is ideally suited for simple and low-cost applications based on four-Layer PCBs. Moreover, with the option for manual soldering and removal, it can also serve niche applications with low production volumes. For customers with highly integrated and complex applications, Telit offers this new product as part of its broad family of Ball Grid Array (BGA) m2m modules. The pins of the BGA package are arranged in a grid pattern on the entire lower surface of the module, thus providing a greater number of pins making the BGA package highly efficient in terms of size to number of inputs and outputs. The introduction of this product is an important step for Telits portfolio development which now includes LCC castellation packaging alongside our successful and well-known BGA packaging. LCC and BGA packaging complement each other as they serve different market segments. > In the last few years one of the most successful applications in the m2m market has been the remote control of devices over gSm and this kind of application will likely continue its strong growth in the years ahead. Remote control is usually accomplished by sending commands to a remote module through DTmF tones or SmS. These commands allow remote driving of actuators and the reading of sensors status.

The newly released DTMF decoder in Telit modules allows developers to change their traditional approach when working with GSM remote control systems. Although a TCP connection mode is also available this article will focus on the DTMF solution. Traditional approach The traditional way to implement remote control via GSM using DTMF tones typically involves the use of a microcontroller (MCU), a GSM module and a hardware DTMF decoder. (Figure 1) When DTMF tones are employed to send remote commands, the audio output

from the GSM module is connected to the DTMF receiver which provides decoded tones to the MCU. The MCU in receipt of this information recognizes the command and takes the appropriate action or sequence of actions. The Achilles heel of this approach is the need for several components to execute even the simplest command. Telits approach The aim of the Telit approach is to simplify the system by more fully utilizing the powerful embedded features of the GSM module while at the same time giving new degrees of freedom to the developer. (Figure 2) With this smart use of the Telit module the DTMF receiver and the external microprocessor can be removed leading to a smaller and cheaper implementation. In fact DTMF tones are recognized by the internal decoder embedded in the module without the need of any external device. (Figure 3) Embedded DTMF decoder To access this feature, developers can select between python script or event monitor for the software

gSm/gPRS module Power Supply

SIm

AT#eVmonI="DTmFo",0,1,0 AT#eVmonI="DTmFo",0,0,"AT#gPIo=3,1,1" AT#eVmonI="DTmFo",1 AT#enAeVmonI=1Figure 4

DTmF Receiver

I/o

mCuFigure 1

AT#eVmonI="gPIo1",0,1,1 AT#eVmonI="gPIo1",0,2,1 AT#eVmonI="gPIo1",0,3,5 AT#eVmonI="gPIo1",0,0,"AT+CmgF=1;#C

Power Supply

Telit gSm/gPRS module

SIm

mgS=+393468686XyZ,\22gPIo1 on\22" AT#eVmonI="gPIo1",1 AT#enAeVmonI=1Figure 5

I/o

Figure 2

TELIT2MARKET 06|11

TELITPrOduCTs

23

DTmF, S mS

or TCP

implementation. Access to the embedded Python Easy Script gives the developer the ability to program complex control sequences. Using the virtual internal AT serial port, a Python script can be written to receive the asynchronous messages generated by the embedded DTMF decoder, interpret them, make decisions or execute commands. If avoiding software programming is preferred, the user can take advantage of the event monitor. This feature allows a DTMF tone detection to be automatically associated with a specific action at the module by simply sending it an AT configuration command. SMS at run Telit modules also makes available, with no change in hardware configuration, one additional solution: the use of the Embedded SMS AT Run. This feature allows users to run AT commands remotely just by sending an SMS to the module. Responses and errors are sent back by the module via SMS. Two types of messages are available: simple and protected. Protected messages are encrypted with an MD5 hash algorithm. It is important to note that the SMS AT Run feature is also available via TCP where AT commands are sent to the module via TCP/IP. Responses and IP protocol related traffic are redirected via TCP/IP to the device acting as the TCP terminal. Event monitor example Based on a Telit GL865 module a simple 2 IN/2 OUT remote control can be implemented using event monitor for action control. In this sample application the objective is to read the status of the 2 opto-isolated inputs or set the status of the 2 relays. If the user wants to link

the activation of Relay 1 (connected to GPIO3) to the receiving of a DTMF tone equal to 0, the following custom command must be sent to configure the module: AT#EVMONI. Upon detection of a DTMF tone 0, an event will be generated and AT#GPIO command will be executed automatically activating Relay 1. (Figure 4) Contextually the module can be triggered by a HIGH level on GPIO1 and send an SMS to alert the remote application. (Figure 5) > new m2m markets are advancing into intelligent automation systems, innovative solutions, and above all energy efficiency. Interoperability will be a key requirement for certain segments like metering while another target will be to continue increasing network flexibility. In order to build an advanced wireless system it is mandatory that a comprehensive review of priorities be completed to determine the most suitable combination of performance and cost.

