View
218
Download
2
Category
Preview:
Citation preview
| www.schoenox.co.uk |
| Sub-floor Preparation
and Adhesive Products |
| Primers and DPMs | Levelling Screeds | Adhesives | Ancillaries | Specialist Wood Flooring |
| SCHÖNOX Catalogue 2018 Edition 1
SCHÖNOX® is a brand name synonymous with quality products for the building and renovation
industry. These products are designed for use during the installation of all types of floor tiles
and coverings with a range which includes high quality levelling screeds, floor adhesives,
primers and waterproof membranes, many of which can be used in conjunction with the Sika®
wood floor bonding range.
All of the SCHÖNOX® products are developed and produced to the highest quality using state of
the art manufacturing facilities; we also have extensive R&D capabilities and constantly work
to ensure that innovation is always at the forefront of the products we bring to market.
| SCHÖNOX is a Sika brand
Place an order
Tel no: 01707 358588
Email: frsales@uk.sika.com
Technical
Tel no: 01707 363864
Email: flooring.technical@uk.sika.com
| Contact our Dedicated Team for
Specification, Technical or Design Advice |
| Contact us
6 - 7Primers and DPMs
8 - 11Gypsum & Cement Based Levelling Screeds
12 - 15Adhesives
16 - 17Ancillaries
18 - 22Specialist Wood Flooring
23Pictogram Key
24 - 26Sika Standard Terms and Conditions
Content |
6 Primers and DPMs
Whether you are priming an old cement based substrate without a damp proof
membrane, a new anhydrite screed, keying old ceramic tiles or isolating adhesive
residues, SCHÖNOX® has a top of the range product to ensure your requirements are
met in full.
| The right problem solvers for every situation
7Primers and DPMs
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487645 4016447011444 Light blue 10kg Single 60 pcs
| SCHÖNOX® VDUniversal acrylic primer for use prior to application of the SCHÖNOX underlayments on porous and non porous substrates
in interior areas. Suitable for pre-treating on walls and floors following the recommended dillution rates.
USES
n Internal use n To reduce absorbency of cement screeds, concrete, rapid cement screeds, calcium sulphate based screeds,
gypsum boards and wooden substrates n To improve adhesion of the levelling screeds n To reduce moisture ingress into
substrate
Storage: not below +5˚CCoverage: 50-80 g/m2
Shelf life: 1 year
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483398 4016447017798 Yellow 10kg Single 60 pcs
| SCHÖNOX® SDGSCHÖNOX® SDG is a rapid drying, ready mixed special dispersion based damp-proof membrane for interior use. It is
suitable for the fast pre-treatment of unheated cement based substrates with a residual moisture up to 90% RH as a
2 coat application and 93% RH as a 3 coat application. No additional primer is required prior to applying Schonox floor
levelling sreeds. It has high coverage and short waiting times: just 15 min for the 1st coat and approx. 45-90 min for the
2nd and 3rd coats.
USES
n As a damp-proof membrane on moisture resistant substrates with increased residual moisture n Under SCHÖNOX® floor
levelling screeds with subsequent laying of textile, elastic coverings, parquet
Storage: not below +5˚CCoverage: approx. 100-150g/m2/layer (30-40m2/ 10kg for 2 coat system)Shelf life: 1 year
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483203 4016447010454 Blue 5kg Single 90 pcs
A solvent-free, 1-component acrylate dispersion primer for interior applications. SCHÖNOX® SHP is a special primer for
sound, smooth and non-absorbent substrates. Especially suitable for application over old well bonded vinyl sheet, tiles,
steel access floors and all non porous substrates. With short waiting times, and easy roller application, this product
provides optimum adhesion. It has low consumption/high coverage rates, and can be used on both floors and walls. It has
low emissions, and is also odourless, making it pleasant to use.
USES
n As a primer to improve adhesion on smooth and sound substrates n As a primer over Sikafloor®-156
| SCHÖNOX® SHP
Storage: not below +5˚CCoverage: approx. 100-150g/m2 (6.5-10m2/kg)Shelf life: 1 year
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet1458 N/A Clear 10kg Single 30
82671 N/A Clear 25kg Single 21
14921493
N/AN/A
ClearClear
180kg Part A (Kit is 3A:1B)180kg Part B
Single 22
3093330934
N/AN/A
ClearClear
1000kg Part A (Kit is 3A:1B)1000kg Part B
Single 11
A 2-part, solvent-free, low viscosity, epoxy resin primer suitable for use in conjunction with all SCHÖNOX® adhesives and
levelling compounds. Controls moisture on damp cementitious substrates with a moisture content up to 99% RH. Provides
substrate consolidation and adhesion promotion on weak or friable surfaces. Sikafloor®-156 is suitable for refurbishing
existing substrates against the egress of moisture which can damage floor finishes.
USES
n Moisture regulator for cementitious substrates n Substrate consolidator on concrete, cement and refurbished substrates
n Adhesion promoter on broadcast mastic asphalt and most adhesive residues.
| Sikafloor®-156
Storage: not below +5˚CCoverage: approx. 400-600g/m2 (concrete/cementitious screed) approx. 250-350g/m2 (broadcast mastic asphalt)Shelf life: 2 years
8 Gypsum Levelling Screeds
Levelling screeds today are far more technically advanced than they have ever
been. SCHÖNOX®, part of the Sika® Group of companies are at the forefront
of this development and bring to you not only products with exceptional
smoothing and levelling properties, but they are also fast drying which enables
final flooring finishes to be applied in as little as two hours after application.
| Quality guarantee for your substructure
9Gypsum Levelling Screeds
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487578 4016447022198 White 25kg Single 42
A synthetic gypsum self-levelling superflat screed for use from 1 to 45 mm. Especially suitable on all gypsum and cement
based substrates, as well as on cast asphalt screeds according to DIN 18 560. Suitable for use with underfloor heating
systems, and for castor wheel loading, Used in thicknesses of 1 to 30mm (without aggregate), or 10-45mm (when bulked
out with 3mm granite chippings). It boasts high strength values (40 N/mm2 compressive strength), is stress free, while
also being protein-free, and low in emissions (EC1). Used in conjunction with SCHÖNOX® SHP primer it can also be used to
overlay old, firmly bonded, resilient floor coverings. After adding of 6 litres of water to 25kg of powder, it is ready to use.
USES
n Interior use n For use under textile and elastic coverings, as well as parquet
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483099 4016447017637 White 25kg Single 42
| SCHÖNOX® AP
Storage: not below +5˚CCoverage: approx. 6.5m2 per bag at 3mm thicknessShelf life: 1 year15804
| SCHÖNOX® APFSynthetic gypsum fibre-reinforced, self-levelling screed for use from 3-15mm in internal areas.It is especially suited for
use with wooden floor boards, chipboard (V100), mastic asphalt screeds and other critical substrates in combination with
elastic and textile coverings. Ready for foot traffic after approx. 3 hours, it has a particularly high coverage rate, as well
as very low emissions. It boasts high flexural strength, and is particularly suited for use with electric underfloor heating
systems. It provides an extremely smooth and flat surface and easily achieves SR1 smooth surface which is ideal for use
with soft floor coverings where every defect in the substrate will reflect through to the finished floor. It is ready to use
with addition for 6.0 litres of water; can be poured or pumped.
USES
Storage: not below +5˚CCoverage: approx. 6.5m2 per bag at 3mm thicknessShelf life: 1 year
15804
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483097 4016447022594 White 25kg Single 42
Very low emission, calcium sulphate based superflat levelling screed especially suitable for all calcium sulphate based
subfloors as well as mastic asphalt screeds according to EN 13 813. Also for interior use on cementitious subfloors
and for application on subfloor heating systems. Layerthickness is 1 to 10mm without aggregates and 10 to 30mm
with aggregates. After adding 6l water for 25kg powder, SCHÖNOX® XA is ready for use.
USES
n Interior use n For filling, smoothing, evening and levelling of substrates under textile and elastic coverings n For use
under parquet (layer thickness above 3mm)
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487737 4016447023966 White 4.5kg 4 50
| SCHÖNOX® AST
| SCHÖNOX® XA
Synthetic gypsum based rapid drying, feather edge and patching compound suitable to provide a smooth finish on
calcium sulphate based substrates in interior areas. SCHÖNOX® AST can be installed as a true featheredge. It is fast drying
independent of the layer thickness and is ready for foot traffic after approx. 60 minutes. Suitable for underfloor heating
systems, as well as for castor wheels loadings according to DIN EN 12529.
