March 2, 2015 appeal the Summary Judgement and Go to Trial

Preview:

DESCRIPTION

Attached is an appeal to the summary judgement of which petitioner, Zylo Marshall, filed with the court on March 2, 2015.In this appeal,

Citation preview

lN RE: The Estate of Allan Haymes

cAsE No. 502010CF004252XXXXS8

APPEAL THE SUMMARY JUDGMENTAND GO TO TBIAL

IN THE CIRCUIT COURT OF THE 15TH 'UDICIALCIRCUIT IN AHD FOR PALM.BEACH COUNTY,

FLORIDA

PROBATE DIVISION

CASE NO: 5O2010CP004252xxxxSB

IN RE: ESTATE OF AI,I.AN HAYNE'

Dbceased.

ZYLO MARSHALL

Petitioner,

v.

LOIS M. HAYMES, as personal

Representative of the Estate of

ATLAN HAYMES, and CRAI6 DONOFF,

as Personal representative of the Estate

of ALIAN HAYMES

Respondents.

I

""&ffigpvfrUn r'!,eu#)Bgo"".

::HifsA, ;!:",*;{Zpirr!$

lN BE: The Estate of Allan HaymescAsE NO. 5020L0CP004252XXXX5B

APPEAL THE SUMMARY JUDGMENT ANO GO TO TRIAL

coMEs Now, Petitioner, Zylo Marshall, Pro Se, and hereby moves this Honorable court to strike the

summary judgment on the basis of mischaracterizing facts. This appeal presents an issue of first

impression in this circuit court to empower the circuit court and in support thereof, avers the foltowing:.

1. Exhibit 1 is an order granted for a summary judgment in favor of the respondents'. lN this order

as defined under THE COURT MAKES THESE FINDINGS OF FACT paragraph 2 states, 'The 2003

Will is a pour-over Will which direct that all assets of the decedent, Allan Haymes should be left

to the trustees of the Allan Haymes Bevocable Trust Agreement, Which Allan Hayrnes Also

executed on May 30, 2003 in conjunction with his execution of the 2003 Will."

Z. Exhibit 2 is the May 30, 2003 Will under ARTICLE lX APPOTNTMMENT OF PERSONAL

RtPRESENTATIVE Clause l appoints Carol Haymes as a personal Representative. Clause 2

appoints Mark Ertes as SUCCESSOR PERSONAL REPRESENTATTVE.

3. Exhibit 3 is the January 30, 20Og Wilt ARTICLE Vlll appoints Lois Haymes and Craig Donoff as

personal representative. And ARTICLE lll states, "l make no provisions for my grandsan, ZyLO

MARSHALL, for reasons best known to me.

As you can see ln the May 30, 2003 Will xCarol Haymes and Mark Ertes were personal representatives of

the pour-over Willand Lois Haymes was not even considered a beneficiary or a personal representative

in the May 30,2003

1 Carol Haymes and Mark Ertes would be the personal r€presentatives that would determine who the disabledbeneficiary is,

lN RE: The Estate of ,{llan HaymesCASE NO. 502010CP0M252XXXX5BAPPEAT THE SUMMARY JUDGMENT AND GO TO TRIALAs you can see in the January 30, 2009 Will zLois Hay?nes and Craig Donoff were the personal

representative.

4. Exhibit 2 of the May 30, 2003 will under ARTIVLE vt DtsABtLtw oF BENEFtctARy

L. CLAUSE 1, My Personal Representatiye in their discretion may bedetermined that a beneficiary hereunder is physically or mentallyincapable of properly using any property or income to which suchindividual is entitled.

2. CLAUSE 2 lf any beneficiary hereunder is under the age of Twenty-Five(25lyears or pursuant to Clause L hereof has been determined to beincapacitated, My personal Representative, during said incapacity, cruntil such beneficiary attains the age of Twenty-Five {25} years, as thecase may be, shall hold any property or income to which such individualis entitled, lN TRUST, for such individual and may apply without theintervention of a 3guardian all or part of the income and{ar principalthereof as in their opinion is necessary for the support, education,health and maintenance of such individual. The receipts from personsselected by myopersonal representafive to receive and disburse suchprincipal or incorne shall fully discharge my personal Representativewith regard thereof.

5. Exhibit 4 is an email from Matt Tornincasa to Zylo Marshall on April 4,2OL41.L before rhe April

L5,2OL4 Trial stating that they found a Will misplaced and was not in the possession of either

respondents', Lois Hayrnes or Craig Donoff-

a. Zylo Marshall had 2 Grand-Mal Seizures and L Petit-Mal seizure at trialcausing the trial

to be post-poned. Ow Zylo Marshall has a Vagus Nerve Stimulator implanted in his neck

which has increased his seizure activity allowing Zylo Marshall to properly attend trial

without ant interruption of 6rand-Mal Seizure.

? Zylo Marshall was disinherited under the control and influence of tois Haymes and Craig Oonoff.3 The guardian is Doctar Dean Edell. To date, Dean Edell is still Zylo Marshall's Guardian.a The personal Representatlve of the May 30, 2003 Will is Carol Haymes and Mark Ertes

lN RE: The Estate of Allan HaymescAsE NO. 502010CP004252XXXX58

APPEAL THE SUMMARY JUDGMENT AND GO TO TRIAL

5. Exhibit 5 is the December 3.1, 2006 Will in question of forgery by Lois Haymes.

7. Exhibit 6 is Curt Beggett'1 an expert document examiner, professional opinion on the

authenticity of the December 71,7W6 Will as forged by Lois Marlene Haymes.

WHEREFORE. Petitioner,Zvlo Marshall, Pro Se, respectfully asks this honorable court to strike the

granted order for summary judgment on the basis of resBondent's and their counsel mischaracterized

facts to suit their own benefit. Further, petitioner wants to strike this summary judgment on the basis

that opposing counsel deliberately and intentionally jumped over two Will on a surnmary judgment to

avoid losing their license at the trial. Zylo Marshall is asking this honorable court to set this case for trial

as originatly scheduled on January 25, 2OL5.

CERTIFICATE OF SERVICE

I HEREBY CERTIFY that a true copy of the forgaing wac furnished via facsimile this

February,2015.

Zylo Marshall, Pro 5e

912 J St. #34

sacramento, ca 95814

9L6-247-7736

1 i Dayor

Date:J

il\i TFIE CIRCUTT COURT OI"' 'ffM 15T}T JUDICTALCIRCLTIT IN AI.{D FOR PAI}f.BEACHCOUNTY,FLoRTDA .: \ ,r

PROBATEDTVISIOII r'. \ , i \ \ 1t_1., r.,, D

.r I

FI RE: ESTATE Or AJ-LAN I{AYMES,Deccased.

I

ZYLO MAFS}{ALL

Petitioner,v.

LOIS M, HA,YMES, as PersonalRepresentative of tbe Estate ofAILA].I HAYMES" a::d CRAIG DOI{OFF,as Psrsonal Represontative of the Estate

of ALLANHAI*I'IES

Respcudents,

0.,BD4R.-GRAIY[tr{G rN4I, flAry4RY dWC-IflElIr ArymlrAt JupcllrENr Rlr4YoR.p{.REsloN,D,ENfE

TIIIS CAUSE came before the Courr on December 8, 2014 at fi:40 A.M., upon

Responde.nts, LOIS J. IIAYMES, as Personal Represeatative of the Esta:te of ALLA.N

HAYMES, and CRAIG DONOFF, as Persanal Rep'reseutative of the Estate of ALLAN

IIAYI\,IES' Motion for Summary Judgment agairst &e Petitioner,'ZYLQ MAISI{ALL. The

Court bas :eviewed the record, pleadings, affidavits and eriidence fiIEd therewith, the mesroranda

of law and case law authority submiued by *ouasci and the Pro 5e Potitioner, ha'/ing 6eard tbs

arguments of counsel and Pro Se Petitioner, aad otberqdse belnf fuUy advisedia the premises,

finds that ao malerial facts are in dispute and that the law supports eatry of Fiaal sumrnqry

J::dgment in favor of Respondents on all couats in that:

rHE COURT MAKES THESE FINDINGS OF FACI:

1. On May 30, 2003, Allan Haymes exesuled a Last Wiil and Testarnent in

conformity witb all formaliries r€quired under Florida law (the "2003 Will").

2, Ihe 20S3 Wiil is a pour-over will :rldch directs that all assels of the Decedent

Ailar }laymes should be Ieft to the Trustees of the Allaa Haymes Revoeabte Tnrst Agreemctrt,

which Allen Ha3rrres also executed on May 30, 2003 in conjunction with his execution of the

2003 wiIt.

3. On Jaauary' 3,20A9, the Deceden! Allan Haymes, executed another lsst wiii ard

testanaent in corfomity with all fomnalitim required under Elorida law (ihe *2009 Wili').

4. The 2009 \Mill was a psur over will, leaving all assets not specificaliy devised by

the Decedent, Allan Haltne$ m his thea existing Revocable Trmt

5. The 2003 and 2009 Wills are substantially simiiar in form aad disposidve effect;

aeitler Will nanres PetitionerZylo Marshall as a beneficiary.

BASED UPON TT{E FOREGOtr\{G, I"HE COL?T MAKES TI{E FOLLOqrINGCONCLUSI0I.IS OFLAIY:

1 . Petitioaer, Zylo Marshall lacks standing to proceed with his Petition to Revoke

the hobate sf Dwedcut, Allaa Haymes' 2009 Will.

2. Standing to purnre reyocation of a wili is reserved solely to "interested pcrsonst'

pursumt to $733.109 Florida Sta&rrss. See e.g., yeirhcirn v. Golden Po+d Assig[d Living

Facilitv,9O5 So. 2d1W2 (Fla- 5&DCA 2005).

3. An "intsresfed person" is defined as one who may reasoaably be expechd to be

affic1ed by the outcome ofthe proceeding, such as by haviega pecuniary stake i:r.the outcome of

the proceedings. Iie.lisL $?3 i.20i(23).