With advantages such as longer range, reduced power consumption, lower deployment and operating costs, sub-GHz ISM wireless systems can step in to address important need areas of m2m like metering (water, gas, electricity), lightning control, building automation, irrigation, and tracking or access control. The Telit portfolio in sub-GHz ISM band includes 3 different product families: the LE, ME, and NE. They are based on the same form factor of 26 x 15 x 3 mm with weight of only 1.7 grams, LGA mounting technology (suitable for manual soldering in small volume applications), and full pin-to-pin cross-compatibility guaranteeing flexibility and making possible the re-use of the wireless design in different market segments. All modules include serial RS232 interface, digital and analog

I/O ports allowing easy integration into any application reducing development time and costs. Long battery life is ensured with a standby mode that consumes 1A for wake up on external interrupt (hardware over DTR or software via AT command). When used for remote control applications the best design choice is cyclic wake-up where the module is set to listen periodically to the radio link (with the use of its internal timer) using current of only 3A. Some key characteristics include budget link of up to 123dB (LE50), configurable output power of up to 14dBm, sensitivity in the order of -109dBm (LE50), and extended operating temperature range. Telit started by launching products in the 868MHz frequency and this will be followed by 433MHz and 915MHz variants.

TELIT2MARKET 06|11

TELITPrOduCTsNE50-868

33

For all Telit short-range (SR) module families there is a complementary gateway solution, the GG863-SR which provides the short range wireless network the ability to extend on the IP network. Dedicated demo cases and kits are also available for each family which include all the necessary resources to enable outof-the-box testing of RF performances and others so that the designer can quickly start taking steps towards building a network. Moreover these three product families (ME, LE, and NE) were designed to be pin-to-pin compatible with the Telit ZigBee products, the ZE51-2.4, and the ZE61-2.4 (compliant with ZigBee PRO stack). The LE Module Family is the ideal solution for ultra-low-power and low-latency-time applications requiring point-to-point or multipoint (broadcast) network communication and a simple plug-and-play protocol for RF communications, being a great fit for applications replacing communication over cable. Because of the very low latency time, incoming characters are transmitted to the radio link as they are received on the serial port and collision is avoided with the application of the LBT (listen before talk) feature, while for more advanced network planning, RSSI level measurements can be used as a simple indicator of signal strength. The Star network protocol stack running on the LE module family is a Telit proprietary protocol that can be applied in transparent mode (plug-and-play, minimum latency), in address secured mode (nodes have ID numbers, data can be addressed to a specific node), in telemetry mode, or in download over-the-air mode (remote re-flashing of the modules). This family also

LE50-868

Demo Kit & Development Tools ME50-868

includes a 2.4GHz variant which can be a valuable alternative to ZigBee in applications where a simple communication protocol can be used. The NE module family is based on the Telit proprietary low power mesh protocol, implemented on a cluster-tree network structure. Power management can be achieved on both routers and end nodes with extreme flexibility by setting different synchronous network times, data rates, or message formats. These same parameters also influence network latency providing a high degree of freedom for OEMs to program them according to system requirements. Lowest overall power consumption can be achieved in networks running a regimen of small data volumes transmitted periodically while high data throughput demanding high network data exchange rates cause an increase in power consumption. Auto-repair, auto-association, up to 10-hop routing, and 10,000 device capacity make it easy to integrate complex and stable network solutions. The ME module family is based on the wireless M-bus European standard EN 13757-4 covering data exchange for remote meters (modes S, T, and R) and the EN 13757-5:2008