USES
n Interior use only n For smoothing and levelling of: gypsum based screed boards and levelling screeds, gypsum substrates,
old substrates such as ceramic tiles, water-resistant adhesive residues, wooden substrates
Storage: not below +5˚CCoverage: approx. 6.5m2 per bag at 3mm thicknessShelf life: 1 year
Storage: not below +5˚CCoverage: approx. 7m2 per bag as a feather edgeShelf life: 1 year
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
10 Cement Based Levelling Screeds
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet505287 4016447024789 Grey 25kg Single 40
503002 4016447016647 White 4.75L 4 24
High Performance two component latex levelling screed. A protein free, two-component self-levelling screed for interior
use that can be laid at a thickness of 3-40mm without aggregates, and 10-60mm with aggregates. 4.75 litres of SCHÖNOX®
LC LIQUID is applied to a 25kg bag of SCHÖNOX® LC POWDER to create a latex- and polymer- modified levelling screed that
is ideal for use below textile and other flexible floor coverings, as well as parquet flooring. It is ideal for use with underfloor
heating systems, and can be used on concrete, rapid-hardening cement systems, cement screeds, gypsum screeds, new
mastic asphalts IC10/15 (layer thickness up to 5 mm), and also old substrates such as ceramic/terrazzo.
USES
n Interior use n Under textile and other flexible coverings n Under parquet (layer thickness above 5mm)
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487679 4016447008369 Grey 25kg Single 42
A self levelling moisture tollerant levelling screed for use from 3-50mm without aggregate and 10-60mm with aggregate.
Noted for its rapid hardening, high strength, and low shrinkage, SCHÖNOX® FPL PLUS can be used for both interior and
exterior applications, as it is both frost resistant and waterproof. Suitable for use with underfloor heating systems,
SCHÖNOX® FPL PLUS is both pourable and pumpable, and is ready for covering after approx. 4 hours, for ceramic tiles on
concrete floors. It has low VOC emissions, and is regulated under EMICODE EC1 Plus. After adding 4.5-5.0 litres of water to
25 kg of powder, SCHÖNOX® FPL PLUS is ready to use.
USES
n Interior and exterior n On balconies and terraces n As a repairing mortar for filling holes
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483292 4016447022914 Grey 25kg Single 42
| SCHÖNOX® LC POWDER AND LIQUID
BA
Storage: not below +5˚CCoverage: approx. 5-6m2 per bag at 3mm thicknessShelf life: 1 year
| SCHÖNOX® FPL PLUS
Storage: not below +5˚CCoverage: approx. 5m2 per bag at 3mm thicknessShelf life: 1 year
15804
| SCHÖNOX® ZM RAPIDRapid setting self-levelling screed with very low emissions, for internal applications. For layer thicknesses 1 to 10mm wit-
hout aggregates and 5 to 25mm with added aggregates. Suitable for almost all internal substrates, SCHÖNOX® ZM RAPID
allows coverings to be laid after approximately 90 minutes. With very low shrinkage and good absorptivity, SCHÖNOX®
ZM RAPID is suitable for underfloor heating applications. It is also suitable for castor wheels loading with layer-thicknesses
great than 1mm (according to EN 12 259).
USES
n Interior use n For filling, smoothing and levelling of sustrates n For full surface levelling under wooden floors
Storage: not below +5˚CCoverage: approx. 5.5m2 per bag at 3mm thicknessShelf life: 6 months15804
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483232 4016447008925 Grey 25kg Single 42
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
| SCHÖNOX® DSPVery low emission, premium levelling screed for direct use on all suitable substrates in exterior and interior areas, parti-
cularly for levelling of industrial floors as well as garages and cellars. SCHÖNOX® DSP is characterised by a
low material shrinkage, very good flow properties and a homogeneous concrete grey appearance. It can be laid at
a thickness of 4-15mm without aggregates and 15-50mm with aggregates. Ready for foot traffic after approx. 3 hours.
USES
n Interior and exterior use n For filling, smoothing and levelling n For under coatings, ceramic or other coverings, interior
and exterior
Storage: not below +5˚CCoverage: approx. 5.5m2 per bag at 3mm thicknessShelf life: 6 months
15804
11Cement Based Levelling Screeds
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487660 4016447021788 Grey 4.5kg 4 50
| SCHÖNOX® SLCement based rapid drying, feather edge, smoothing and finishing compound, suitable to provide a smooth finish on
various substrates in interior areas. Moisture resistant. SCHÖNOX® SL can be installed as a feather edge. It is characterised
by quick drying time, independent of the layer thickness and is ready for foot traffic or covering (up to 20mm) after
approx. 20 minutes.
USES
n Interior use n For patching, smoothing and levelling of concrete, cement substrates, floor levelling screeds, old sub-
strates such as ceramic tiles, old, water-resistant adhesive residues, wooden substrates n For filling, smoothing and level-
ling of unheated, cement based substrates under SCHÖNOX® Moisture Mitigation Systems
Storage: not below +5˚CCoverage: approx. 7m2 per bag as a feather edgeShelf life: 6 months13813
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483234 4016447004088 Grey 25kg Single 42
Storage: not below +5˚CCoverage: 1.6kg/m2/mmShelf life: 6 months
| SCHÖNOX® RRRapid setting repair mortar for use from 1 to 50mm, suitable for direct bonding of coverings in interior areas.
SCHÖNOX® RR is ideal for use on subfloor heating systems, and can be used on concrete, cement and rapid
cement screeds, as well as on ceramic tiles, natural stones and terrazzo. Foot traffic can be accepted after 30 minutes
and is suitable for castor wheels loading with layer-thickness more than 1mm according to EN 12 529. After adding
of 5.5l of water to 25kg of powder, SCHÖNOX® RR is ready to use.
USES
n Interior use n For patching, filling, repairing and levelling staircase steps and platforms, wall breakouts n As a repairing
mortar for filling holes
15804
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
| For every covering there is a
professional solutionSCHÖNOX® has a full range of technically advanced dispersion adhesives to suit every ap-
plication. From pressure sensitive to the unique roller applied iFloor® system for installing
luxury vinyl tiles and planks in a quarter of the time, SCHÖNOX® adhesives will provide the
installer with greater flexibility in all aspects of their installation.
12 Adhesives
13Adhesives
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet484590 4016447004255 Beige 14kg Single 44
A universal pressure sensitive dispersion adhesive for all flexible coverings including textile, linoleum, vinyl, cork, rubber
and impact sound underlay in interior areas. Suitable for both wet and pressure sensitive adhesion. Solvent-free. It is is
easily spread, has short waiting time and rapidly develops a strong bonding strength. It is also particularly suited for use
with difficult floor coverings (please see data sheet).
USES
For bonding: n Textile wall and floor coverings n Woven fabrics, needlefelt, natural fibre coverings n PVC and CV wall
and floor coverings, LVT n Impact sound insulation underlays n Linoleum coverings in sheets, cork linoleum, corkment
n Synthetic rubber coverings
| SCHÖNOX® EMICLASSIC
Storage: not below +5˚CCoverage: By Roller: approx. 200g/m2 (5m2/kg).By notched trowel A1-A4 200-300g/m² (3.33-5 m2 per kg). By notched trowel B1-B4 300-500g/m2 (2 - 3.33m2 per kg)Shelf life: 1 year
SCHÖNOX GmbHD-48720 Rosendahl
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487741 4016447018627 Beige 14kg Single 44
| SCHÖNOX® UNITECHSolvent-free dispersion adhesive for bonding flexible coverings in interior areas. SCHÖNOX® Unitech is suitable for wet
adhesion, has short waiting times, high coverage rates, strong stringiness and has a rapid development of adhesion
strength. Suitable for use over all SCHÖNOX® levelling screeds, this product is suitable for use with underfloor heating
systems, and can be used in areas subjected to castor wheel loading.
USES
For bonding: n PVC floor coverings n CV floor coverings n Textile wall and floor coverings n Single or multi-layer needlefel
n Natural fibre coverings n Linoleum sheet coverings
Storage: not below +5˚CCoverage: Trowel size A1-A2 - 300-350g/m2
Trowel size B1-B2 400-500g/m2
Shelf life: 1 year
| SCHÖNOX® LINO XTREME
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet493369 4016447024147 Beige 14kg Single 44
Very low emission linoleum dispersion adhesive for one-side gluing linoleum in sheets, cork-linoleum and corkment on
absorbent substrates in interior areas. It is suitable for use over all SCHÖNOX® levelling screeds, also ideal for
application on subfloor heating systems and areas where castor wheels will be used. It is easy to apply and rapidly
develops the adhesion strength. It also has strong stringiness and high coverage rate.