4. Becarse &e Petitioaer, Zyio Marshail cannot reasonabiy expect to be affecrH by

the outcoae of this matter, he is *ot an "interested person'o snd theref$re, Petitioner lacia

standing to proce*d, Se? In:rE Estpte o{.Coqkos. 947 Sa" Zd 1290 ffla 2d DC,A, 2007}; tn Re

Esrere of Leuis, 41i So. 2d 36s (FIL 4e DCA,1982).

ACCORDINGLY,IT IS ORDER"ED A]TD AI}JU}GED THAT:

1. Reepoadents, Lois Halm.es aad Craig Doaoff, as personal rcprcscntatives of the

estata of Allan Haymes' Motion for Final Summary Judgment is hereby GRSIITED.

2. Finai Srimmar,v Judgnent is hereby entered in favor of Respondents on a1l counts

of Petitiorer's Complaint

3. Finai Snmmary Judgmenl in this mattst does not affcct the Petitipner's right to

file a separats.actioa regarding &e Revocable Trust of Alan Ha3mes.

4. Petitioner, Zylo Marshail shetl take nothing by this actioa and Respoadents, I"ois

Halmes aod Craig Donoffshall go hence without day.

5. Respondents are entifledto recover the costs of this actiou Aom Pelitioner.

6. The Court reserves jurixiiction to determine t&e anount of costs to be awardEd ts

Respoadertsu and to effertain artd hear any timely flled motion for attomey's fe*s by

Respondents, to detsmrine entitlement snd amount of attomey's fees arryarded, if appropriate.

DONE AND ORDERED rn Chambers in Palm Beach Cormty, Fiorida, tr*;q6gFf "f_ ,7014.

*h\1-fr B-u'

.fl\{6:* , s,'f.j}R$l\-l . rt t'' r:l,iiiMARTIN Itr COLNtIL"' .*.rrr'iCircuit Court Judge ...- \$'l

'Ils*.Sacrarnento. CA 95814

Copies firnished to:Zyio nnarstall, Pm Se Petitione6 912 J Sueet, #34, Sacrarnento, CA 95d

zmhf ssoci+1gs@Yaboo.,qoPqKeuneth S, PoIIock, Esq., Shendelt & Pollock, ?,L.,27A0 )i'or& Mititary Trail, Suite l-50, BqcaRatono Fiorida 33a3 t kmf&shend4lpgJloc.k.cs$

WILL

OF

ALLANHAYT\{ES

r*.',L,\ ],i, ALLAI;}IAYMES, aresidentofanddorniciiedinPalm Beach Counq',Ilorid4declare

this to be my last lllill anci revoke all prior Wiils and Codicils.

ARTICLE I EXPENSES OF LAST ILLNESSAND FIJNEIdA,L

I direct the pa,vment of the expensss of my last illness and funcral.

AR ICLE 1I. GIFT OF HOUSEI.IOLI} A],,IDPERSONAL EFFECTS

Clause 1. SeBarqtq lUrltirg. I give all of my automobiles, household and

personal effecls, and odrer tangible perscnal propert-v of like naare, together *i& all propertv and casualrl,

insut ance thereon iud claims r.l{th resafil therelo, in accordance q'ith a rvrifien statement rvhich I may hare

prepared prior io my dealh in co:r{bmtify with Florida larv. &{y Persor:al Represenratives may a-csume rhat

no r.rriiten statement exists if none is tound within 30 days after admission of this \trrill to probate,

Ciause 2. Git to Wife. Except as olhenvise provided in ar:y such *rirren

statement, I give my autcmobiles, household arirl personal effects, and other tangible personal propeny

oflikenarure, together*'ithallpropert-vafldcasualtyinsurancetl:ereonanciclaimsvlithregardtherero,to

my u'ife, CAROL HAYL{ES.

-l-

Clause3,Cpntiqgentg!&toTrust,Exceptasottrerrviseprovidedforinarrysuch

qrirten starement relbned to in clarse 1 ofthis Arricle, and in the event my wife' cARoL ILAYMES' does

notsuniveme.I give suchpropery*totheTrusteestl:ensen'ingunderthe Agreemerrtof Trustreferred to

in Article IV of ihis Wili'

clause 4. includahleProoerrl'. Howeholdandpersonaleffectsandolher tangible

personalproperryoflikenatureshallnotincludecashorsecurities,andinrheer,cnlofanydoubtordispute

asra rvhichitems ofpersonalpropefiare disposedof bythisArticle' I give myPersonal Representatives

discretion to determine the property included herein'

ARTICLE 1II. PR'OVISIO}I FORTAXES

AII Federai, statc and other iaxes, including any interest or;xnaldes' payable because

ofml,deathwithrespectto propefty included inmy gross esate fort*x purposes ancl passing under this

will shallbe paidtotheexlenrandindremarurerprovidedin&eAgreementofTrustreferredtoinArticle

IY of this w-iil, as if such laxes were adminisrration expenses'

ARTICLE IV. DISPOSITION OI' RESIDUE

Subjectto the fbregoing,l give all the rest, residue a:tci remair-rderolm},'estate' real

aliil personal, io the Trusteesthenserting underthe AgreementofTrust ofwhichi am se*lorarrdTrustee'

rlatedtirisdaybutexecutedbelbrethlsWill,foradmirusu-ationanddistribution;xpartofkusrprincipaland

subjectto the terms and provisions of said agreement, including an'v alterations or amendments tl'rereto'

In an insrancewhere ashareolmJrestate$,ouldhe disu'ibuted to abeneficiaryof suchtrustu"hen received

b.v the frusteesn my Personal Representatives may make distributions directiy to such beneficiary'

ARTICLE V. PROTECTIVE TROVISIO}'I

l{o interest under this wiil. qhether in income or principal, shall be subjecr ro

anticipaiion, assignment, p1e dge, saie or Eansfer in any manner. No benefrciary shall anticipate, encumber

or charge srrch interest, nor shall ary such interest, whiie in the possession ofmy Personal Represenxatives,

be liabie for or subject to the debts, contracts, obligarions. liabiliries or rorrs ofany beneficiary,

ARTICLE VI, DISABITITY OF BEI{EFICIARY

Clause i, MyPersonalReprrsentativesin&eirdisqretionn:aydeterminethat a

beneficia4v hereiinderisphysicallyormentalil incapable ofproperlyusingarryprop€ry*orincon:e to rvhich

such individual is entitled.

Clause2. Ifa.rtl'beneficiaryhereunderisundertheageofTwenry.ftve(25) 1rars,

or puriuant to Ciau:e I here,tf has been determine d to be incapacitated, my Personal Representatives,

during said incapaeiry, or turtil such beneficiary artains the age of Twenty-Iive (25) years, as the case may

be, shall hold anypropertvorincorneto which suchindividualisentitled, N TRUS f, forsuch individual

andn:ayapplywithout rhe interuentionofaguardiaa all orpartofthe incorneand,/orprincipal thereolas

intheiropinionisnecessaryforthesupport,education,healthandmaintenanceofsuchindividual. The

receipis liornp*rsLril3 selected i;;,, ni'.'Pcrsonal R.epresentaiives lo receive and disbuise sucliprincipal or

income shall fuily discharge ml' Personal Represenralives lvith regard thereto.

ARTICLE VI'. SURVIVAL PROVISIO}J

inthe*r'entthatanvL,eneflciaryhereundershall iailtosrryiiemeby aperiodofatleast

sixtf i60J days, it shall be presumed that such beneficiary'predeceased me.

-3-i#,i,

ARTICLEvIIi. PowERSoFPERS0NALREPRESENT,{TIVES

Subjectto arr-,-specifrc directioninrhis lYiil and inadditionto the po*ers vested in

them bylaw and o&erprorisions of niy \Yill. all Personal Representatives servinghereunder at anytime

inadministeringmyestate shall hale the follorvingpowers, excrcisable intheirdiscretionruithourcourt

approval and effective unril actual distribution of all propert-v', Ifany pou'er, authority or discretion granted

fiduciaries hereunderbe csrntrued to deprive my'estateofthe maritai deductionotherrviseprovided for

irereunder$itharesultantincrease in Fcderal e:tatetaxes pa,vable, such porver' autlrority or discreuon' to

the extent it so adversely aftcgs the mariral cieduction, is null, void and inopemtive, provided howeYer, that

this direction sha.ll notrequiremy personal Represenatives to mal<e anyelecrion under section2056(bX7)

of the lnrenrai Revenrre Code'

Clause 1' Prorlertl'I{etentio4?ndInveslmerts'

(a)Nonvit}xandingtheprol"isionsofFloridasrarute$518.11,and

irs successors, or an3' other statute or rule regardirrg ilvestrfients by Personal Representatives &1d withOut

regardtorisk,produetiviry,gro*thofprincipaloranysiatuteorprinciplecfdiversification; toletainany

or all pi.op*rq,.; and to inve st in all ibmu of property e'ithout restricdon or limitaaon to iruestnenu auhorizeri

frrr Pcrso:'-ir1 I1 epre sentatit es'

(b)Ms,PersonaiRepresentatilesshailnothaveanyobligationtct

rent m] resiile*ce during the period of administration'

ciause 2, use gl:s!4istr. 'I'o hold shares ofstock or other securities in nomilee

regisradon fonn, includurg ihat ofa clearing corporation or depository, or in book enry form or unregistered

or in sucli other form as wili pass by delivery

-4-

Clause 3. DiffositionE[hBegry. Wiihregardto anypropefiyandforsuch prices

anduponsuchtermsastheydetermine:toexchangeorsellatpubiicorprivatesale;toleaseforary"period

oftime, even though the rsrm may exrend beyondthe conslusion olthe administration of my estate; and

to give options for any such sales, exchangss or leases'

Clause.1. Bonorv&BUan$ llEdgeP-Ippstn. To borrorvmonsytiorn any

person, including any Persora!Repres€ntative' and inconnection iherervith, to moflgage orpiedge any

property.