extension of part 4 which specifies additional routing providing the possibility to extend the range in 868MHz band (modes R2 and Q). At the application level Telit supports AES encryption and is compliant with the Dutch profile NTA8130 and OMS. This module family can integrate any network of devices compliant to the Wireless M-bus standard (parts 4 or 5) including the Telit TinyOne Lite 868MHz module. SR Tools Manager The SR Tools Manager is a unique powerful development environment covering all Telit Short range module families (ME, LE, NE and ZE). It is Windows based and easy to use internally handling most of the complexities of Short Range technology and therefore dramatically reducing time-to-market and TCO. Its purpose is to allow performance of preliminary testing, help during the design phase, assist in deploying the network, and to guarantee network operation and maintenance. Starting with basic features like firmware upgrading, sniffer and packet analyzer, commissioning and configuration of the short range module; and moving up to the more advanced features which include graphic network topology view together with its most important parameters this single tool adds substantial value to the Telit Short Range module offering. The starting version of the tool allows selection of the SR technology and which part of the tool to access, e.g. flashing, management, or analyzer. While using the analyzer it is possible to select the ZigBee channel or Wireless M-bus operating mode and all the captured data packets from the selected source can be saved to a file. The management section is used for sending the modules hexadecimal or ASCII commands and its extremely easy-to-use, while configuration wizard provides quick access to configuration or reading of the SR module registers. > Predicting now the impact that the internet of things (IoT) will have in our lives is not a trivial exercise (who could have predicted the impact of Internet in the early 90s?), but it is safe to state that Smart City will be among the most important applications of the IoT. Following its long term vision and strategy, Telit has been preparing for this new challenge and has put in place a valuable offering to provide its partners with unique competitive advantages.New m2m Wireless Communication Technologies In addition to well established m2m cellular communications where Telit is already playing a leadership role worldwide, short range (SRD) communication technologies much better suited for LAN/HAN application are required to enable the IoT. Among the forerunner technologies, different flavors of the IEEE802.15.4 (e.g. ZigBee, 6LowPAN, etc.) and Wireless M-BUS are establishing themselves with WiFi becoming more adept to providing connectivity to the consumer market through Smart Tabs and dedicated applications (Apps). A common question some in the IoT space are posing pertains to the strength of the make vs.ZigBee Wireless MBus

buy approach for the Short Range communication component of their application. Considering the required level of investments in the design of wireless connectivity for the application the module approach always provides solid advantages whenever the silicon used in the design has a lifecycle time in the range of 3 to 4 years. That is usually the case because of the increased ROI and reduced and predictable total cost of ownership (TCO) due to the full liability of the wireless solution (hardware and software) resting on the module. Moreover, in the case of Telit and the pin2pin multi-technology family approach, a remarkable additional investment reduction can be achieved. Consider as an example, a smart gas meter designed with the Telit ME50-868 (Wireless MBus) and how it can also easily use the pin2pin compatible ZE51 ZigBee variant or the ZE61 ZigBee PRO solution, or yet the new LE50 or NE50 for star or low power mesh architectures available in 433, 868 and 915 MHz. New Tools to deploy and manage complex multi-technology networks