USES
n Interior use n For bonding of linoleum coverings in sheets, cork linoleum and corkment
Storage: not below +5˚CCoverage: notched trowel TKB B1: approx.400g/m2
Shelf life: 1 year15804
SCHÖNOX GmbHD-48720 Rosendahl
14 Adhesives
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet484591 4016447013608 Crème Beige 14kg Single 44
| SCHÖNOX® DUROCOLLMulti purpose dispersion adhesive for bonding all types of soft floor coverings in internal areas. It is an adhesive ideally
suited for use with problematic, high movement soft floor coverings. This high quality, fibre reinforced adhesive is
appropriate for use with underfloor heating systems, and has a low consumption with high coverage. It is easy to apply
and rapidly builds to a very high final strength. This product compensates for the higher plasticity of some imported vinyl
products.
USES
For bonding of: n Luxury vinyl tiles (LVT) n PVC and CV coverings n Textile coverings n Single multi-layer needlefelt
Storage: not below +5˚CCoverage: Trowel (Size A1-A2): approx. 250-300g/m2². Trowel (Size B1-B2): approx. 350-450g/m2Shelf life: 1 year15804
SCHÖNOX GmbHD-48720 Rosendahl
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet481685 4016447012458 Creme -Beige 7.05kg (A:6kg; B:1.05kg) Single 60
| SCHÖNOX® PU 900A solvent-free 2-component polyurethane adhesive for bonding elastic coverings in interior areas or sheltered exterior
areas. Especially suited for bonding PVC and rubber coverings, as well as a variety of other materials. This adhesive can
be used on either absorbent or non-absorbent substrates. PU 900 is easily spread, can be used with underfloor heating
systems, as well as in areas expecting castor wheel loading. A long open time makes it easy to work with. It hardens
quickly and reaches a high bonding strength.
USES
n For bonding of PVC coverings, synthetic rubber and lino coverings, rubber granulate underlays, grass carpets n As a
repairing compound for cracks in screeds
Storage: not below +5˚CCoverage: approx. 500-1000g/m2 (7-14 m2 per 14kg unit)Shelf life: 6 months
SCHÖNOX GmbHD-48720 Rosendahl
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487437 4016447019846 Light Green 4.5kg Single 24
487438 4016447019037 Light Green 11kg Single 18
| SCHÖNOX® iFLOORA revolutionary new system for laying of all types of luxury vinyl tiling on levelled substrates by professional fitters.
Unique, dispersion based rollable adhesive provides an extremely clean and fast installation. No excessive adhesive
residues, and no residual adhesive moving up through the joints, leaves the vinyl surface and installer’s hands clean. By
forming a flat adhesive bed instead of adhesive notches, this product will not cause point load deformation. As only a thin
layer is required, it boasts particularly high coverage rates. It bonds the vinyl immediately, allowing for immediate foot
traffic, and therefore a very fast installation.
USES
n For bonding LVT on levelled substrates
Storage: not below +5˚CCoverage: adhesive : 80g/m2 50m2 kit and 125m2 kit); primer: 25m2/kgShelf life: 1 year
15804
SCHÖNOX GmbHD-48720 Rosendahl
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
15Adhesives
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet485560 4016447018498 White 10kg Single 60
Roller applied anti-slip tackifier for fixing all types of carpet tiles. Used internally, this product is easily applied by roller
to fix all types of carpet tiles to most substrates. It has low consumption and high coverage rates. By remaining wet
(tacky) for a very long period, the product holds carpet tiles in place, but also allows for the easy replacement of tiles
when required. The product is suitable for use with underfloor heating systems and in areas where castor load bearing
is expected
USES
For fixing: n Textile tiles without surface tension n Conductive and antistatic textile carpet tiles n Loose laid textile sheet
coverings
| SCHÖNOX® TACKIFIER
Storage: not below +5˚CCoverage: approx. 75-120g/m2
Shelf life: 1 year
SCHÖNOX GmbHD-48720 Rosendahl
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet539397 - Light Brown 5 litre 2 45
| SCHÖNOX® DOUBLE STICKA multipurpose polychloroprene based contact adhesive, suitable for a wide range of applications. These include Cap and
Cove installation, bonding of vinyl, CV, Carpet and textiles coverings. It is a high strength brushable contact adhesive which
offers the contractor many benefits such as minimising task time, reducing waste and costs.
USES
For bonding: n For bonding PVC and rubber edgings, covings and nosings, floor and wallcoverings with backings of PVC,
rubber cork and all textiles. rigid PVC, foam, leather, rubber, glass fibre, wood and metals
Storage: not below +5˚CCoverage: 5.5m2/lShelf life: 1 year
15804
| Round off your equipment
Sika® supplies a number of accessories that are an important tool when installing
flooring. SCHÖNOX® TS provides sound and heat insulation and living comfort in
modern and old buildings for wall and floor areas. While Tramex Moisture Meter is an
essential tool for any installer to have in their toolbox, and can prevent costly damage
from warping if there is too much moisture in a substrate or the wood flooring.
16 Ancillaries
17Ancillaries
| Sika® TRAMEX HYGROMETER
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet116022 - - - Single 100
This pocket sized Digital Hygrometer provides fast and accurate measurement of relative humidity, ambient temperature
and dew point of the environment.
| Sika® TRAMEX MOISTURE METER
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet5450 - - - Single N/A
The Hand-Held Moisture Meter is designed to instantly and accurately measure moisture content in concrete/cement
screed, prior to laying wood floors.
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483535 4016447021832 Brown-Black 20m2 Single 12
| SCHÖNOX® TSA special cork-PU granulate underlay for improving impact sound insulation, heat insulation and living comfort in modern
and old buildings for wall and floor areas. It also reduces the formation of walking lines on textile coverings.
USES
n Under flexible coverings e.g. PVC- and CV coverings and textile coverings n Under parquet and laminate with tongue and
groove by floated laying n Under parquet with tongue and groove by full-surface bonding n Especially suitable on stairs as
well as ready-built houses and timber construction
Mass per unit area: 3 mm approx. 1.65 kg/m2. Acoustic improvement according to ISO 10140 (without covering): 3 mm 17 db; 5 mm 18 db Thermal resistance according to ISO 8302: 3 mm 0.04 m2 K/W
SCHÖNOX GmbHD-48720 Rosendahl
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483686 4016447008116 - 50.42m2 Single 12
A multiaxial glass fibre fabric to reinforce SCHÖNOX® APF used to screed critical substrates in refurbishment projects,
avoiding the need to replace the existing subfloor It is easy to apply, ideal for projects where height is limited. Perfect
for all kind of carpets and elastic coverings.
USES
n Wooden substrates n Bitumen emulsion and Magnesia screeds n Old existing floors n Coatings
| SCHÖNOX® RENOTEX
Dimensions: 42m length and 1.19m widthConstruction: -AR-glass fibre cloth with polyester/cotton stitching and acrylate coating
| QUARTZ SAND
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet102259 - Greyish/White 25kg Single N/A
102264 - Greyish/White 25kg Single N/A
102267 - Greyish/White 25kg Single N/A
- Greyish/White 1250kg Big Bag 0.7-1.2 Single N/A
A light coloured kiln dried graded quartz sand for use with SIKA® coatings and membranes to provide a mechanical key
for subsequent levelling materials.
AVAILABLE IN THREE GRAIN SIZES:
n Small - 0.06 - 0.3mm n Medium - 0.3 -0.8mm n Large - 0.6 - 1.2mm
pH: pH 5-8 (400 g/l water at +20˚CMelting point/freezing point: > 1610˚CRelative Density: 2-3 g/cm3
Solubility in water: negligible
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
| Sika® Flooring adhesives - suitable for
every application.A varied and quality range of adhesives to complement the application of specialist
wood flooring.
18 Specialist Wood Floor Bonding
19Specialist Wood Floor Bonding
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet7027 7612894079630 White 600ml 20 48
A high viscous one part, ready to use, solvent-free, elastic adhesive used as a high strength construction adhesive, which
is particularly suited for the bonding of solid wooden boards with a maximum width of 160mm. It has good adhesion on
concrete, bricks, stones, tiles, ceramic, wood, aluminium, steel, plaster, hard PVC, GFRP, PU and more.
USES
n For indoor and outdoor for bonding solid wooden boards with max 160mm width for stair steps, skirting boards, base
boards, crash protection boards, covering boards and more
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet424418 7612894887525 Brown 600ml 20 48
427263 7612894905342 Brown 1800ml 6 18
| SikaBond®-52 Wood Floor
| SikaBond® T2 Adhesive
Fast curing elastic wood flooring adhesive for professional use. SikaBond®-52 Wood Floor is perfect for bonding solid
wooden boards with a maximum width of 160mm, using liquid batten/beaded application. It is suitable for most common
types of wood floors, particularly for problematic woods including beech, maple and bamboo. Also compatible with Sika®
AcouBond® System.