Clause 5. Coryllor:riseCjaim:aneil,{ekeDjsclaimers. 'locompmmiscany claim

or contrclversl,and to make and file ,Jisclainrers for rne or my eslate without Court a*thorization.

Clause 6. Aba:dsg]gs$ o:!.Propeay" Ttl abandon arry propcnl.for an!, reason

my Personal Representatives deern proper.

, Clause 7. Disrributipn. Todistributepropeqv,includingincomeorprincipal, in

cash androrinkind..and to allocarespecific assetsamongthe beneficiarieshereundcrin suchpropoilions

as rny Persoiral Represet:tatives think best.

Clause 8. Egiplgffnesgf0fhefs. To engage aftoile:'s, accounlgnts, custodians,

inl.estr€$ counsei a::.i oil:e r pcr:ons ;r^t tit*y deem advisable in the administatron ofmy estate artd to make

payment therefor as they detcrminc'

Clause9' ApIro4io.nrnents.

(a) To allocate receipts, income, expenses &td disbursemenls to

principal or income, or pafil1, to each, as my Personal Representatives, oiher than a Personal Representative

havi*ga beneficial interest in anysuch ailocation, at any time and me to time, in theirdiscretion may

determine, or othersise in accord riitli applicable law, and this pou'er to allocate shaii include, but not be

limited to, stock, extraordinary and liquidating dividends, premiums and discounts on investmenrs,

compensation for professienal and other personal serv ices, and gain or loss on disposirion ofassets; and

(b) Toallocaredepreciationand imortizarionexpens€s: includkg

such expensestalien byapannership alrning depreciabie assets, to income orprincipai, orpa*lyto each,

a.ndtotheestentsuchai*:cationismadeioprincipai,myPersonalRepresentativcsare djrectedtoestabiish

and to fi-rnd a reserve equal to suchprincipal allocatinn, which shail be added to and made a part of

principal.

Clause I0. Eteqtio.nsBelatinglB la:m.I'tbt*ithsundingthtaddition*itax burdens

may result, or that the size of the gifi or interest passing to any beneficiary or trust may be affected by

increased raxes payable as a result of the exercise or nonexercise of an1'of the foliowing porvers:

(a) To electaltemate valuationofmyestate ulder Section2032 of

the hrternal Revenue Code sr any similar provision;

(b) To elect pursuar:t to Section 2ti56tb)(7) ofthe lntemal Revenue

Cade to hal'e propeny consiitute quaiified terminable interesl propenl;

(.c) Ii:;rllocate any federai exernprion fiom the federal generation

skipping transfbr rax to any praperty rvith rcsp*ct to rvhich I am the transferor for puqposes ofsaid tax

(ufietherornotsuchFrope*,1'is inciuded ir:myprobateestate) arrdto exclude any such properry*fom such

ullaqation:

{d} To join uirh my r.r.iib, CAROL HAYM}:S, in fr ling Federal, State

and Local income and other tax rellrrils for ali years; and

-6-

(e) To ccnsent tlr having gifts made by my rrfe, L'.AROL HAYI\,{ES,

considered as having been made one-half by each of us for Federal gift tax pqposes.

Clause I i , Oodonal Trq4,t{rre4 o;[Peduplig$s. To exercise any option provided

bf iawro treatadministration orother expenses. rvhetherpaid fromprincipal or from income, as iterns of

deductioeon either:he inconle tarrefi"trns oreslatet&x renlms, uith*ut requiringreimbupementofprincipal

for any resulting increase in esnle t&i, provided, however, that if any Personal Rcpresentati\ es are not

beneliciaries, such Perscnal Represenutives shall be solelyresponsibie for such decision to exercise this

pol1er.

Clarrse 12, ExccUtiosgftrgsgssgsts. Toexecuteanddelir,eranyandall deumenx

and inslruments rvhich they in their discretion tnaY deem advisable '

Clause lJ. GeneratAuthoritv:. Toperfomrallacrs,irsritute suchproceedings and

exerciseall rights a:td privileges, althougir nox herein specifi.cal.lymentioned, uith relatio*to anyprcpn)'?

as if the absolute orl'ners rhereof.

Clause 14. LirnitatioqO+Fowers. lnadditiontootherlimiutionsonthe powers

ofPersonal Represeniarives contained in this Will, no provision in this Will shallbeconstued to pennit a

Perso::ai Reprcsentarive to take piut in any discretionary decisiort to distributc income eir principal ro or

for rhe benefit ofa beneficiar-1 in satisfaction ofany legai oblig*tion ofsuch Personal Representative to

support such heneficiarl'.

C lause I 5 . Wirhdgru,el Aurhgrit'. Upon unauin:ous uritten agreement, my- Pemonal

Representatives may authorize an1. oneormore thanone ofthepersonal representatives to sigltchecks and

-7-

other irxr.rments to make rvi*rdrauals from any checking, savings, mone, market, bmkerage or otler accatttrt

ARTICLED(. APPOT.T{TMENT OF PERSONALREPRESENTATIYES

Clause i . .{ppointment gfPersonal RqprpERtativg. i appoint my trite. CAROL

K{YME S, Personal Representative of this \Yi li .

Clause 2. $ue$Fssor Per.spnal RepreseBtativqt. Sliould my rvife, CAROL

ltA\lvIES, failtoqualif orceaseto acrasPersonalRepresenta[vei iappointmynephew, hIARKERTES,

ro senze in her place.

Clause3. $iaiyergfSecuritv, ]rioPersonaiRepresentative shallberequired to

give bond or fun"rish sureties ir: any jurisdietion.

Clause 4. Transscrioirs *'ith Relaied Persons gI Er:tiries, ir'fy Personai

Representalil.es ma) enter into any contract or other ttansaclion r*ith anl e ntity m $hich any one or more

ofrhem ha-s any interest as a proprieior, fiduciary, beneficiary', emplotee, parmer, stockholder, director or

officer.

Ciause5. Resrmnsibiliq,vefP-.e.f-sonal$sp1e$il1altlgt. NoPersonal I{eprescnradre

shail |ave any liabilir:*excepi ibr his orher orw dishonesty, gross negligence, cr the u'illful commission of

an act knoilx by hir,r or her to be a hreach of fust'

ARTICI,EX CONSTRUCTIO}I

Ciause l. As used herein, rvherEver lhe context iequires or permils,

thc gender and number ofrr,ads shall be interchangeable; Leneficiaries shall include legarees and devisees;

-8-

,,disoretion,'' uniess otherwise expresslylimiredherein, shall mean &e sole andabsoluteright, porverand

authoritl' to make a detennination r.vhich shall not be subject to questian by any person and shall be

conclusive and binding on all persons; and no anti-lapse or other statute regarding devolution ofproper&-

shall appli,10 any gift hereunder which is conditioned upon surviv'al of rhe beneticiaq'of sueh gift'

Clause 2. AilheadingsprecedingrhetextofttreseveralArticles, Clauses and

Sub-pamgraphs hereofare inserted solely fcr reference and shall not constitute a part ofth"is 1'!'iil, nor aflect

i.ts meaning, conslr*ction nr eifect.

IN WITNtrSS WHEREOF, I, ALLAF; HAYVIES, have set mv hand and scai to this. my

lastWillcansisdngofnine(9)pages,g,i' 7"P Aayof

SIGNEI], SEALED. PUBLISHED and IIECLARED by ALLAN IiAYME$"Iestator', as and for

'is l_ast lViil and.i-estar:re*r, in the prcsence of us. rr'ho, at his request, in lus pre sence and in the piessnce

-9-

. Tua Thousand Three (2003 ).

ztLLAN HAI'I'IES

STATE OF FLORIDA

COLIITY OF PALlvl BEACH

F:DOC\CLIENTS*'laSmcs EP'Iic u r {J!':r \t :': Ai1}n'$}*d!:f+ Trmr&e B Malsey

t"ryj3,:ru;,*"r';;,

))SS:)

i, ALLAN HAlAnEs,declaretothEoficerrakingmyackno*'ledgmentofthisinsrumeni,

andtothesubscribinglvitnesses,thatlsignedthisinstrumentasmyrviil'

ve, €/t izc,,p.'r(',qtr*un* C!'*s+i"*'${ "hil'havebeen srvomb'v

the officer signing be lort, and declare to that officer on our oarhs that ALLAN HAY-fulEs declared the

ifisrrument to be his rvill arid signed it in oru presence and that we each signed the insrrumen! as a rtit]ress

in tire presence of ,'\ILAN HAYkIES and o1'each other

Acknorvledgerj and subscribe d before nre by the Testator, ALLAN rIAla,IES' rvho is

perlf$jf&nol\ntomeorrvhohasproduced -' '' -asidentification'aad

srvomloandsubscribedbelbremebyth ewitnesses, - {f t tn fr';:.'' . fSeE&-

rllto is persggLil*grolt'rl to me or *'ho his produced

identificafion and t trho is pc$ggg}lt$o1lr] to me or r'vho has

produced as identification, and subscribed by me in the presence

of i\i,LAN llAYllES anii d:e subscribing uiinesscs' all on 2rl13.

My Commission exPires:

u--z' / /

ljr"

I-A,$T WIIL AI{D TESTAIVIENT

or L*$* -:ALLAN.H$viffiq

I,ALIJN}IAYME$,domiciledinPalmBsgtrCounty,Flurida,domake,publiehartd

dedetrethismylast$JiIlandTltama*,herebyrwokinganddecladngnrrllandvoidany

ard alt Witls and Codidts by:ne at any tine heretofore made'

ArtirJe I

I dbect my Pereonal Representative to Pay my legally srforceable debts' the

€{p€''sesofmylastill'ss,rnyfuderatexperrsesandestateadrninigtrationexp€n.ts.ArdclP$

I deyise certain ite;s* of tansible persorul groperty in accordance with a writgt

slatementwhic}tlshallhavep,reparedplrlortomydeathtncgnforrritywithrtoddalaw.

&*icleItr

Igiveandbeqrreathallmyiewelry,automobiles,clothinga:rdotherperconal&cts,

as well ae all hou'eftdd goods and equipnecrtruhich I may own' whichhave not been

oth€r$ri8e dieposed of by the aforesaid written statement' to my daughter' Iols M'

HAYMES.