ME50-868 DIP Version

considering the cost of a minimal subscription plus the cellular hardware with required battery provides the immediate answer that an SRD technology LAN/HAN is the cheaper option; however dedicated new software tools able to minimize cost and risk in large scale and efficient SRD network deployment for the full lifecycle of the project (usually 15 to 20 years) are definitive requirements. To this end, Telit has designed a dedicated SRD network tool, adding dramatic value to its offering. The Telit Advantage The Telit competitive advantage is based on the focused strategy to reduce the m2m application TCO by dramatically reducing the required investment and time-to-market. In fact Telit is unique in the wireless solution and module supplier space for providing: 1 Fully owned IPR m2m solutions from cellular to Short Range technologies, all based on the Pin2Pin compatible family approach; 2 Fully-customizable, highly-integrated, cellular and SRD Gateways and Concentrators; 3 A unique SRD network tool for the deployment, operation, and maintenance of large mixed cellular and SRD networks devoted to m2m applications. > The Aarlogic m09/5 is ideal for industrial applications requiring environmental robustness to withstand cold, heat, vibrations, etc. As a gateway, on the WAn side it communicates via gSm and on the short range side it utilizes license-free ISm standards including wireless m-Bus, Zigbee, and RF868/915 mhz covering distances of up to 4000 meters.Round Solutions, a specialist manufacturer in m2m communications, has developed a new industrial printed circuit-board (PCB) especially designed for use under extreme environmental conditions. The AarLogic M09/5 is equipped with this technology and boasts an operational temperature range from -40 to +85 degrees Celsius and because it is populated with SMT components, it is highly vibration resistant. Measuring only 5.64 x 8.45 cm, the board can be used directly in smart metering and smart grid applications with Telit's ME50-868 Wireless M-Bus module. Since the Telit ME50 series is pin-compatible with the ZE family, also ZigBee and Meshbased RF technologies can be addressed with the same hardware design. Alternatively, with the use of the Telit TinyOne family the M09/5 can be made to operate in the license-free radio bands of 868 MHz and 915 MHz (US market). The board's voltage converters were designed for the higher energy consumption of the TinyOne-Pro series. Thus when this product family is used, the board can cover ranges of up to 4km without any hard-ware changes. STK-S4 The AarLogic's GE865 GSM module from Telit works almost regardless of range. An Atmel microcontroller is applied to control the board, supporting the option of Python scripting. The Atmel AtMEGA162 controller, programmable in C and BASIC, allows the development of special applications which is a desirable feature in the fields of remote monitoring and smart metering (e.g. to create a central hub for bulk data transfer). The modules for Wireless M-Bus metering also comply with EN13757 standard and the Open Metering System (OMS). As required for OEM board-level products, this new radio board is equipped with all important inputs and outputs, including serial CMOS interface, power inputs (6 to 32V), and antenna connections. According to Olaf Schfer, Technical Director at Round Solutions, the AarLogic M09/5 allows specific hardware and working prototypes to be developed in a very short time. A complete Round Solutions STK-S4 development environment guarantees a quick and easy development effort. >German-basedFalcomWirelessCommunications,theleadingsupplierofwirelessm2m solutionshasjustintroducedtheROCK,aninnovative, adaptable and standalone tracking device that can be used for both mobile and fixed asset management. The device concept combines the latest quad-band GSM/GPRS technology (Telit GE865) for communication, ahigh-sensitivityGPSreceiverforpositioning, awaterproofcompactcase,anddurableinternalbatterypackforlong-lifeoperationeliminatingtheneedforanexternalpowersource. This is an ideal solution for managing and tracking containers, trailers and high-value assetswherenopowersourceispresent.Many features of the device and the new firmware can be downloaded over-the-air helping you manageyourmobileandfixedassets,provide better customer service, reduce costs and increaseprofits.Anenergyharvestingversion iscurrentlyunderdevelopmentanditwillbe available4Q2011.>Falcomiscurrentlyprovidingseveralkinds of GPS and telematics products responding tomarket demands. The company recently launchedanewvehicletrackingsystem;aspecialversionoftheFalcomAVLdeviceportfolio combining GPS and GLONASS positioning systems with a higher level of reliability for complete telematics functionality. Using quad-bandGSM/GPRStechnology(TelitGE864) for two-way communication, high-capacity Li-Polymerbackup-battery,andhousedina weatherproof plastic case, the device is suitableforawiderangeofmixedindoor/outdoor applications in the AVL, fleet management, asset tracking, vehicle security and recovery, andtransitsegments.ThedevicehasanIP69K protectionclass,whichallowsittobepermanentlymountedontheroofofavehicle,truck, train,vessel,orotherassets.> Falcom introduces the new MAMBO, an advancedpersonaltrackerconceptcombining a quad-band GSM/GPRS phone, a high-sensitivityGPSreceiver,GSMandGPSantennas,a three-axis motion sensor, full-color OLED display (128 x 128 px), a five-way navigation button and a 1300mAh Li-Polymer battery intoacompact(97 x 48 x 23 mm)enclosure.At firstglance,MAMBOlookslikeaconventional mobile phone. It incorporates a number of functions designed specifically for use by logistics providers, cab companies, security andfireservices,police,technicalemergency serviceproviders,andmanyothers.MAMBO canbeusedasacellphonewiththefullcomplementofstandardfeaturesincludingvoice callsandSMS,allthroughsimplemenu-guided operation.Thissmallrobustdevicecanbecarriedalonginapocketoraffixedtoavehicles interior.Itisatruemobileall-rounderbothfor commercial and private users. MAMBO also supportsaseriesoffunctionsforGPSnavigationandtrackingviaSMS,CSDandGPRS/TCP.