USES
n For bonding wood floors using liquid batten/beaded application n Full surface bonding using SikaBond®
Dispenser-1800/-5400 n For use with the Sika® AcouBond® System n Use with solid, engineered, parquet wood floors and
chip board n Suitable for most common types of wood floors
| SikaBond® MS Wood Floor Gun Grade
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet467798 5055492700933 Brown 600ml 12 55
A high quality, gun applied MS adhesive for bonding wooden floors to all common substrates. Being permanently elastic it
accommodates differential movement caused by changes in humidity and climatic conditions. Solvent and moisture free,
will not cause cupping of wood flooring. It is also quick to install and Ideal for use with underfloor heating when part of
the Sika® AcouBond® System.
USES
n Gun applied bonding of wood floors n For bonding directly to all common substrates n Suitable for use with under floor
heating when used with Sika® Silent Layer Mat (Sika® AcouBond® System)
Storage: not below +5˚CCoverage: 44 ml approx. per running meter (with triangular nozzle)Shelf life: 1 year
Storage: not below +5˚CInstallation: (+23˚C / 50% r. h. up to 1 mm adhesive thickness dependent on climatic conditions and adhesive layer thickness).Shelf life: 1 year
Storage: not below +5˚CCoverage: 2m2/600ml sausage (beaded application) Shelf life: 1 year
| SikaBond® Silent Layer Mat
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet50368 5055047210252 - 25m Single 1655606 5055047210269 - 20m Single 11
SikaBond® Silent Layer Mat is a footfall sound reducing polyethylene mat for use with SIKABOND® gun grade adhesives.
Available 3mm or 5mm thick, and 3 differing sizes to cover 12.5m2, 20m2, 25m2. Ideal for use with SikaBond®-52 Wood
Floor Gun Grade and SikaBond®-52 Wood Floor to deliver high performance insulation and adhesion for a variety of
flooring.
USES
n Fixation and insulation of hard flooring such as wood and laminate n Integral part of the Sika® AcouBond® System used
to bond solid wood boards and 3-ply engineered wood floors
Footfall sound reduction: Up to 16dbCoverage: SILENT0316: 3mm thick, 16.66m x 1.5m roll = 25m2; SILENT0513: 5mm thick, 13.33m x 1.5m roll = 20m2
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
* Special order only
20 Specialist Wood Floor Bonding
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet27784 7612894907285 Brown 13kg Single 33
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet183195 7612894760415 Brown 17kg Single 33
| SikaBond® AT-80
| SikaBond®-54 Wood Floor
| SikaBond® MS Wood Floor
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet466914 5055492700902 - 14kg Single 24
A high quality, trowel applied MS adhesive for bonding wooden floors to all common substrates, eliminating the need
for battens. The formulation is completely water and solvent-free thereby alleviating the likelihood of wooden boards
cupping or crowning. With an extended open time in excess of 40 minutes, this product is ideal for larger application
areas.
USES
n Trowel applied bonding of wood floors n For bonding directly to all common substrates like concrete, anhydrite,
chipboard, plywood, metal, ceramic tiles, and most natural stone floors n Suitable for use with all solid and engineered
wood types up to 180mm wide
| SikaBond®-5500 S
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet165745 5055047210177 - 16kg Single 44
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
A professional wood floor adhesive that is fast curing, solvent-free and elastic. A full stick down adhesive for both solid
and engineered wood floors. Reduces footfall noise. It is also suitable for use with sub-floor heating systems.
USES
n For full surface wood floor bonding n For bonding solid and engineered wood n Suitable for use with most common
types of wood n Suitable for use with underfloor heating
A 1-part easy to use, solvent-free, elastic wood floor bonding system. Can be laid on all mineral substrates such as ce-
ment, wood, ceramic, metal, chipboard, OSB. Particularly suitable for full surface bonding of solid and engineered boards
and mosaic and industrial parquets.
USES
For surface bonding of wood flooring systems including: n Solid and engineered wood floors (strips, longstrips, planks,
panels and boards) n Mosaic and industrial parquet n Wood paving (residential) and chipboard
Storage: not below +5˚CCoverage: 600g/m2 (minimum); Approximately: 18 – 20m2 / pailShelf life: 1 year
Storage: not below +5˚CCoverage: 750g/m2 (minimum), approximately 15 – 80m2 / pailShelf life: 1 year
A solvent based rigid adhesive for bonding wood block parquet and engineered boards onto porous substrates. Ideal for
full surface bonding of wood flooring systems including hardwood, mosaic parquet and industrial use engineered wood
floors. It does not require the complete removal of bitumen and can also be used over underfloor heating installations.d.
USES
n Bonding of hardwood, mosaic parquet and industrial use engineered wood floors n For refurbishment projects where
bitumen adhesive residues are present n Over underfloor heating installations
Storage: not below +5˚CCoverage: 800g/m2 (minimum), approximately 18 – 20m2 / pailShelf life: 1 year
Storage: not below +5˚CCoverage: 800g/m2 (minimum), approximately 18 – 20m2 / pailShelf life: 1 year
21Specialist Wood Floor Bonding
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet57452 7612894581065 - 10kg Single 45
Solvent-free, water dispersed 2-part primer based on epoxy resin used to promote adhesion on new concrete,
cementitious screeds, hardened concrete, existing floor coatings, EpoCem® levelling layers. Easy and fast to apply primer
that is odourless so can be applied in unventilated areas. Especially suitable for highly absorbent substrates.
USES
As a primer and adhesion promoter on properly prepared: n New concrete n Cementitious screeds n Hardened concrete n
Existing epoxy floor coatings n EpoCem® levelling layers n As a primer for Sikafloor®-81 EpoCem® and Sikafloor® Level®-25
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet165745 5055047210177 - 10kg Single 44
7377 7611237126406 - 23kg Single 50
| Sikafloor®-81 EpoCem®
| Sikafloor®-155WN
A 3-part, epoxy modified cementitious, fine textured mortar for use as a temporary damp-proof membrane (min. 2mm
thick), prior to the application of SikaBond® Primer-MB. Can be applied onto green concrete, flood damaged concrete or
where no physical membrane exists. Please see technical data sheets for more details.
USES
n As a Temporary Moisture Barrier (TMB) (min. 2 mm thick) under Epoxy, Polyurethane and PMMA resin floors, over high
moisture content substrates, even green concrete n As a selfsmoothing screed n Extended with quartz sand, as a patching
and repair mortar n Designed for use on cementitious
Storage: not below +5˚CCoverage: 0.3 - 0.5 kg/m2/coat. (2 - 3.3 m2/kg/coat). All values indicated above are internal test results according to DIN 52615 and EN 13892-8. Conforms to the requirements of EN - 13813 SR - B 1.5 Shelf life: 1 year
Storage: not below +5˚CCoverage: approx. 2.25 kg/m2/mm; approx. 4.5 kg/ m2 for a 2mm thick application (minimum as a moisture barrier)Shelf life: 1 year
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet102547 - - - Single 1
| Sika® Barrel GunThe Foil Pack applicator gun is designed for use with foil packs, the enclosed aluminium barrel can also be used for standard cartridges.USES
n As a Temporary Moisture Barrier (TMB) (min. 2 mm thick) under Epoxy, Polyurethane and PMMA resin floors, over high
moisture content substrates, even green concrete n As a selfsmoothing screed n Extended with quartz sand, as a patching
and repair mortar n Designed for use on cementitious
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
22 Specialist Wood Floor Bonding
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet499307 7612894751420 - 3 litre Single 210
| Sika® Thinner CA xylene based thinner and an activating solvent cleaner. It can also be used as a general purpose solvent for cleaning
adhesive from tools and floors etc.
USES
n Component of priming systems n Modification of membrane viscosity n Cleaning of application equipment n Re-
activation of over-exposed membranes
Storage: not below +5˚CCoverage: approx. 250ml/m2
| Sika® Remover-208
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet34288 400392313400 - 1 litre 4 300
A solvent based cleaner for removing traces of uncured adhesives or sealants from application tools or from soiled wood
floors. Also effective as a pre-cleaner for strongly contaminated non-porous substrates and to clean painted surfaces
prior to bonding.
USES
n To remove uncured excess material adhesives or sealants from application tools or from soiled surfaces n For pre-
cleaning of strongly contaminated non-porous substrates n To clean painted surfaces prior to bonding
Storage: not below +5˚CCoverage: 750g/m2 (minimum), approximately 15 – 80m2 / pail
| Sika® Hand Wipes
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet104885 - - 100 wipes N/A 192115767 - - 100 wipes refill N/A 252
Specially designed to easily remove uncured Sikaflex® and SikaBond® products from hands. They can also be used for removing uncured materials from tools and other surfaces, in this handy wipe form they allow for mess free cleaning and easy disposal. Each tub holds 100 wipes.USES
n Clean wet and semi-cured paints, sealants, adhesives, bitumen’s, polyurethanes, expanding foams, polyester fillers and
epoxies from hands, tools and surfaces
Storage: not below +5˚CShelf life: 1 year (if unopened)
Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet180934 - - 10 litre Single 50
| Sika® Thinner EGA dilutent that is mixed with SikaBond®-5500 S at a ratio of 1:1 by volume as a primer over embedded under floor heating
systems prior to the application of the wood block flooring. Quick drying and easy to roller.