Imakenoprovisionformygrandsor',aft"oMAR.9IIALL,fotreasorrsbestlnown

to me.

Ar8cb,ry

Ifanybenefldarrhereunderstrallcontesttheprobateorvaltdityoft}ris}YflI,orarty

provisiorrttereof,o:ehallinstifiItearioininanypmceedingtocontgtttrcvalidityoft}ts

*1bALI.AN}IAYMES

HAYOOOOTl

WrIL or to prevent any provision thereof ftom being caITid out in accotdance with its

terrre (regardlss of whether or not suqh Proceedingp are lutiUled in good faith and with

probable catse), then all beneflta provided for zuch beneficiary are revoked'

ArtisteV

I dired that all etate taxe* of anynature, togttl€rwith all property reguired to be

included in my ttros$ e8taie, or ta:cable tp any Psrsom receivin6 it under the provisiorrs of

8ny presEnt laws, regardless of whether that p'roP€rty peeea under or oubide of the li{riu

e a codldl to it, or whether tlro*e taxer are payable by eate ot by any recipient or

beneficiary of any such propenty, shail be pai4 bI my Fersornl Representative and the

Tmgtee 8rd€r that cerfainTrust Agrenrrent referred toin 6ds l'Vill, out of the corpus of the

Tn:stB*htehetd urder that Tru8t Agrc$ne$t, withns rightof reirurbursementfrom any

recipiertorberEliciaryofanyzuclrpaopertyolanytemPomqyorregralndeJinterest.

ArticleYI

Theresidueofmyeshte,Igive,deviseandbequeathtomytherractingTn:stee

gnder that certain Tru*t Agreemerrt dated the 30th day of May' 2003' (ar may be Ertended

&om time totinelexeeutedby me, pdor to tlre oxeordon of trieLastWill andTestamer*'

6aid dgeise and bequeet shall be added to the pineipal of the aforcaid Truet' to be lreld

and dfsdb,uted as though an ariginal part thereof'

.*eticlsVII

ln addition to thm Po$rer6 granted Personai Bepresertative under t}e Florida

Statutes, I give my Peraorral Eepre*entathre Power to invest in bold8, gto*8, note8, or other

pro,perty, lea*, borrow, eelI or e*chan6e all Or any part Of my estate' real or pereonal for

;ffi-nes,resz

HAY000012

su*h pricee and upon such tensrs as sty Pefeonal Reptesentative deems Plop€r; to

compromise, contet, proemute ot abarrdon r.hims in lavor of or agairut gly $tatei to

di$tsibute incsne and principal in cash or ill kind, or PaItIy in each' and to allocaa or

distributeurdividdinterestsordiffelsltassetsordisp'roportionateintesests ina'se6and

no action taken by rny ?ersonal Rspreserrtative grnsuarrt to this power ehall be su$ect to

quertionhyr*ybeflefi'ci8ly'TheforegoingPowersshallbeo<ercis€dbymyFEreonal

Bepreser*ative witlmut authsization hy any court'

erFcleYH

Iappaintmy'daughter,LoEM.HAYMEsarrdmyattorrre},CxA]GDoNoFF,as

co-Personal Represenhtives of this my Last wiu and TestEst€nt' I direct tlnt tle Personal

Begreserrbtive and aubstiarte or succssor Peraonal Rep'reserrtative ahall seme rriihout

bond andsecuritY.

IN }\TITNESS WHBRBOF, I hereunto sigrr my nane' and publish ard declare tfiis

o be my last Y'{iIi and TeeAment in the iresemce of the persons wiAreosing it at my reryrest

;iffi-{tu-n -,ALLAN}trAYliTE8

S'TATEOFYISBTDA ))se.:

COI'NTYOF PALMBEAC}q

L ALLAN HAYlvffS, dedare to the ry. taking my a&towledgment of tlfe

krstrunrent, and to ttre eubecribing w*ness€E' this instrum€nt ae mY will.

ALTAN HA

5,[S0.Qlade* Rd. - **itgiglEocaSstonl["33'S-4

6100.Glades BJL. SutB.3O1BocaRatpn.HLB{S*Witneas

residing at

HAY000013

gIATB OF FTORIDA

COI]NTY OF P

t*ved"nnn'om

by the offil -tirhl otricer

'.1.3t :,"e" Y t}:*l:1aig.*C tlr" lngtrum&rt to Ue ttr{tcstato,t'e Will arui signed it in firr P'regence andttrat we

- ----eadrsignedtreinstruomtasaeritneas krthe presenceof tleTestatorand of eacho&er'

STAIEOFFLORIDA ))s

colINTY OFPALMBEACH)

Acfrrowledged and subssi-bed and sr rort before rrre bY tlre Teetatcrr, ATLAN

IIAYMES, who is aa

identificadsr, and bY srtd

witnesses, who gre knowntome,

))s

-

This docusrerrt PrePared bY:

CraigDuro$,P'A'eiOO Claaes Roa4 Suite 30L

Boca Rabn, W *3d,34

HAY000014

wRrtIF{ fl.rA1E}mrf

I heeby make this written eBte$Hnt or ust, in rccordaree with Flsida statute+ section

732.515,todlsps6gs1*mgit{epes*ftAlp$Psd'notot}tgwi5e5Ptriflcat}ydisposedof fu

*y t "tWilt

and Testarnen*, as follows:

1. Igive{*ome of berdiciarY}*

residing{address of belrsfi dar}r)

the following article;(deocribe iteut)

2" I give*.

residingiaaOneas of bemefieia:Y)

the following(dffiibeitem)

3. I gtue to'

reaidingfiUat"o of bendiciarY)

thefollolringarHde:,-.-''-{der<ribe iterrr)

4. I give

reeiding

(narrre of benediciarY)

luaOou* of beneficia*y!

thefollst'rinB *H"1".

Dated thi6

-

daY of

{eiEnature}

HAY00,0015

subjectDonoflTHaymes adv Marshall- Document for your Review- seth Ellis Pourover willproir : Matt Tomincasa (matt@shendellpollock'com)

To: zhmassociates@Yahoo'com;

The 12/2O06 Will attached, like the 1/2*A9 and 10/2005 will' is a poufover witl which leaves

Allan Haymes' estate ;irl, f*rt. As the terms and practical-effeet ofthis will are essentially

idenrical to borh rt, iiioog witt ut issue in this matter as well as the 10/2005 will, there is no

significant change in the status of this matter based on this document' Notwithstanding' we

would like to ensure we highlight the existence of this document pt v'u T ft *":1{.be subject to

a Dependent Relative Revication urgu**nl in the event that Mr' Haltnes' current will is

successfullY overtumed.

Thank you,

Matthew A. Tornincesa' Esq'

Shendell & Pollock

2700 N. MilitarY Trail

Suite 150

Lesr Wru,AND Tnsraruaxr or

r>{. 1+i

PreP*red hY

Seth E. Ellisr P.A.

23S5 Executiv* Center llrive, Suite I90Bo*a Rrton, Florida 33431

(56r) 98&oo7s

Synopsir of LastWi[ and Tcrt*nent of Allrn Haymer

This abbtwiated summsty is fot convenience anly and should not be telied apon in

irrterpreti*g the Wilt The' Yilt' contains otii tWifr'*t ptovisiow nat desqibed in this

surnil$y.

fuiiele I $awtylidentifies family merubets and refercnces

Artiple 2 (Treatment o! Bodily -Re.mains) directs that upol your death' yorn bodily

remains be cremated;A ;#;isd md tiai yor" ashes be disbursed over the grave of

your deceased wife, Carol

*{rtic'lc3{spectfreGtfisaJTangible.Pe,rsowlhoperty}give,stangibtepgt.soralpropedyas specified io * ,"puiut" ;id"g ryd q-":s all yoru

'em6ning tangible pe'sonal prope#y'

includirg tuiaiaq,€,'dffi; n"oi-frirfr, ;+"; vehicfts, ilott'ine, ieweLv' and

;;;""tl"-*;t ti,o* of yoru childres who suvive vou'

Artiele 4 {Re*iduay Estate}gives yoru residuary estate to &e tustee of yotu revocable

tust fol administration under its telms

adi*Ie5{Appoint*entaJ?ersonolReptesentative}mmt$LoIsMHAYMESasyoulpersonat n pr*nou?i""*i';ffid*'f* ;tt*;* No Personal Replesentative is

required to Post bond

Articlo 6 {survival Provkiaw)rcquires a bsneficiffy to survive by 90 days to receive his

or her devise

Article?(Paymenrsolobltgatians,Extenses,andTmes}providesdirectionstoyol.Epersomi Representariii r.g*ti"g pu,**i of A*Ut*, admirishation sx,€ases' and estate

taxes &om p* i"to ,irrIt*tl vo* rl*ii.iry *.t"t" is to pay any ta:(es not paid by

the tust

Articls. s {Fiduciwy Powets} sants broad powers to the Personal Rqlrese,ttative to

?ffiud*ioisradon of Yow estate'

Articleg{TmElecttons}dil,rytsyorrl?emonalReprese,lrtativetomakefdemlestateaadcensration-skipping't*'"Gti"ts us itstusted Ui ttre &ustee o{ your Revocable Trust

lgarding tansfets under that tust

Art,icle. 10 {Transactiow with oths Entities) provides general instluctions for

i"J-rp:;.6rka uppritutien oI the tuas o{'vou'will

Articklr{trfiSeellaneousPtavisioal)includesdefinitionsandothermiscellaneousprovisiotts

m#l#t-*ttArl#sSm$S Erlil'PA

23t5 EJCfUTTVE CENIERDRIYE, StnIE I90-* *---

EocrRamr'i FLoRDA 33431('61)9tf{075

TABLE OT COIYTENTS

1

ARIICLE 1 FEUNY

ARIICLE2

Anrrcrr33rt)̂,L

33

ARIICLE4

AerELs5

ARIICLE6

Anrtcl"eT7t4nth

Anrrcr"e I8"1

82

8'3

8.4

85

8.6

IREATMEi\{I OT BODILY REMAINS

$pecrr Grrs or f eNcrsrn PeRsoNeL PRorrxrv

Separate List for langible Personel kopetty ' '

Othel Gifts "

SPecial Ierms " '

Rsspu*nY Esrarn

APPOTNIIT,GNI OF FERSONAL REPRESE.NIAIIVE

SunvrvAt Pnovtslolts

PevrncNrs or oruoermNs' ExprNsns' AND TAIcES

Obligations

Expenses and fa:res

F:DUCIARYPOITIERS ' "

l5rPe of Assets

Odginat As#ts

T angibte Pelssnal ProPgtty

Specific seculities ' '

FroPe*Yfransactions " "'BorrowMoneY

,l

Itt

.1

.}

z

1

?