MAMBO

This all-rounders true strength lies in themultitudeofitsconfiguration options: rolling GPS display, geo-fencingcapabilitywith alarm, and an ultra-precise mo-vement detector are just some of the MAMBOscorefunctions. MAMBOcanintegrateup to five communication options including GSM and TCP, system-wide IEEE 802.15.4forcommunication withakeyfob,Bluetoothfor hands free communication, ANT for heart-rate monitoring and ISM for short range applications.Thisfirst-of-its-kind solutionwithsophisticatedsoftware offers system integrators and developers the abilitytodeveloptheirowncostefficientand flexiblesolutions.>Grundfos Communication Interface Modules(CIM)andCommunicationInterfaceUnits (CIU) enable data communication via open and interoperable networks for complete control of water supply, waste water pumps, andpumpsystems.TheCIM 250isastandard interface module for remote wireless data transmission via GSM/GPRS networks. The GSM/GPRSmodulecanfunctionasaSCADAinterface enabling a SCADA system or other PLC controller to establish a remote connectioneitherviaGSMcall-upusingtheModbus RTU protocol or via a GPRS connection using thesystemsModbusTCPprotocolsupport. The simple SMS interface enables users to controlandmonitorGrundfospumpsfroma mobile phone. The system makes it possible foraprogrammednumbertoreceivemessages whenever a warning or an alarm condition occurswhilealsoallowingtheusertorequest statusorexecutesimplecontrolfunctions such as start, stop, and setpointadjusting.

FAcTSGrundfos a/ssystemCIM/CIU250GSM/GPRSCommunication Interface

www.grundfos.com

which telit module do you use and why?TheCIM/CIO 250GSM/GPRSCommunication modulecomplementstheextensiverangeof industrial (wired) communications modules which interface the millions of Grundfos pumps installed each year. Thanks to strong R&D team efforts by Grundfos and Telit, the CIM 250 carries all major mobile GSM/GPRS network approvals, thus aggregating uncomplicated wireless data transmission and remote control capabilities for Grundfos pump systems across theglobalmarketplace. Last year several thousand Grundfos pumps worldwidewereconnectedallowing monitoring of data points to optimize performance, yield, and maintenance service intervals. And since demand for reliable water supply and efficient disposal of wastewaterwillonlyincreaseinthefuturetheoutlookforwirelessly connected pump systems is verybright. All Grundfos CIM/CIU communication interfaces offer easeofinstallationandprovisioningareuser-friendlyanda great value for money in the longterm.>Telicsfocusisthedevelopment,production and sales of flexible telemetry and telematics productswiththeMadeinGermanyquality standard. The first generation Picotrack was alreadythesmallesttrackingdeviceofitskind. The new generation Picotrack is even smaller enabling use in a greater number of business models.AlthoughthenewPicotrackisassmall asamatchbox,itispackedwithhighendfunctionality such as a complete set of telematics softwarefunctionswhichcanbeeasilyconfiguredovertheairorviatheTelicconfiguration tool.Becauseofanewlow-powerarchitecture, Telic customers can apply it to asset tracking projectssuchastrackingofvaluablegoods.The PicotrackPowervariantincorporatesastacked LiPo (Lithium-Polymer) battery with double thecapacitytofulfilleventhelongestbatteryliferequirementsinthissegment. The Picotrack hardware platform is ideal for container and trailer installations. In combinationwithsolarpanels,thePicotrackcanbe used for years of maintenance free tracking tasks.