USES
n As a primer over embedded under floor heating systems prior to the application of the wood block flooring n Cleaning
of application equipment
Storage: not below +5˚CCoverage: approx. 250ml/m2
All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.
23Explanation of Pictograms
The product fallsIn the said
GISCODE group
BA
2-part product
For interior floors
DIN18 365The corresponding
DIN standard is applicable
Mechanically high loadable
Blue Angel
Steel spatulaNotched trowel Spatula Product hardens fast
Possible to use in combination with underfloor heating
Pinsel
The product fallsIn the said
GISCODE group
The product fallsIn the said
GISCODE group
SCHÖNOX GmbHD-48720 Rosendahl
Product is clearly building permitted.
Suitable for marine equipment
Suitable for castor wheel loading according to DIN
EN 12 529
Reduces dust
Roller
The product complies with the criteria of the above-mentioned GEV emicode
CE-identification
For interior and exterior floors
For interior floors and walls
Product-/Processing Characteristics
Seal of Approval
Areas of Applications
24 Standard Terms and Conditions of Sales of Goods Sold by Sika Limited
1. INTERPRETATION
IntheseTermsandConditionsthefollowingexpressionswillhavethefollowingmeaningsunlessinconsistentwiththecontext:
“BespokeGoods”meansanyGoodswhicharemadetomeasure,bespoke,orotherwisemanufacturedtoauniquespecification.
“Buyer”theperson(s),firmorcompanywhoseorderfortheGoodsorServicesisacceptedbytheCompanyinaccordancewiththeseTermsandConditions.
“Company”SikaLimited(Companynumber:226822)whoseregisteredofficeislocatedatWatchmead,WelwynGardenCity,Herts,AL71BQandwhoseSikaSarnafiloperatingofficeislocatedatWatchmead,WelwynGardenCity,Herts,AL71BQ.
“ConfidentialInformation”meansallinformationinrespectofthebusinessoftheCompanyincluding,butnotlimitedto,know-how,pricesorothermattersconnectedwiththeGoodsorServices(whichshallincludeanyinstructionsorprocedures,instructionmanuals,userguidesandotherinformationwhichissuppliedbytheCompanywiththeGoodsorServices)andanyotherinformationofwhatevernaturewhich,ifdisclosed,willbeliabletocauseharmtotheCompany.
“Contract”anycontractbetweentheCompanyandtheBuyerforthesaleandpurchaseoftheGoodsorServicesformedinaccordancewithCondition2.
“DeliveryPoint”theplacewheredeliveryoftheGoodsisagreedtotakeplace,assetoutintheCompany’swrittenacknowledgementoforder.
“FinalInspectionCertificate”ACertificateissuedforthebenefitofathirdpartyatthecompletionoftheServices.
“Goods”anygoodswhichtheCompanysuppliestotheBuyer(includinganyofthemoranypartofthem)underaContract.
“Guarantee”aguaranteeorFinalInspectionCertificatefororrelatedtotheGoodsinaformtobeprovidedbytheCompanyinfavourofathirdpartynominatedbytheBuyer.
“GuaranteePeriod”theon-goingperiodofprotectionprovidedtoathirdpartyassetoutinaGuarantee.
“IntellectualPropertyRights”allintellectualandindustrialpropertyrightsincludingpatents,know-how,registeredtrademarks,registereddesigns,utilitymodels,applicationsforandrightstoapplyforanyoftheforegoing,unregistereddesignrights,unregisteredtrademarks,rightstopreventpassingoffforunfaircompetitionandcopyright,databaserights,topographyrightsandanyotherrightsinanyinvention,discoveryorprocess,ineachcaseintheUnitedKingdomandallothercountriesintheworldandtogetherwithallrenewalsandextensions
“Services”anyserviceswhichtheCompanyperformsfortheBuyerunderaContract,whichareancillarytothesupplyofGoods.
“ServicePoint”theplaceatwhichtheServicesaretobeperformed,assetoutintheCompany’swrittenacknowledgementoforder.
“SpecificDeliveryRequirement”anygoods,whicharerequiredtobedeliveredbyatypeofvehiclespecifiedbytheBuyer.
“TermsandConditions”thestandardtermsandconditionsofsalesetoutinthisdocumenttogetherwithanyspecialtermsagreedinwritingbetweentheBuyerandtheCompany.
“Trademark”theSARNAFILtrademarkregisteredintheUnitedKingdomundertrademarknumber1046240.
“WorkingDay”anydayotherthanSaturdayorSundayorapublicorbankholidayinEngland.
2. FORMATION AND INCORPORATION
2.1 SubjecttoanyvariationunderCondition14.5,the
ContractwillbeupontheseTermsandConditions,totheexclusionofallothertermsandconditionsandallpreviousoralorwrittenrepresentationsincludinganytermsorconditionswhichtheBuyerpurportstoapplyunderanypurchaseorder,confirmationoforderorsimilardocument,whetherornotsuchdocumentisreferredtointheContract.
2.2 EachorderoracceptanceofaquotationforGoodsorServiceswillbedeemedtobeanofferbytheBuyertopurchaseGoodsorServicesupontheseTermsandConditions.TheContractisformedwhentheBuyerreceivesconfirmationthattheorderisacceptedbytheCompany.Suchconfirmationmayeitherbegivenorallyorinwriting.NocontractwillcomeintoexistenceuntilsuchconfirmationhasbeengivenbytheCompany.
2.3 TheBuyermustensurethatthetermsofitsorderandanyapplicablespecificationarecompleteandaccurate.
2.4 AcceptanceofdeliveryoftheGoodsorcommencementoftheperformanceoftheServiceswillbedeemedconclusiveevidenceoftheBuyer’sacceptanceoftheseTermsandConditions.
2.5 SubjecttoCondition6.5,theBuyermaynotcanceltheContract.TheCompanymaycanceltheContractatanytimepriortodeliveryoftheGoodsorcommencementoftheperformanceoftheServices.
3. DESCRIPTION OF THE GOODS AND SERVICES
3.1 ThedescriptionoftheGoodswillbeassetoutintheCompany’spricelist.Allsamples,drawings,descriptivematter,specificationsandadvertisingissuedbytheCompanyandanydescriptionsorillustrationscontainedintheCompany’scataloguesorbrochuresareissuedorpublishedforthesolepurposeofgivinganapproximateideaoftheGoodsrepresentedbyordescribedinthem.TheywillnotformpartoftheContractandthisisnotasalebysample.
3.2 TheCompanymaymakeanychangetothespecification,design,materialsorfinishesoftheGoodswhichare:
3.2.1 requiredtoconformwithanyapplicablesafety,statutoryorregulatoryrequirement;or
3.2.2 donotmateriallyaffecttheirqualityorperformance.
3.3 TheCompanywillonlyperformServiceswhichareancillaryto,orrelatingto,GoodsprovidedunderaContract.
3.4 TheServiceswillonlybeperformedbytheCompanyattheServicePoint.
3.5 TheCompanyshalluseallreasonableendeavourstoperformtheServices:
3.5.1 tothestandardrequiredfortheissueofaFinalInspectionCertificate;
3.5.2 promptly,buttimeshallnotbetheessencefortheperformanceoftheServices.
3.6 TheCompanyshallhavetherighttomakeanychangestotheServiceswhicharenecessarytocomplywithapplicablesafety,statutoryorregulatoryrequirements,orwhichdonotmateriallyaffectthenatureorqualityoftheServices,andtheCompanyshallnotifytheBuyerinanysuchevent.
4. PRICE AND PAYMENT
4.1 ThepricefortheGoodsorServiceswillbethepricesetoutintheCompany’spublishedpricelistcurrentatthedateofdeliveryofGoodsorperformanceofServicesorasotherwisenotifiedbytheCompanytotheBuyerpriortotheContractbeingmade.OrdersforGoodsvaluedbelow£2000(beforeVAT)areexclusiveofanycostsofpackagingandcarriage,VATandanyotherapplicablesalestaxordutywhichwillbeaddedtothesuminquestion.OrdersforGoodsvaluedgreaterthan£2000(beforeVAT)andwhicharetobedispatchedfromtheCompany’swarehousewithintheUnitedKingdomareinclusiveofanycostsofpackagingandcarriagewithintheUnitedKingdombutexclusiveofVATandanyotherapplicablesalestaxordutywillbeaddedtothesuminquestion.