I

{

" .3

,*., *"!

"{4

SE?HE ETT,$.PA

2rr5 ErECInJVScrrirSn DEnrr' sl.,lrE I90

- {361}t$&{fi5

I 7 Maitaain Assets

I I Advisors

I I Indire'ct Distibutions ' '

8,10 Non-ProRctaDisBibution

811 Nomisee

I t2 Custodiau

8,13 $ettle Claims ' ' '

8 14 CorPorate Rights

8.15 PartnostriPlnterests

S 16 Self-Dealing

8 1? Eleotions

S 18 Qualilied ProPertY '

I 19 ExPenses

S 20 Tetminate Small frusts '

8-21 Atlocations to lnter6$t and Principal

822 Use of Income

S.2j Sever or 'Ioin flusts

824 Consolidated Funds

8.25 Valuations

I26 IncolPoration

827 Delegation

S 28 Advances

8?g Inveshueat Manager ' '

S 30 DePreciation ' '

8,i1 Disclaim Assets or Powers '

I 32 Transfer Situs

I 33 Related Partie*

*,14 Additional Powers for Income-Producing Real Estate

ARIICI,Eg TAXELECITONS

*4

5.

s

;5

fr,

6

6,E

(g

7.7

Z

".7,?.

g

&

., E

g

g

,gg

IIa

$EIilE E't'l'Ir$'FA

2385Exrcr.rmffiffiItiI{s6l)ess4o7s

2

$ffiH-Mt*-HrvMne

LAST WILL AFTD IESTAIT{ENT OF

ALLAI$ IIAYMES

I, ALLAN IIAYME$, a rcsidBnt of l*l]l Beach County, Florida, revoke all prior Wills

;Jp-;lt-t ** roflo*ing as mv Last will and Testamer*'

Tffi:?'

I am not maflied. I am a citizen of the united states I have one ehild' named LOIS M'

HAYMES, and one J*.*ur"a child, nameJpmusn HAY1VIES IIOOPE& who was

siuvived by zylo #Ans,*An ;fi,,r;RrAI{ ITAYME* MARsIrAtt' Refnences

to ,,ilry children' *"* *y children ou*"J uUoo", as well as any otha child'en of mine

boln or adopted urcrf" J*J*ion of this *iil; reference$ to "my descsndants" mean my

children and their descendants

AnrtclP2TREAIMENT OT SO}ILY BEMAINS

Uponrnydgalh,itigmywishan{fsirsthatmybodityremainsbEcrEmaledandnotburied Upon the ,rrrri,ior, oi*y body,I direst that my i'eisonal Represvntative and my

Health Care Surrog;;;;-h;t *y *r,o *" disb,rsed ovet the grave of my deceased

wrfe, .cARoL A- ;;ffis, Gi.r, *-Gut*o at sharon ffardens cemetery' 273

fof""i"* Avenrren Yalhalla, NY 10595

ARITCLS3

SPECIFIC GTTTS OT TANGMI'S PER'gONAL PROPERIY

I make the following gifts:

S.lsepatateListforTangiblePersonolPropertylmaymakegiftso{tangible personal p,iffi qy ryeaqlof one or mole sspilate written lists Tr: be

effective, a ssparare ii*I *i" 6" signed by me, and must if"tify the items and persons to

reeeive them with .**onuUf, ""riinty. If td; is a conflicq I confirm the gift of &at

item made inttre *j;;**1 Est Mi Po*nur Representative will aot be bound by any

written list pr*a**a*-Ji:r**tra more than ta,o months after mv death

Sj-othcr'Giftslgiveatlmyremainiagtangiblepeisonalplopertynotgivenby other provisions ; ,il- alti"tr, inciuding fiuniture, household ftunishings, motot

vehicles, clothing, i**"fty' *O g{ry'"f "ff;tts (toggtler with all insurance on thos€

irems), to LOIS M ;IAYiTIES;ii ftuioe;'otfi;i*; tfiis bequest sholt lapse and sball be

added to the residue

I}j,'ffil**---HAv,",EsSETHE Et16'PA

2385 ExscunvECEHIER D*Iv& SUiIE 190

Eoe'r RATaN, FLoiloA 33431(J6l)'8$'0075

33$pei*lTetmsAllgiftsoftarrgiblepeffionalpropCItyundertlrisa*icle*. uut'j*t to thi followfurg canditions

(a) rru*tforMinor*' Jf*Iry:1i1r1;l;*ff::i*;::-fri'o;trffi:."# XX"re tmf*,:m ilffr H",ff t'[x;;;;; cause alr sI

any part of that *n*Jli't ,;$9-1jo ,t "

**nciarv or to anv adult having c,stodv

of tbs bemeficiary *r,**r* the rrustee dffi ,rp*pu1e;.ryi4 *a t* proceeds used

for the benefit otn" f,**ef;,*i *ru .10 t'ilt;J-a" added to the share o{'mv estate to

be held ir uusr a, ,t?u"i"iliJry; ", air*iliiJ-t'r*"J"" u*r''* of the beneficiarv bv

ay f ersonat RePresentative

(b}Dfui*ionbyPersomlRepruentative,Ifthepelsotrsentitledtothese items caonot a$ce upox u Airr"r.*Tthffii.;;U* un"' *y d"ath' my Personal

Reprcsentative shall-divide ttrese ite.ms ir, iis discretion *o"t those persons' and tSat

di;;i;" will be conclusive and binding

(c}DelfueryExpersesAllexpensesofstorage(beforedisuibution),packin& shipping, irrrl*"r,"oelivery, *i;t#';o*!1."

-u'Ia nt****y charges in

ai*ituni,rg a""" itemJili*"; puid; ;;.p# of admiaistation of mv estate'

*"-,fli$[ol''n"

IeiveallmyResiduaryEstatetothe.ryls,€frvl*ghu$teegfttrerrustAgeementofAllanriuy*r, dated May 3b, 2003, u"

"*"*alf, t"T;out*d -on.octobet

20' 2005' and as

asrended oro restatea';&;;ril" ,h" #ffi";i trris wiu (referred to in this wilt as

nmv Revocable Tru#'1, u-r',1*o1v3o1'll"#''il--*".pd aflet the execution of this

Wiil, for rO*l"irrrtiii ood* iqtuys, iilll Utn *J]at fiurt is ineffective for any

teasoB, I give til *i'-ii*iduatv E*t? * Lt ""Ltt-?I rI Re"ocable Trust upon the

snme t'rns *o *nilrili"';" dt'il; *#;;;; *rf* I incorporate those tu,ms

by refereuce, o* #ilil#il& of tbis contingent sift

Anrrct'c5APPOINIIUENI OT T'ERSOI{II, BSTBSSEN I AIIYE

I#ffil*?s; ffi t$t :ffi "ilffirffiH; H$' ;Jtr' x"''H:'$;personal n*pro*offi]"a-r*"i*r.il;;;,rve .wilr G entitled tg ryasonable

compensation , #* i* "" r"i*""r'il;t;;;;u" be

"quired to post bond or ather

securitY.

sErHE Erl,ts'P&

,"t"r(*,m:1x$,nmllifi(561)'8l4s7$$ffikM**-HAYldEs

ARrrcr'r 6

Sunvlvar'PBoYIsroNs

If any boneficiary is required ': :*111::* o' anoths pe$on to receive a disuibution'

and if the bonsficiarv does ryt.lryvive ;; ;; O* otnit q"1son bv 90 dayts' or if that

beneficiary cannot Ur'f*rt"a *ithin one &"-#' *; d"-ih desoite teasonable attsmpts

by my peisonal n*pr*ifrtir* to locale ,ffi;;;6.i,"" th" beneficiarv rvill' be treated

; fi*t ;h- died Lsforc me or thatother person'

Asrtcu ?