The configurable motion sensor and alarm buttoncombinedwithitssmallsizeallowfor useinnearlyallsecurityapplications.Thelarge GPS-patch antenna ensures high accuracy of location information, even under bad reception conditions as for example, inside a home. Unlike other leading tracking service providers in Europe, Tracker.com offers the Picotracktogetherwithitstelematicsservices which, through a unique and free-of-charge iPhoneApp,canprovideendcustomerswith constantaccesstopositioninformation,availablealsotofamilymembersandfriendsatthe discretionofthecustomer. Tracker.com offers the Picotrack together withtrackingservicesforlocatingathletesin outdoor activities, children, the elderly, and impaired individuals requiring care. Picotrack helps increase personal safety for these individualsbykeepingthecareproviderconstantly informed of their whereabouts. Athletes can use Picotrack to chart their training and competitionroutesonline,keepingthemselves constantly updated on distance covered and average speed. Personal trainers and coaches can easily view the training modules completed by their athletes online. Pets can also betrackedwiththePicotrack.>Fideltus Advanced Technology Venture's disciplined investment strategy focuses on emerging growth businesses across four primaryareasofinterest:communications, infrastructure, software and services, consumer technology, biopharmaceuticals, medicaldevicesandemergingtechnologies. The vast majority of our portfolio companiesarebasedinTurkey.Ourtargetmarkets arecommunications,infrastructure,software & services, emerging technology, consumer technology, biopharmaceuticals, medical devices,andinformationtechnologies.

and efficiently store, protect, and manage yourinformationsothatitcanbemadeaccessible, searchable, shareable, and, ultimately, actionable. You can also use FIDELTUS information infrastructure as the foundation for implementingyourinformationlifecyclemanagementstrategies,securingyourcriticalinformation assets, leveraging your content for competitive advantage, automating your data center operations, reducing power and coolingcosts,andmore. We help a range of customers FIDELTUS works with organizationsaroundtheEMEA,inevery industry,inthepublicandprivate sectors, and of every size. Our customers include banks and other financial services firms, manufacturers, healthcare and life sciences organizations, internet service and telecommunicationsproviders,airlinesandtransportationcompanies,educational institutions, and public-sector agencies. Strong leadership record Our differentiated value comes from our sustained and substantialinvestmentinR&D,ourtechnicalR&Demployeesaroundthe globe, the industry's broadest portfolio of systems, software,andservices, our ability to create total integrated solutions all designed in-house from top to bottom and our commitment to delivering the best total customerexperienceinthisorany industry.>Integratingsophisticatedtechnology,OrbiSatmakesavailabletothemarketareliable, easytoinstallandlowcostGPS+GPRSvehicle trackingsystem.Itisaperfectchoiceforinsurers,carriersandcardealers.Fleetmanagement, vehiclerecovery,andmonitoringofcarroutes aresomeofitsmainpossibleapplications. The OrbiSats Vehicle Tracking System combinesallthetechnicalknowledgeofOrbiSats engineering teams from the development of telecommunication equipment, to radar systems, to expertise in development and production of high volume consumer electronicsdevices. The main challenge in the development of this system was finding the perfect balance betweenqualityandpricetoaddresstheBrazilianafter-marketautomotiverequirements. Investinginareliablehardwaredesign,findingstrongsupplierssuchasTelitwerethefirst stepsandwiththesechoicesmade,securinga soundcombinationofmoduleswastofollow. Redundantinternalsystems,realtimekernel, a strong watch-dog function, ESD and EMI protection,allSMTboardassembly,intensive testingcycles,andcompliancetogovernment