4.2 TheCompanymayinvoicetheBuyerfortheGoodsonoratanytimeafterdispatch,orfortheServicesonoratanytimeafterperformancecommencesandpaymentisdueinpoundssterlingbythelastdayofthenextcalendarmonthfollowingthedateofinvoice,oruponterminationoftheContract,whicheveroccursfirst.
4.3 Timeforpaymentwillbeoftheessence.Nopayment
willbedeemedtohavebeenreceiveduntiltheCompanyhasreceivedclearedfunds.
4.4 AllpaymentstobemadebytheBuyerundertheContractwillbemadeinfullwithoutanyset-off,restrictionorconditionandwithoutanydeductionfororonaccountofanycounterclaim.
4.5 IfanysumpayableundertheContractisnotpaidwhenduethen,withoutprejudicetotheCompany’sotherrightsundertheContract:thatsumwillbearinterestfromtheduedateuntilpaymentismadeinfull,bothbeforeandafteranyjudgment,atacombinedrateoftheBankofEnglandbaseratefromtimetotimeandtherateprovidedbytheLatePaymentofCommercialDebts(Interest)Act1998asamendedfromtimetotime;andtheCompanywillbeentitledtosuspenddeliveriesoftheGoodsorperformanceoftheServicesuntiltheoutstandingamounthasbeenreceived.
4.6 TheCompanyreservestherighttorecoupanysum,resultingfromcostsincurredfromlegalproceedingstorecoverthesumpayableundertheContract.
4.7 AnyinvoicequeriesmustbecommunicatedtotheCompanywithin10(ten)WorkingDaysofreceiptoftheinvoicebytheBuyer.
5. INSTALMENTS
TheCompanymaydelivertheGoods,orperformServices,byseparateinstalments.EachinstalmentwillbeaseparateContractandnocancellationorterminationofanyoneContractrelatingtoaninstalmentwillentitletheBuyertorepudiateorcancelanyotherContractorinstalmentunlessotherwisenotifiedbytheCompany.EachseparateinstalmentwillbeinvoicedandpaidforinaccordancewiththeprovisionsoftheContract.
6. DELIVERY OF GOODS
6.1 DeliveryoftheGoodswithintheUKmainlandwillbeCPTDeliveryPointINCOTERMS2010(savethatcarriagemaybechargedtotheBuyerinaccordancewithCondition6.4and/orCondition6.5).
6.2 DeliveryoftheGoodstoNorthernIreland,theScottishIsles,theChannelIslandsortheIsleofManwillbemadeFOBDeliveryPointINCOTERMS2010.
6.3 DeliveryoftheGoodsoutsidetheUKwillbemadeFASDeliveryPointINCOTERMS2010,exceptthatriskshallpasstotheBuyeratthetimethattheGoodsleavetheCompany’spremises.
6.4 DeliveryoftheGoodswillbeacceptedatanytimeofday.AtthesolediscretionoftheCompany,overnightdeliveriesordeliveriesatspecifiedtimesmaybeagreedincertaincircumstances.Notwithstandingcondition6.1,suchdeliveriesshallbesubjecttoanadditionalchargebeingraisedbytheCompany.IftheBuyerfailstotakedelivery,orprovideanynecessarydocuments,theGoodswillbedeemedtohavebeendeliveredandtheCompany,withoutprejudicetoitsotherrights,mayatitsoption:
6.4.1 storeorarrangeforstorageoftheGoodsuntilactualdeliveryorsaleandchargetheBuyerforallrelatedcostsandexpenses(including,withoutlimitation,storageandinsurance);and/or
6.4.2 followingwrittennoticetotheBuyer,sellanyoftheGoodsatthebestpricereasonablyobtainableinthecircumstancesandchargetheBuyerforanyshortfallbelowthepriceundertheContract.
ExcessivewaitingtimesmayalsobechargedtotheBuyerincertaincircumstances.
6.5 TheCompanywillusereasonableendeavourstodeliverGoods5(five)WorkingDaysafterthedateonwhichtheorderisconfirmedbytheCompany,butthetimeofdeliverywillnotbeoftheessenceofaContract.Notwithstandingcondition6.1,carriagewillbechargedondeliveriesrequiredwithin5(five)WorkingDays,ordeliverieswithspecifictimeorvehicletypestipulations.If,despitethoseendeavours,theCompanyisunableforanyreasontofulfilanydeliveryofGoodsonaspecifieddate,theCompanywillbedeemednottobeinbreachoftheContract,nor(fortheavoidanceofdoubt)willtheCompanyhaveanyliabilitytotheBuyerfordirect,indirectorconsequentialloss(allthreeofwhichtermsincludes,withoutlimitation,pureeconomicloss,lossofprofits,lossofbusiness,depletionofgoodwillandlikeloss)howsoevercaused(includingasaresultofnegligence)byanydelayorfailureindeliveryofGoodsexceptassetoutinthiscondition.AnydelayindeliveryofGoodswillnotentitletheBuyertocanceltheorder
25
unlessanduntiltheBuyerhasgiven10(ten)WorkingDays’writtennoticetotheCompanyrequiringthedeliveryoftheGoodsandtheCompanyhasnotfulfilledthedeliveryoftheGoodswithinthatperiod.IftheBuyercancelstheorderinaccordancewiththisCondition6.5then,saveasexcludedunderCondition6.6:
6.5.1 theCompanywillrefundtotheBuyeranysumswhichtheBuyerhaspaidtotheCompanyinrespectoftheGoodswhichhavebeencancelled;
6.5.2 andtheBuyerwillbeundernoliabilitytomakeanyfurtherpaymentsunderCondition4inrespectoftheGoodsthathavebeencancelled.
6.6 Notwithstanding,theprovisionsofCondition6.5,theCompanywillbeundernoobligationto:
6.6.1 torefundtheBuyeranysumswhichtheBuyerhaspaidtotheCompanyinrespectoftheBespokeGoodswhichhavebeencancelledunderCondition6.5;and
6.6.2 waiveanyoutstandingfurtherpaymentsduebytheBuyerinrespectofBespokeGoodswhichhavebeencancelledunderCondition6.5.
6.7 TheBuyerwillprovideatitsexpenseattheDeliveryPointadequateandappropriateequipmentandmanuallabourforoff-loadingtheGoods.
6.8 A£10.00handlingchargewillbemadeinadditiontothecarriagechargeforovernightdispatchofGoods.Thisserviceisofferedasresourcesallowandissubjecttoavailabletransport.
6.9 ThetypeofvehicleusedtodeliverGoodsandthemethodofpackagingoftheGoodsfordeliverywillbeatthediscretionoftheCompany.
6.10 AnychangerequiredbytheBuyertothedeliveryvehicleand/orthemethodofpackagingtheGoodsfordeliveryselectedbytheCompanywillconstituteaSpecificDeliveryRequirement.TheBuyerwillincuranyadditionalcostsforaSpecificDeliveryRequirement.
6.11 TheBuyerwillprovideafullandcorrectaddress,includingpostcode,forthedeliveryoftheGoods.
7. RISK/TITLE IN THE GOODS
7.1 RiskofdamagetoorlossoftheGoodswillpasstotheBuyerinaccordancewithCondition6.
7.2 OwnershipoftheGoodswillnotpasstotheBuyeruntiltheCompanyhasreceivedinfull(incashorclearedfunds)allsumsduetoitinrespectof:
7.2.1 theGoods;and
7.2.2 allothersumswhichareorwhichbecomeduetotheCompanyfromtheBuyeronanyaccount,whetherforGoodsorServices.
7.3 UntilownershipoftheGoodshaspassedtotheBuyer,theBuyermust:
7.3.1 holdtheGoodsonafiduciarybasisastheCompany’sbailee;
7.3.2 storetheGoods(atnocosttotheCompany)separatelyfromallotherGoodsoftheBuyeroranythirdpartyinsuchawaythattheyremainreadilyidentifiableastheCompany’sproperty;
7.3.3 notdestroy,defaceorobscureanyidentifyingmarkorpackagingonorrelatingtotheGoods;and
7.3.4 maintaintheGoodsinsatisfactoryconditioninsuredontheCompany’sbehalffortheirfullpriceagainstallriskstothereasonablesatisfactionoftheCompany,andwillwheneverrequestedbytheCompanyproduceacopyofthepolicyofinsurance.