PAYMf,NIS OT OBI,IGAIION$, EXTEN$ES, AND TA,ffi S

MyPetssnalRepresentativEshallpayallolmyobligatiorn,sxpsB$eslandtaxesasfollows:

T.lobligation*ldirectttratmylegatlyenfotceableobligetion*(exce,ptthose secursd uy mortgages or other ##d' ;il;*") be paid ilr thc ordor and

maursr Prescribed bY law

12 Erylenses and Tares' The tetrrr "exlleitse$" includes all estate

tansmission or managemexrt "iry:--"t *y p'oUutt "*f and all casts of'my last

illne*s and firneral; ttJt*r* "estate **J""iti all state a1d federal estale' inhelitanc€'

or fiassfer ,*** piliii--;, ,**r, ori #ffi; the ge,eration-skipping

transfet tax on *,Tiffi' *'-#*"q bythe exprcss terms J{ tfris Wnt Iather than by

disclaimer), pfu* uJ rifut"i intergt ffi;;ilt* utniU"aUfe to these taxes' but

excluding any ottrer gs-ner3lion'sxi1{1g ffi;tl ; dircct thst all ercpvnscs of mv estate and

Ji-*tu,*1*iscua,ga'*itr,,",p.il.11ffib'd*S,fliHffi ffi iif ffi [:d#ifn:m'X$'$'Hlt$ "ff'lJt:'ffi;i3j

s r I *a o*ii'* se'tion 73 8 20r (2xc)

of the Florida Statitcs For these n***t I-incolPorut" UV refetence the tax

*r*******t***;i*";rilT'ffi,i*LH#ffi $

appoltionment, excapt to rhe extent prorrii"iT*ily n."*"ui* n*t as to nonprobate and

nontaxable sssgts

*,'ffiTiH"X**

I stant to my Personal Representative..and the rlustee. (collectively refelted to as "the

Filuciary") rru p"Ift' J,5J gqy Yi;Fpytf ilil estate rhe Fiduciav mav

exercise tnese powl[ i-ioip""a*tiy.*d iliuiuita* appto]8l of'anv *orut' No-person

dealins with the Ffi;tuilrrJ inq,ii,.;;',fi"p'pir "t *v of iti actions or into the

application of TI fir#;';;ets. The r*.,"t"i rhull, hoot'o' exercise all powers in a

fiduciarv *pu*"v'ilJ G be't il}**J?I-# *'i*ft:t ot' *v estate' wbieh for

purFosss of rhis *f,*f**i*"i"Oo *, Jrrf ;;d-io tfris WiU Wittrot't limiting the

$-IflE ETTI$'P A

asnsExPcu*wcilffiH$i:tt56t)9iE-0075

*r*rrsLi*, w", ;6-m* oF AI I AN H^YMls

rcnemlityoftheforegoing,theFiduefry.ispventhefotlowtngdisuetiongypowsrsmIaditiooio any other powels confened hy taw:

s,lTypcofAsssB.Exceptasofhellvi*pr.ovide{tothecontaly,taholdtuirits uuinvested f", ;;-p-tirdr;ar;til;y a;* prudent, aad to invest in any

sssetstheFiduciaryd;'A"isableevBnttt"t'gf*"tn-yarcnotlechnicallyrecogniredorspecifically listed in #;.1fi;l.grl lirt ,'; ;;tmt r"il*iulitv for depreciation ot loss

on acsount of those ;;J;{ o, becsuss those iivestments are non-productivs' a$

ilrrfidr- FiduciarY actsin gPod thith'

E2originalAca0ts.Exceptasothelltli$epovide.ftotheconfiarf,,t0r€tainthe original a*sers it ,#i"* Or * tgog ; i, d.;;t best, md to dispose of'tho$ assets

wtren it deems dri*li;;ut'* *'ot'sh ;# ;;il;; of'their it'ata't"' or lack of

diversificarion, *rrdH;;;; J.ri*i*c i*ptopo investrrrents fol tbs Fiduciarv

8.3 Tangible Persoual froperty Io' yceivl 1d hold tan$ble personal

property; to qav ", ;fiti" [o* p*y'ne-tt;*gt *d TsT--T;1'charges

for such prropefiy;

and to pelmfi any #neficiaries to *" ,*t prop{ty- either the Fiduciary ot

beneficiaries incurring any liability fot **' -t"i'

a"d outol"seence of the propetty

E.4Specificsecurities.Joinvestinasse.ts,secrrrities,olinter,estsinsecurities of any *r,il, ;};ilG 1*r,u"y, i#iti*;P"a,*rcs., options' tufuces' preciotts

metalsn currc,rcies, ;ri il"ffi;r,];-*a'tild,-;;Gtt Tl i' mutual or investrneid

tuirds, inctuding *;;; ilr-*airn-,tr riffi^? ;;;-.fftliats petfotms services fot

odditionat fess, r*hfr; as custodian' O"*f"t "i-"f investment advisot or othsrwtse' or

in securities drs*ibuted, urderwritten,;i;ffi- 6' tr," riao"i*y * by syndicates of

which it is a member; to tade- * "r"oii-*r-**sm ssct)unts (whether secured or

uusecrued); and'to eiA;- **t* of rny estate for thet pwpose

8,5Prup*rtyTranractlons-.robuy,sell'pledge'excha$gle,orleaseanyrcalor personal p*p"i eiui'rv * p'i"t"rv'it':iJii[;-it''*itrto"i**t appuval *nd

uoon ttre ,oo,, *d fi#;il iri tnJ'nlr.Av A*t- advisable; to u,(ecute de€ds'

liascs, conraats, biils of sale, nores, *"r;'*;;, Jditirstuments' and oths written

in$,me*ts, n. u}*a.i *ljrpory ot.u,,r-'&t t pnso4 p*pu'ty io IV el3tlwhich

has rittle o, oo *o*rury or usou y*Jlffi;;[frt"-.trnl tun*iaris or their leeal

re,r€sentatives; to ffi;* [pui" t"#;;bdili*; '"d vacate

'ny plop$tv; t9 elect'

ulier or demolish builbinss; to aajust Uorlaai;; ft; sl"se easements' ttstrictions'

aad coveuanr. * tfr* iiari"i*y ry9s tit .fiilJ;tll ; valid and binding for its tu.l term

frirl:rl*i-,e- bevond &e ftll druation of mv estate

&6 Bontw ltloney' t1 bouow msnsy -fr't*' aEY soulc€ (including &e

Fidrpiary in its notrfid*i*y "upu"itylriir**i*t-tA.lttf'*t' and to sec.oe tle loan

r.6"rtiqrty *o'tiugu o' oth"' security interest

SEIHE. ETTls'PA

zltser*",'*cgffiffi1frt56t)9E64075

.*rr**@i*l'd;;*f m'.*to*f"'P*r'nss

g.T lilaintrir Acacts To expeird whatever fimd$ it daems propr-for the

prmelvaliou maintenaoce, ol improve.ment of assets rhe Fiduciary in it$ discretior may

el€ct atry options o, ,*ttiu**t* or exsrcise any rights-undet sll insuranct policie* tl*t it

holds, However, ""'A;*dt ,"f,o it the insrned of any insurance Poficy held i* my

astaDe may exerciss any rights or have- a*v incidgnts of' onmership urith rcspect to &e

polisy, including A*fr*.it, ;;r.g; the fieaeficiary, to sune$d$ or sancel the policy'

i" ,.iigr tUe p;'trcy, io i"uofr. any assignment, to pledge &" polly for a loan, ot to

obtain from the i*s,*r-" i"* ug"intt thisurre,rdet'value of the po-licy AII such Powst

is to be exflsis€d *f* ty rhi rerr*ining Fiducinry, if :*{, oi if nooe, bv a spwial

i;ra*i*y.pf"ir*"4 fot ttat p*pos e by acourt having iuridiction

S.SAdvisoreToemployandcompensate.attgqers,a0countants,.advisors,fimrsial consultaotq m.urage{s, ag€rlts, aad assistants (including any individuslor eatity

who provides investmenl advisoly ol matr€*mefi sscYices, or who furnishes

professional assistanc; in makiag inveryments f"tLV estate) q'ithout liability for any act

of those person$ if they are sslected ana re1uined witir 'easonable

cate Fees may be paid

fi,orr the domiciliarf'ot"t* "u* i{ the to*"", werc renderrd in connection with

aucillaly proceedings --The

Fiduciary may selve in any oI these c*pacities and bo

**p*oitd separately for its services in eaoh

S.g Indirect Di*tributions, ro malie distibutions, q/hetllsl ol prtlctpal ot

income, to any psffio; undpr age 2l o-J to any incapacitated Pfryn actording to the telms

of this Will by *"kir;;ffi;tT** ait""Uv'to tnqpl'* *hethet or not &at person has

a guardian; to the ,rra *uarCiar, gr $pous€ ofttnqpersoa; to a custodial ascount

establichd by the Fiduciary or others 1o1 ritt-n"t*on urder P.?eplicable.tJni{org Gift to

Minors Act or Unif.;'ilar;f; io nai"om act; to any aqult who resides in the same

household with that po"* o."rUo is otfrerwise t"*po*ilt" fo,1 fu carE and well-being of

rhar person; o,. uy upffis *y3irttbs.* for the benefit ol that psrson in any mannel

the Fiduciary A**'n oG-in: ,"cuipt'of tt" personto whom payment is made will

**,i*r. n h aisch*g. of *" Fidrrciary with rcspect to that payment

g.t0 Non-Prn Bata Distribdion To make anv division or distribution in

monsy or in klnd, o, Uofr,G*out uffo"*irg the qme.tio9.:f properly to all shares or

distributm, and without regard to-the i;;.-l* basis of the property Any division

Jfi-* ui"di"g and conclusive orr all parties"

S.llNominecExcepta.spt.ohibitedbylaw,I"h:ldanyassetsinthenameofa uomiaee wittroui-iird";d;

-tri1 .-fcuciary

rclationship; to bold the prop"'ty

u*egisteied, ',,o,itt,o; ,ff;t#- U.bilirrr ;ito.hof sl"iitio eadotsed in blank, in

sEE€t ccriifipate& et a depositiy lrust company' or it a book entry system

s.12 Custodian. ro employ a custodian or agent (]the.custo{ian} locared

anrnnrlrere within tn"'Iinit"u itur"qit tn air*J"" ofthe-riduciay bBt at the eryeose of'

rififfi,;ffiffi;;;;iuch c*t"ai* is sB alfiliate of the Fiduciav or anv p€rssn

rendyring ssrvices ;';;;**t io .*gi*r"t:*titnities in the aame of the Custodian cr a

SSTfiE BIIS'PA,23E5 DG.CUITVE CBflER T}RH& SvIIE I9O

BocARAfllN fmruBA 31431(J61)988{t}75

INIIIALS *ry.f rsl vtillt ArID TgsrruEllr or aii"rx g'r'vr*sr

nomines thereof'withor:t designafion of liduciay *apacity;.arxi to appoint the custodiail

to perform ,*n o*,J"Joi#i*r n*"rio**-utit"'ria'i*i'uy eav dirEct While such

seeurities are in the -;o"d;-;fa;ftstodia& &e Fiduciary wi* be und*' no obligation to

inspect or veriff *.fr r*,iri i"* nor will *tt fiA*i*y be responsible for my loss by &c