regulationsandcertificationswereallpartof thisproject. Consideringthattherearealreadyanumber ofcompaniesinthemarketsupplyingvehicle tracking services, and many with their own trackingsoftware,OrbiSatmovedtooffer,at nocharge,asoftwarelayercalledCollector, whichcanbeeasilyintegratedintoproducts already available in the market, allowing securitycompaniestoworkwiththeOrbiSats tracking device in a seamless way. The communicationprotocoldevelopedbyOrbiSatis compactandlight. Anotherfeature weintroducedistheconfzero,allowingtheOrbiSatstrackingdevice to be configured at activation time, once it is installed in the car. Using configuration parameters pre defined in the control software of the service provider, this informationistransmittedoverGPRStothedevice, preventing issues such as misconfiguration and other errors or mistakes that can cause thesystemtomisbehaveorperformpoorly. The GA-2010 Vehicle Tracking System is the new security product offered by OrbiSat to themarketinanapproach allowing either small or large vehicles location and tracking companies to have their needs addressedbyareliable,accurate, economic, and professional-gradedevice.>REDTAIL Telematics is a global hardware manufactureranddistributorofGPStracking solutionsforfleetmanagement.Ourproducts are designed and developed by an experiencedengineeringteam,globallyrecognized aspremierleadersinwirelesstechnology.The sameengineeringdesignteamhasdelivered morethan5milliontrackingdevicestomarketsworldwide. TheVAM(VehicleAssetManagement)features abinaryprotocolavailableinTCP/IPandUDP overGPRSandSMS.Itissupportedbyacomprehensive software development kit (SDK), haslowoverheadforefficientdatacommunication, and is future-proof with a full overthe-air(OTA)firmwareupgradecapability. TheproductisbasedontheGE865-QUADmodule,whichcontinuestoshowoutstandingreliability.Portingthefirmwarefromaprevious Telitmodulewasextremelyeasy,savingREDTAIL Telematics valuable development time. The Telit support team also prepared us to Ourcompanyoffershigh quality,lowcosthardwareproductsdirectlyto GPS vehicle tracking providers. The evolution of the REDTAIL Telematics roadmap happens inlockstepwithcustomerdemandandacceleratedjointdevelopmenteffortswithourcustomersarealwaysconsiderediftoachieveoptimalwin-winsolutions. REDTAILTelematicsbringsfull-featuredfleet management solutions to market based on themostdesiredfeaturesfromfleetmanagers. Our feature suite focuses on driver behavior,dashboards,enhancedmapping,vehiclemonitoringandmore.Weexpect2011to be a very exciting year with more and more companies developing their own solution or looking to partner with a company having proventrackrecordinthemarketplace. Visitoursiteatwww.redtailtelematics.com/VAM to learn moreaboutourproducts andservicesortorequest freedemounits. TechnoKom is a company focused on research,design,development,andproduction ofelectronicdevicesforvariousapplications. Withover17yearsofexperience,itiscurrently one of the leading vehicle tracking device and software manufacturers in Russia. The TechnoKom dealer network covers over 95% oftheregionsinRussiawithanumberofrepresentativesabroad. TheAutoGRAPH-GSM+(GPS/GLONASS)was designedtoprovideaprofessional-grade,safe andflexiblevehicletrackingsolutionforawide range of customers with different needs and applicationopportunities. TheproductisequippedwiththeTelitGE864QUADmodulewhichisaperfectplatformfor medium-to-high-volume m2m devices and applications. Automatic vehicle location is a powerful conceptwhenmanagingfleetsofvehicles such as service, emergency, public (buses and trains) and personal transport, water and rail transport, agriculturalandbuildingmachinery, aviation, etc. The AutoGRAPH-GSM+ can also be used to track mobile assets,suchasnon-wheeledconstructionequipment,non-motorizedtrailers, and mobile power generators.

GPS/GLONASS/GPRS eal-timevehicletrackingand R monitoring lerting,collectionandreporting A oflocalexternalevents Internaldataloggerwith270,000records EasyconfigurationviaSMS/GPRS/USB ull2-wayvoiceandtext-messaging F communicationinterface AN(SAEJ1939/FMS)/RS-485/1-Wire C interfaces rogrammableanaloganddigitalinputs P uelconsumptionandfueltanklevel F monitoring onitoringandcontrolofauxiliary M vehicleequipmentandsensors ERA-GLONASSready

features

90

tracking

TELITworLd

TELIT2MARKET 06|11

we appreciated telits technical support which significantly reduced our product development time.Mark Hu, Vice President

FAcTSwonde Proud technologywww.wondeproud.com systemDevicename:M7(GPSPortableMagnetic Tracker).TheM7isaportableGPSTracking devicecompactinsize,easilymounted(or hidden)throughmagneticinstallationto anymetalpartofavehicle.Withsuperior GPSandGSM/GPRSmodulesonboard, ultra-lowstandbypowerconsumption, andIP67-ratedwaterproofenclosurefor outdoorenvironmenttheM7represents thebestchoiceforyourGPSvehicle trackingapplicationforitsreliability, convenience,andflexibility.