7.4 TheBuyermayreselltheGoodsbeforeownershiphaspassedtoitsolelyonthefollowingconditions:
7.4.1 anysalewillbeeffectedintheordinarycourseoftheBuyer’sbusinessatfullmarketvalueandtheBuyerwillaccounttotheCompanyaccordingly;and
7.4.2 anysuchsalewillbeasaleoftheCompany’spropertyontheBuyer’sownbehalfandtheBuyerwilldealasprincipalwhenmakingsuchasale.
7.5 TheBuyer’srighttopossessionoftheGoodswillterminateimmediatelyifanyofthecircumstancessetoutinCondition11.1occur.
7.6 TheCompanywillbeentitledtorecoverpaymentfortheGoodsnotwithstandingthattitleinanyoftheGoodshasnotpassedfromtheCompany.
7.7 TheBuyergrantstheCompany,itsagentsandemployeesanirrevocablelicenceatanytimeto
enteranypremiseswheretheGoodsareormaybestoredinordertoinspectthem,or,wheretheBuyer’srighttopossessionhasterminated,torecoverthem.
7.8 WheretheCompanyisunabletodeterminewhetheranyGoodsarethegoodsinrespectofwhichtheBuyer’srighttopossessionhasterminated,theBuyerwillbedeemedtohavesoldallgoodsofthekindsoldbytheCompanytotheBuyerintheorderinwhichtheywereinvoicedtotheBuyer.
7.9 OnterminationoftheContract,howsoevercaused,theCompany’s(butnottheBuyer’s)rightscontainedinthisCondition7willremainineffect.
8. LIABILITY OF COMPANY
8.1 TheCompanywill,freeofcharge,withinaperiodof12monthsfromthedateofdeliveryofGoods,orwhereaGuaranteehasbeenissued,fortheGuaranteePeriod,whichareprovedtothereasonablesatisfactionoftheCompanytobemissing,damagedordefectiveduetodefectsinmaterialordesign(otherthanadesignmade,furnishedorspecifiedbytheBuyer),repair,oratitsoptionprovideorreplace,suchGoods.Thisobligationwillnotapplywhere:
8.1.1 theGoodshavebeenimproperlyalteredinanywaywhatsoever,orhavebeensubjecttomisuseorunauthorisedrepair;
8.1.2 theGoodshavebeenimproperlyinstalledorconnected;
8.1.3 anymaintenancerequirementsrelatingtotheGoodshavenotbeencompliedwith;
8.1.4 theBuyerhasfailedtonotifytheCompanyofanydefect(s)ormissingitem(s)fromtheorderacknowledgementwithin48hoursofdeliverywherethedefect(s)ormissingitem(s)shouldbeapparentonreasonableinspection,orwithin48hoursofthesamecomingtotheknowledgeoftheBuyerwherethedefect(s)ormissingitem(s)isnotthatwhichshouldbeapparentonreasonableinspection,andinanyeventnolaterthan12monthsfromthedateofdelivery;
8.1.5 whereaguaranteehasbeenissued,andhasbeenbreachedbythethirdpartybeneficiaryoftheGuaranteewithintheGuaranteePeriod
8.2 AnyGoodswhichhavebeenreplacedbytheCompanywillbelongtotheCompany.AnyrepairedorreplacementGoodswillbeliabletorepairorreplacementunderthetermsspecifiedinCondition8.1fortheunexpiredportionofthe12monthperiodfromtheoriginaldateofdeliveryofthereplacedGoodsorwhereaGuaranteehasbeenissued,fortheGuaranteePeriod.
8.3 IntheeventofanybreachoftheCompany’sexpressobligationsunderConditions6.5,8.1and8.2abovetheremediesoftheBuyerwillbelimitedtodamages.
8.4 TheCompanydoesnotexcludeitsliability(ifany)totheBuyer:
8.4.1 forbreachoftheCompany’sobligationsarisingundersection12SaleofGoodsAct1979orsection2SupplyofGoodsandServicesAct1982;
8.4.2 forpersonalinjuryordeathresultingfromtheCompany’snegligence;
8.4.3 undersection2(3)ConsumerProtectionAct1987;
8.4.4 foranymatterwhichitwouldbeillegalfortheCompanytoexclude(ortoattempttoexclude)itsliability;or
8.4.5 forfraud.
8.5 ExceptasprovidedinConditions6.5and8.1to8.4,theCompany’sliabilitytotheBuyer(whetherincontract,tort(includingnegligence),breachofstatutoryduty,restitutionorotherwise)foranyinjury,death,damageordirect,indirectorconsequentialloss(allthreeofwhichtermsinclude,withoutlimitation,pureeconomicloss,lossofprofits,lossofbusiness,depletionofgoodwillandlikeloss)howsoevercausedarisingoutoforinconnectionwith:
8.5.1 anyoftheGoods,orthemanufactureorsaleorsupply,orfailureordelayinsupply,oftheGoodsbytheCompanyoronthepartoftheCompany’semployees,agentsorsub-contractors;
8.5.2 anyoftheServices,ortheirperformance,orfailureordelayinperformance,oftheServices
bytheCompanyoronthepartoftheCompany’semployees,agentsorsub-contractors;
8.5.3 anybreachbytheCompanyofanyoftheexpressorimpliedtermsoftheContract;
8.5.4 anyusemadeorresalebytheBuyerofanyoftheGoods,orofanyproductincorporatinganyoftheGoods;
8.5.5 anyusemadebytheBuyerofanyoftheServices,orofanyproductincorporatinganyoftheServices;or
8.5.6 anystatementmadeornotmade,oradvicegivenornotgiven,byoronbehalfoftheCompanyorotherwiseundertheContract,
shallbelimitedtotheinvoicedvalueoftheGoods.
8.6 ExceptassetoutinConditions6.5and8.1to8.5,theCompanyherebyexcludestothefullestextentpermissibleinlaw,allconditions,warrantiesandstipulations,express(otherthanthosesetoutintheContract)orimplied,statutory,customaryorotherwisewhich,butforsuchexclusion,wouldormightsubsistinfavouroftheBuyer.
8.7 EachoftheCompany’semployees,agentsandsub-contractorsmayrelyuponandenforcetheexclusionsandrestrictionsofliabilityinConditions6.5and8.3to8.6inthatperson’sownnameandforthatperson’sownbenefit,asifthewords“itsemployees,agentsandsub-contractors”followedthewordCompanywhereveritappearsinthoseconditionssaveeachreferenceinCondition8.5.1.
8.8 TheBuyeragreestoindemnify,keepindemnifiedandholdharmlesstheCompanyfromandagainstallcosts(includingthecostsofenforcement),expenses,liabilities(includinganytaxliability),injuries,direct,indirectorconsequentialloss(allthreeofwhichtermsinclude,withoutlimitation,pureeconomicloss,lossofprofits,lossofbusiness,depletionofgoodwillandlikeloss),damages,claims,demands,proceedingsorlegalcosts(onafullindemnitybasis)andjudgmentswhichtheCompanyincursorsuffersasaconsequenceofadirectorindirectbreachornegligentperformanceorfailureordelayinperformancebytheBuyerofthetermsoftheContract.WhereaGuaranteehasbeenissued,suchindemnityshallcontinueuntiltheendoftheGuaranteePeriod.
9. GUARANTEE
9.1 WheretheCompanyprovidesaWarrantyadditionaltotheguaranteeinConditon8hereof,theBuyermayrequestthattheWarrantybeprovidedinfavourofaninterestedthirdpartynominatedbytheBuyer.
9.2 TheWarrantyshallbeonsuchtermsandinsuchformastheCompanyconsidersappropriate.
9.3 TheWarrantyshallonlybeprovidedwhenallpaymentsduefromtheBuyerhavebeenreceivedandifinassociationwithaFinalInspectionCerficate,whentheCompanyhasbeengivenallreasonableopportunitytocarryoutatechnicalaudit..
9.4 TheBuyeracknowledgesthatintheeventofaclaimbeingbroughtagainsttheCompanyunder,andinaccordancewiththetermsofaWarranty,whichissolelyorpartiallyduetotheinstallationoftheGoodsnothavingbeencarriedoutinaccordancewiththeCompany’srecommendationsorwiththeskillandcareexpectedofanexperiencedcontractor,theBuyershallindemnifytheCompanyandshall;
9.4.1 recognisethecontinuingobligationsoftheCompanyandtheBuyertoremedydefectsintheGoodsfortheGuaranteePeriod;and
9.4.2 notseektorelyonand,ifandtotheextentnecessary,expresslywaiveanyentitlementtorelyontheprovisionsoftheLimitationAct1980indefenceofsuchclaim.