Custodiat

S.lsSettteClaimsfocontest'ccmptomise'TliIu"'orothet$/isesdjustclaims iu favor of'or against rny estate,.to ugt"e {o any rescission or modification oi any

cortrasr or agreemen, *d to reftain f;m instituting aay suit or action unless

iademnified foi reasonable costs and exPenses

S.l4CorlrorateRightsfovoteaadexersiseanyoption'light'otprivilegetoourrhase o, to conoettl"J-I"*, "*iti"tfuaing

share! oi tactio,ul shates of stock

:fJ";;;#;;#y), *-riiti"r. * o*", |rope*v; to borrow monev for the

puposs of'exercisini*#,iit rgi""fi*ht or privitegs; ro d*tegate those riglts to an

asenr; to enter r* J"ffiL""rJ" i"J "*J-st"";::lf^::H:riptions; to participate in

anv type of liquidati* "ir*rg*i*ai"" of any enterprise; and to write and seli covered

call optionq puts, caril, ;lJarEr, * .rh"r *#oa* "ru,rving

or selling scutities, as well

as alt iElatsd tansactions

S.r5PartnorshiplnterestsToholdinterestsin.soleproprietorships,ge-neralor,iniffi- *-t T3;##";#ffi;,ffiffi *X;X#I;Ifr'*"#'Hi?il*TT;#*-l*;*:flfi1,;,T:#;3:';ffi ";""i8:i,r,&;ia,e,includinsanvffi;;;-ppii"rur" to u-"o"-ua*ittua transferes of'anv such int€rest"

8.16$elf-Dsaling.,Toexerciseallitspo$rcl.selelthouehitmayalsobeactitrgindividualty *, oo *ilfiii anv otlrcr person & entity ilte.rested

in the same mattsts

The Fiduciay, r,o*Jlf;;GGr: +;; e';* ui all times in a fiduciarv capacitv'

nrimarily in the iuter#;;il; ueaeficiarie-s';f;; -*ter .DesRite anv other provision of

ifris WilL no Fiduct;-;"y prti*in"t* ;4" decision tcr make a discretionatv

disaibution trrat *Jii'ci;L'i* ' 'tq* ;ry1 ;P]t#i"" of that Fiduciarv No

Fid*siary who has #d;;ffi;;o, *iift*tl"tividualty or as-a Fiduciarv' mav cxsrcise

anv discreri"n ir d;;J;; trt" *;rr1""i ot tttt disetained o'opertv AII pou'et to

make such oirniu"iiiil'lt"* ttf-ii"*'tiipi""" of"disstaimed propertv' t"ill b*

oxcrcised solalv uy ta.I*-i"i"g-rla*i;;";;tf;y' or i{ there are no ot}rer Fiduciaries

then serving, by the persoa o, po*on, **Ji;;;; as the next successor Fiduciary' oI

if.thflr are non6, bi a special riduciary Jip"rrr"a for that purpsse by a court having

iurisdiction.

S.lTElacfions.roperforrniaeliducialvcapaairyafryactandmakeryyandall decisions o, "r"#II*

rJ"ittut* ru*o' i" Gt*titut it"nert'e Code on behalf of me o,

my estflte, iilcludkg ;;;-1fi4*, "rJ*,"g'he whole or any part of the 9x9en1e* 9f

a{miristation * ro*lioJi*?*aurtio* f* ;; cstate,.electine the mslital deduction tn

whole or in par! making allocations J:;',";;il;too fioi th€ fedsrat genaatioo-

6

*,t#HAYME$SEmE Er'ts'PA

2385 E,(EculIvECExtERDs'rve $L'rE 190

Brx'rRcrox Fm$DA 33431

(J6l)9S840?5

skipping [ansfet tax, adopting altemat* values for esiate tfi( purposes, and solectingtaxable years aad dates of'diseibution, Ihe Fidusiay is specifically excused fiommakirry equitable a{iusffierts among beneficiaries because of any election

8.1ff Qnalifiod ProBerty" To manage any qualified real popstty or qualifiedfamily-oumed busiaess interests so &s to avoid imposition of'the additional estate tax

under Ssctions 2032A or 2A57 of the Intcrnal Revenue Code, and to furnish recurity for

thepaymentof any additional estate taxes imposed u*der &ose sections.

8.19 Erpenses To determine, in a fiduciary capasity, how e4peirses ofadministation aad receipts are to b appoltioned betrreen principal and income.

8.20 ?erminate $msll Trusfs To exercise its dissretion to ref,ain fiomfilrrding or to termirate any tu$t wtrenever the valuE o{ &e principel of that ttxst would

be or G tao small to administer economicallv, and to dishibute the remainirg plittcipal

snd all accumulated income of the tu$t as provided in Seotion 8.,9 to the beneficiades

then entitled to receive incame in proportion to their shares of'tlrat income (ot on a per

capita basis if'their shares are sot fixed) The Fiduciary shall sxercise this powct to

terminate in its discretion as it deerns prudent fot the best interest oI'the permissible

income benefisitri$ at that time fhis pou,ercarmot be exercised by a beneficiary,

eithsr aloae or in conjunction with any othEr Trustee, but must be exercisd solely by the

other frustre, or i{'noae, by a special Irust€e appointed for that flItpose by a court

having juisdictioa.

g:f Agae*tiore to Intcrc*t rnd Prineipal fo treat premiums and discounts

on boads and other obligations for the palmlent of'moaev in aecordance with eithet

genelally accepted accour$ing principles et tar( accourting princrples and, except as

I**r*i#frorid"d to the coutrary, to hold nonproduotive assets without allocating any

prl""ipuf io income, despite any laws. or rules to the contary fhe frustee in itsaircrrtioo may exercisc thc power dcssriM in Sec*ion 7?8..104 of the Flodda StatBtes to

adjurt bsfwe& principal and income, as apFropliate,.and, in additiorU may convert my

incame interest into a unitust interest, or a unitust interest to an insome interc$l, as it

r*u nt, a1 as pr,ovided in Section 735.104t af the Florida Statutes, despite any provisioa

of those sections to tbe contrarY

g.ZZ Use of Income Except as otherwise provided in t&is Will, and in addition

to all other available sources, to exircis its disfietion in the use of income &om &e

assets of my esrate to satisft the liabilities desfiibed in this sfill, without ac*ountability

to asy benefieialY

S.Z:i Swer o1Join Trutts fo sever aay tust on a fractional basis iato two or

mOrc separats ttusts, and to se$sgat6 by alloc,{ion to a- seplate a5cou1t or tust a

rp;ifir ffiunt eonl a portioi of, o, a speeifi_c asset included in any tust' The

Fiduciary may c$nsotidati two ot more truste {including tnrsts created by differsnt

tr*r"fenor"l traving iderrtical berreficial terme ard eo*ditions into a single trust A tust

r*r*,r--F!t 7

irsr wrr er6&_-_FmAN HAYT'IEs

SEIHE Etr$,PA2r8i &xEculnr€ Cg*TER tx{YE, S$rE 190

Boc,t ItAroN,FLofiDA 33{31

{561}9i*{s75

sr€flted by severance or consolidation will be treated as a separato tust for all ptttposes

fi,om the datp on u&ich the severmce o, *oi*iiau'i* it edective' and will be twld on

the same beueficial t*, *a conditions *ir'ot" a"rot" &s ssYeranco or corsolidation

Iacome earned on a consolidated or u*r"r& *,o*t, pordon' ol specific a$st after the

consolidatiou o, ,urJ*ifl* k*oio" *iiip*r *itrr tnat ,sro*i, portion or specifle

s$$st.

EJz| Conrotidrrcd Fuadc' unless inconsistent with oths ptovisions of'this

will, to hold two o, *or* u*tt or other'funds in one ol molE oonsolidatsd firads' in

u&ich the sepante o*t" or fturd* have undivided ir*ercsts'-exsapt that-aa 6sssrrrting

must be rendaredtoo[il;-t1**in* fts;divided intercst$ ir tSss€ fimds'

S,2SValuatiorr.Inmakingdistributionsorallocationsundertlretflmsofthiswilt to bs v*lued as oI,a partieular du':, P" Fiduciary may use asset valrrations obtained

for a date rasonably close t0 tbat particular date (such as 1qTrtfily ctosing date before

or aser &at date) if, in the siduciaryt i"dgr.;nt, obtai*ng applaisalt.o.l .otho

detelmiuations of value on that date wouid 'itutt

in unnscessaly-expens*' and if in the

Fiduciarls;roe**rrt;Jai; ry;*luur* * determined is substantiallv the $ame as on

thatactr.raldete,lhispalasaphwillnot**,,,t1-,uationon.aspecificdateisrequiredto preserr-e u quxinoi;or"fo, a tax u."Jf;r, including arry deductiorl credit' or most

iuriruUru alocation of aaexempiol

sj,6Incorpor.atisn"Toincorporateanyb-uslnelscrvenhte,andtocontinuemy uni,corp"rrt*dtd;;; ;*1;; !i;;;i*J deteimines to b€ rst advisable to

ircorPorate

8.2?Dctegationrodelegatepeiiodicallyamongtkeinselvestheauthoritytopeformany a$t of administration of my e$ate'

sjsAdyancesTomakecashadvalcesorloagstobeneficiaries'withorwithout secraitY'

g.zg rnvesfficnt Manager - ro employ any investneilt management Flvicen

firancial institution';;*iil"ie*,i*i;'il-;d;; the Fiduciarv and to handle all

invesrmcnts of my ;*[ffiffi ;ffi J;;;d"s" ".f

f""* hel{on its b€half under

custodial, ag€ocyr *, ffilGrfi* .f ttt* Fiduci}y is ao individual' these costs may

be paiit * * r*p.o*;;#"G"ti* in uaoition b fees and commissions'

830l}cprccirtloaTod$uctfiomallteceiptsatfiibutabletodeprrciableFrop$ty a reasotrabl;;;;* fo, a"gro#"", ."-p"t& in accordance with generally

accepted *ro*t'og p'i*iplts consi*entty applied'