>>Wonde Proud Technology specializes in designing the most advanced, integrated, and user-friendly GPS devices. Our products have been widely used in commercial andmilitarymarkets,wherereliabilityand stability are top concerns. Over the past years, we have registered a number of patents and intellectual property disclosures givingusacompetitiveedgeinthisvigorous market.

ratedwaterproofcompact-sizeenclosure.This portabletrackingdevicecanbeeasilyattached underanyvehiclethankstoextra-strongmagnets while a tamper-detection switch equippingitactivatessendinganalarmreportshould thedeviceberemovedfromthevehicle. ThankstoTelitshighsensitivityGSM/GPRS modem, the GE864, this portable tracking deviceisabletooperateinanyenvironment especially under poor GSM receptionconditions.Wereceivednotonlyoutstanding hardware but also strong andseamlesstechnicalsupport from Telit during the product development period which significantly reducedourtime-to-market, maintaining our competitiveadvantage. Westronglybelievethatthis portable tracking device will soonbecomeanindustryleaderascustomers begintoreapthebenefitsfromitshighperformance, reliability, and cost-effectiveness as a GPSsolution. When its your job to turn peoples wireless ideas into reality, you get to see a lot. innovation in the wireless device space is picking up as a much broader community becomes increasingly aware that connectivity can enable better business and better living. So what trends is driving growth? i like to look at it from two perspectives: technology and business trends. On the technology side, one thing with which we have been challenged several times as designers is the miniaturization of finished products. Thankfully, this has been supported by the continued miniaturization of key components including modules and even SIMs. Nevertheless, it presents unique design problems particularly when it comes to integrating antennas for mission-critical performance and reliability. For those seeking to bring small connected products to market,

we highly recommend looking for expert support for antenna design, particularly in light of the fact that antenna performance is a key component of required device certifications. The next trend creating an impact is the continued downward slope of component pricing across major component categories including modules, processors and memory. For years, analysts blamed slower-than-expected growth in the m2m industry on this very issue. Today, with costs coming down, we are starting to hit the sweet spot on bill of materials enabling attractive pricing on finished products in both traditional and emerging m2m verticals including the connected consumer space. Another trend on the technology side that we expect to continue through 2011 is an increased interest in standardization. Though ABI Research recently stated m2m markets will NOT achieve significant standardization in 2011 (1), they do note that a host of international standards organizations are working on setting standards with many projects expected to conclude this year. While we agree there will continue to be some road blocks, we are seeing increased concern for standardsbased development from the innovators bringing new m2m products to market and believe customer-driven demand will press the industry to overcome objections and begin adopting these standards. On the business side, we are seeing a maturing in m2m value propositions and business models which is leading to improved return on investment and, as a result, the emergence of new vertical market participation.

TELIT2MARKET 06|11

TELITMarkET

113

their products and establishing the grounds for ongoing customer relationships and for recurring revenues. Healthcare companies are enhancing patient quality of life. Car makers and auto insurers are making the highways safer. And, of course, major technology players are looking to complement existing portfolios and leverage customer relationships to expand into this hot new space. Berg Insight projects the total number of m2m connections to grow at a rate of 32 percent to reach nearly 300 million by 2015 (3). iSuppli predicts even faster growth of 52 percent between 2009 and 2014 (4). Beecham Research expects sales of embedded devices to exceed $250 billion by next year (5). By any measure, its clear that m2m is poised not only to grow tremendously, but indeed to change forever, for the better, the way we live and work. Australia > Austria > Belarus > Belgium > Bolivia > Bosnia Herzegovina > Brazil > Bulgaria > Canada > Chile > China > Columbia > Croatia > Cyprus > Czech Republic > Denmark > Ecuador > Estonia > Finland > France > Germany > Greece > Hungary > India > Indonesia > Iran > Iraq > Ireland > Israel > Italy > Jordan > Korea > Latvia > Lebanon > Lithuania > Luxemburg > Macedonia > Malaysia > Malta > Mexico > Montenegro > Netherlands > New Zealand > Norway > Paraguay > Peru > Philippines > Poland > Portugal > Romania > Russia > Saudi Arabia > Serbia > Singapore > Slovakia > Slovenia > South Africa > Spain > Sweden > Switzerland > Syria > Taiwan > Thailand > Turkey > Ukraine > United Arab Emirates > United Kingdom > United States > Uruguay > Vietnam

telit ARoUND tHe woRlD

For detailed information about our distributors, please > where to buy. visit

www.telit.com

116

TELITSaLES

telit2mARKet 06|11

S. Croft

s

Y. Ferhusoglu

TELIT'S SALES

A. Fan

Recommended