10. FORCE MAJEURE
TheCompanywillnotbeliabletotheBuyerforanyfailureordelayorfortheconsequencesofanyfailureordelayinperformanceoftheContract,ifitisduetoanyeventbeyondthereasonablecontroloftheCompanyincluding,withoutlimitation,actsofGod,war,industrialdisputes,protests,fire,tempest,explosion,anactofterrorismandnationalemergenciesandtheCompanywillbeentitledtoareasonableextensionoftimeforperformingsuchobligationsinsuchcircumstances.
26
11. TERMINATION
11.1 TheCompanymaybywrittennoticeterminatetheContractimmediatelyiftheBuyer:
11.1.1 isinmaterialbreachofanyofthetermsoftheContract.FailuretopayanysumsdueinaccordancewithCondition4.2isamaterialbreachofthetermsoftheContractwhichisnotcapableofremedy.
11.1.2 becomesbankrupt,insolvent,makesanycompositionwithhiscreditors,hasareceiverappointedundertheMentalHealthAct1983ordies;
11.1.3 hasanydistraint,executionorotherprocessleviedorenforcedonanyofitsproperty;
11.1.4 ceasestotradeorappearsinthereasonableopinionoftheCompanylikelyoristhreateningtoceasetrade;
or
11.1.5 theequivalentofanyoftheaboveoccurstotheBuyerunderthejurisdictiontowhichtheBuyerissubject.
11.2 TheterminationoftheContracthowsoeverarisingiswithoutprejudicetotherights,dutiesandliabilityofeithertheBuyerortheCompanyaccruedpriortotermination.Theconditionswhichexpresslyorimpliedlyhaveeffectafterterminationwillcontinuetobeinforcenotwithstandingtermination,whichshallincludebutshallnotbelimitedto,theBuyer’sobligationsinrelationtoanyGuarantee.
12. INTELLECTUAL PROPERTY
12.1 NorightorlicenceisgrantedtotheBuyerinrespectoftheexistingIntellectualPropertyRightsoftheCompany,excepttherighttouse,orre-selltheGoodsintheBuyer’sordinarycourseofbusiness.
12.2 AllIntellectualPropertyRightsinorarisingoutoforinconnectionwiththeperformanceofServicesshallbeownedbytheCompany.
12.3 TheBuyerwillnotwithouttheCompany’spriorconsentallowtheTrademarkoranyothertrademarksoftheCompanyorotherwordsormarksappliedtotheGoodstobeobliterated,obscuredoromittednorwillheaddanyadditionalmarksorwords.
13. DISTRIBUTION
13.1 IftheBuyerpurchasestheGoodsandresellsthemthentheCompanyshallhavenoliabilityfornorshallanyindemnityfromtheCompanytotheBuyerinthesetermsapplytoanyliabilityoftheBuyertotheextentthatsuchliabilitywouldnothaveexistedhadtheBuyersoldthegoodsupontermsnolessfavourablethanthesetermsandconditions.
14. GENERAL
14.1 TimeforperformanceofallobligationsoftheBuyerisoftheessence.TimeforperformanceofallobligationsoftheCompanyisnotoftheessence.
14.2 EachrightorremedyoftheCompanyundertheContractiswithoutprejudicetoanyotherrightorremedyoftheCompanywhetherundertheContractornot.
14.3 IfanyconditionorpartoftheContractisfoundbyanycourt,tribunal,administrativebodyorauthorityofcompetentjurisdictiontobeillegal,invalidorunenforceablethenthatprovisionwill,totheextentrequired,beseveredfromtheContractandwillbeineffective,without,asfarasispossible,modifyinganyotherprovisionorpartoftheContractandthiswillnotaffectanyotherprovisionsoftheContractwhichwillremaininfullforceandeffect.
14.4 NofailureordelaybytheCompanytoexerciseanyright,powerorremedywilloperateasawaiverofit,norwillanypartialexerciseprecludeanyfurtherexerciseofthesame,orofanyotherright,powerorremedy.
14.5 SaveassetoutintheContractandCondition8.1.5,theseTermsandConditionsmayonlybevariedoramendedinwritingandsignedbyaseniormanageroftheCompany.
14.6 TheCompanymayassign,delegate,license,holdontrustorsub-contractalloranypartofitsrightsorobligationsundertheContract.
14.7 TheContractispersonaltotheBuyerwhomaynotassign,delegate,license,holdontrustorsub-
contractalloranyofitsrightsorobligationsundertheContractwithouttheCompany’spriorwrittenconsent.
14.8 TheContractcontainsallthetermswhichtheCompanyandtheBuyerhaveagreedinrelationtotheGoodsand/orServicesandsupersedesanypriorwrittenororalagreements,representationsorunderstandingsbetweenthepartiesrelatingtosuchGoodsand/orServices.TheBuyeracknowledgesthatithasnotreliedonanystatement,promiseorrepresentationmadeorgivenbyoronbehalfoftheCompanywhichisnotsetoutintheContract.NothinginthisCondition14.8willexcludeanyliabilitywhichonepartywouldotherwisehavetotheotherpartyinrespectofanystatementsmadefraudulently.
14.9 SaveassetoutinCondition8.7thepartiestotheContractdonotintendthatanyofitstermswillbeenforceablebyvirtueoftheContracts(RightsofThirdParties)Act1999byanypersonnotapartytoit.
14.10 AnynoticeinconnectionwiththeContractwillbeinwritingaddressedtotheotherpartyatitsregisteredoffice,orprincipalplaceofbusinessandwillbedeliveredbyhand,orfirstclassorspecialdeliverypostorAirmail.Thenoticewillbedeemedtohavebeendulyserved,ifdeliveredbyhand,whenleftattheproperaddressforserviceorifmadebypre-paid,firstclasspostorspecialdeliverypost,48hoursafterbeingpostedorinthecaseofAirmail,14daysafterbeingposted.
14.11 Theformation,existence,construction,performance,validityandallaspectswhatsoeveroftheContractorofanytermoftheContractwillbegovernedbyEnglishlaw.TheEnglishcourtswillhaveexclusivejurisdictiontosettleanydisputewhichmayariseoutof,orinconnectionwiththeContract.Thepartiesagreetosubmittothatjurisdiction.
14.12 WherePartIIoftheHousingGrants,ConstructionandRegenerationAct1996applies,eitherpartymayreferanydisputeordifferencearisingunderthisAgreementtoadjudication.TheadjudicationproceduresandtheagreementfortheappointmentofanadjudicatorshallbesetoutintheModelAdjudicationProcedurespublishedbytheConstructionIndustryCouncilcurrentatthedateofreference.ThenominatingbodyshallbetheTechnologyandConstructionSolicitors’Associationoranysuccessororganisation.
14.13 TheBuyerwillkeepconfidentialanyandallConfidentialInformationthatitmayacquire.TheBuyerwillnotusetheConfidentialInformationforanypurposeotherthantoperformitsobligationsundertheContract.TheBuyerwillensurethatitsofficersandemployeescomplywiththeprovisionsofthisCondition14.13.TheobligationsontheBuyersetoutinthisConditionwillnotapplytoanyinformationwhichispubliclyavailableorbecomespubliclyavailablethroughnoactoromissionoftheBuyeroriftheBuyerisrequiredtodisclosebyorderofacourtofcompetentjurisdiction.
Revised24thNovember2015
E&OE
27INDEX
Quartz Sand 17
SCHÖNOX AP 9
SCHÖNOX APF 9
SCHÖNOX AST 9
SCHÖNOX DOUBLE STICK 15
SCHÖNOX DSP 10
SCHÖNOX DUROCOLL 14
SCHÖNOX EMICLASSIC 13
SCHÖNOX FPL PLUS 10
SCHÖNOX IFLOOR 14
SCHÖNOX LC POWDER & LIQUID 10
SCHÖNOX LINO XTREME 13
SCHÖNOX PU 900 14
SCHÖNOX RENOTEX 17
SCHÖNOX RR 11
SCHÖNOX SDG 7
SCHÖNOX SHP 7
SCHÖNOX SL 11
SCHÖNOX TACKIFIER 15
SCHÖNOX TS 17
SCHÖNOX UNITECH 13
SCHÖNOX VD 7
SCHÖNOX XA 9
SCHÖNOX ZM RAPID 10
Sika Barrel Gun 21
Sika Hand Wipes 22
Sika Remover-208 22
Sika Thinner C 22
Sika Thinner EG 22
Sika Tramex Hygrometer 17
Sika Tramex Moisture Meter 17
SikaBond AT-80 20
SikaBond MS Wood Floor 20
SikaBond MS Wood Floor Gun Grade 19
SikaBond Silent Layer Mat 19
SikaBond T2 Adhesive 19
SikaBond-52 Wood Floor 19
SikaBond-54 Wood Floor 20
SikaBond-5500 S 20
Sikafloor-155WN 21
Sikafloor-81 EpoCem 21
Sikafloor-156 7
Recommended