8.3lDiselaim.As$etrorPowerrTodisclaimsnyBssotsotherwisspassingoranvf,drrciaypowarspertaiaing.S*y-ouocregtedheretmder,byexecutionofaginsrrument or aisarJini:*uuti& .n ,tq,iilt"o "r "eeriout"

laur gencrallv imposed

A^L-Ir.nuars f{ S.. , -i-"t tyn to;;rmatrorArl'rN rlayrrEs

SEIHE ETIS.P.{

x3tS ExEcurIvE CE!.Ifr DRreE, $ulrE 190

soclBAralt. FLo*ID 3343I{561)9fl{075

uporind:viu*i:*X,n$:9,*p;""*;",i:"m-"ffi#'r-*''T":"I'iintercsted per$on, or ary yTt '"'::;: ^-1,--^r,*"r." such a disclaimsrbe held hamless * #i f;ff-i""'iJ*"rt or nolmake such a dis

Ss2Transfersiftls.Iofiausferthesitusofany.trustoratrytlrlstpropeltytoany other iurisdictioi"* ;ilr * 6rfirtltv'd*;i6'dliyble' and if necessarv to

arooint a substitute;;;iu*y rr*t*lo ui,t with leyl to that propertv The

ridnciary **y A*kg# tiltt* *i,t*ritot* ;rd;;v;t gi 1r:the poweis givea to the

Fiduciary; may eteoiti urt * advisor t" ,il*Utti* Trustee "od

teceive reason,ble

comrersation ro' tr'tis*ivice; ard ''*y 'J'""" any acting or substitute Trusbe and

ild#ffit* orieaPPoi"t itself' atwill

SssRelatcdParfies.Ioenterintoanyhansactiononbehallofmyestatedespite the fact tl"r:;tht''*"-*:#;;;;i* mav be: o a business or tust

conuolted by the ftfr;iffi ;;;f *hi; tle fiauciu'v, o1 *" director'' officer' ot

employee qf t, ttiffi't .*;y,-*'lt$-. il;;i'om*er' or emplovee; (ii) an

affiliate CI husmess ,Jr*iu* ", *t.*l#v;tdidlcialv; or (iii) a beneficiarv ot

Trustee under this 'frt1ij;;i;ooia"u,y'

oI anvrelative of such aparty

Ss4AdditionalPowarsfor.Income.Pr.odueingBealEstste"Inadditiontothe o&er powers s€! fGth 'boo:1-:dH;-;;;611€db'ta*

the Fiduciatv has the

following powers *i* orp*r, to any i-r*"-prJ*f"e real praperff which it or may

become a Bat of'mY estate:

. To retain and operate tlre praperty for as long as it deems advisable:

. To c,$ntrol, direcr, and menage t".groplty'-l;termining the manner md

extent of its aetiYe p**'i-'i*in th'* oput:li*'and to delegate all or

any part of its supervi*y"ptt-" i" other persons that it selects;

. ro hirc and discharge employees, fix their comtrrnsatiou' and define &eir

duties;

'ToinvestftndsirrotherlandholdingsandtousethosefiIBdsforallim#ffi;ntt' .p-'ations' or othei similar putposes;

- Excspt .as oae1f5-l]"#,XT,**kfif**T*ffiff:ffi*'Hffi

fffillffi $::Stfri ffi;ffi'J* i,, *"ti*itv *ittt sound and

efficient maoagenenu and

' ro purylary *dr^'::#;x*ffi#:l''#ffH[Tli"$needed for the opcmtlon I

I.*1f

NIITALS .::--ilifr*;*'frilffiafirliHavues

SEIflE ElIE,PA* n5 Exfcurvr ctr$Sffi:'lr1l3T

(561)9[84s7s

Anrtcr,r 9TlxEuscrroxs

I dircct my Personal Representative to make fedelal estate and geaemtion-skip'piag Ax

elsction$ as iastucted-fi tlr- o.*t-. oI roy Revocable IT"t oittt respect tg-qlffelsunder thst tust lvly Polsonal Represenetive is to k held harmlees from any liability in

makirg elertions as directed by that trustce'

Anrtcln 10

Tnexs*c'rroxs WIr H Ornsn Exrltus

My PerSonal Reprweatative may buy s.tsEts from othcr estotss ol trus*s' nr make loens to

them, so that flmds *il u u*iluutt to pay claims" taxes, md expenses- -My Pe6onal

Representative * **[u tho* purchases -*:t*** e,en if it slves as the fiduciary of'flut

estare or axst, and o*f,J.*t terms ard coaditions my Pemonal ng,resentafyg"*are appropriate, except that the tetms of auy uansaction must be commer'Bially

reasonable

Anrtct g 11

Mrscgr,r,lurous PRovIsIoNs

1l.l $eIinitiorils. As ucsd in this Will, the foltowing terms heve the meanhgs

set forth below:

(a) :?T;ilil*'ffiffii*trffi ,Tifff 'TffixTf;H'::i?future federal irrternal revenue laws'

(b) *#1ff#ffif,ffir,ffi,,ffi:,51#T#ffi4,*frxestate tCIres)

{c) fr-ffi;*t*? fffi"fi]1,1ffi#.gX'ffi Tffi*;Personal nepre*entati,,e will have all the powers.ryry1ed to

tusttrs under Florittuw, as well as the poxers specified in this

will.

(d}Thewordswiltandshgllroeusedirrterchengeablyinthislvill.and*il-*l* the context clearly indicates othel*'i'e, that my

p,,soffil n"p**rntutiuu pust tati the action indicaed; as used in

ffiW1l;,fi wordm"y means ttrat {y Personal Repre*ntative

has the discretionary iuthodty to take the action but is not

automaticellY required to do so

INrrro,s M , lo

I rsr 1lltrr .fl [ TPsr.le'r sF 6-irx fnva'cs

SEI}IE El.r'ts'PA

2385 E:<r,curnre Cs'.lE*DErvq suIE 190

Boc,r Raaox, f,-otEDA 33431(561)988'0S75

. ,13 Lapsed GiftB fI *y gift is coaditioned on thE recipient surviving r$e orano-th*r Feruofi andns ltyryativeairpr:iti:r -J {rr; dftj*,er*in"a, &e gift wig lapseand become part of'my Residrmy Esra-te if the designaf,d reciiient aoes notiur"i"e.

113 Notices Any person entitled or required to give natice under tris Wiltshall.exlci:t qatpowsr by a unitten ins&ument wiinessed uit*o lrpurti*-p"noru *ongtadzc4 clearly setting forth ths effective date of the action for wtrich ootim is beinggiven lhe ingfument rnay be executed in counterparts,

ll.4 Certifieations.

{t} Frum Trustee For some purposes, my Personal Representative isinsnucted to rcly on a csrtificate Som the truste of my Bevocable Tnrst a$ to certair taxelections and other matteffi. That certificate must be in writing and witnessed by twoimpartial per$on$, but need not be notarized. It is to b deliverd to my PersonalRepresentative in the same fashion as provided for orher notices.

(b) Facts, A certificate signed and acknowledged by my PersonalReprvsentative or the Trustee sfathg any fact affecting this Will, my estate, or Bny trustwill be sonclusive evideqce of such fact in favor of any tuansfer agent and any otherpemon dealbg in good faith wifh my Personal Represemtative or the Trustee MyPersonal Reprcsentative o, &e fru$ee may rely on a certific*te signed ardacknowledged by any beaefieiaty ststing any fast concerniag.the estate beneficiaries,ineludiag dates of birth, relationstrips, or marital st&tr$, unless an individxal serving as

Personnl Reprrsentative or Truste* has actual knor*'ledgethat the stated fa*t is false.

(c) Copy" Any percon may rely on a copy of this insuunent (in whole

or in part) ceitified to be a true copy by my Fet$on spmifically named as a Personal

Representative or Trustea (or successor Trustee); by any Corporate Tlustee whether or

noi specificalty named; or, iftkere are none of the above, by any then serving Trustee,

tl,$ Ilispute Resolutior If there is a di*pute or sonhoversy of'any nature

iavolving the dispositioa ol administatior of my estate,I direct the parties ia dispute to

$bmit *e natd to mediation or $orne other msthad of'alternative dispute resolution

selected by them If a party refuses to submit the matter to elternative dispute re'solution,

ar if'a party refuss to participrt" in good faith I authorize the coutt having juridiction

oner my cs6t6 to aunard cosis and attotney's fees fiom &at parq/s beneficial share or

fiom other amounts payablo to that party (including am(lunts payable to that pa$y as

compersation for seivice as fiducialy) as in chancery actions

ll,6 Efreet of Adoption, A legalty adopted chitd (and any descendants of that

cbild) witl be regarded as a-desccrdant of the adopting parent only if'the petition for

**opiio" was fiGd with the cout before the shild's &irteenth birthday If the legal

relationship bsfiil'een a parert srd child is termiilatod by a corut while the parent is alive,

that chitd ing ftrat childs desccardanl$ will not be regarded *s descendants of'that p*rent

rourrrars &E lt

i "sr

wnr arrTTffiT[*rer HiY,t{s$

SFI*If Eri.is,PAi3t5 [xEcurrvE CB.llEx. DrrvE, sutlE I m

Bac RAroN,ftoaI}A 33431(561)$e{0?5

Ifapalentdiesandthelegatrelationshipy,h'I,*deceasedry*t'*ghildhadnotbeenterminald before *"1'n3ilt;;"b,- -d;;-*"J p"*t* child and tbat child's

descendants wiu conill#il b" ,;;;Ai- aGr**" of the deceased p&Ert even i{'

tftu *tifA it later adoptcd by anathot Frson

Il'?InfartinGestadon.FgrallpurposasofthisWill,aninfantingestatioawho is later born d*;Jrl b" d*** * ;Jti;ft *rg $" ne'ioa of'gestation for

the prupose of q*fifyinJd;;"f-il -ft-t it i* bo'o' as a beneficiary of'my e$tate

ll.sApplicrbleLow"All.matterginvolving&gvaliditvandinterpretationot&is Wi' ee to u" eiffi;f # ry;dr.l#

-ito,;19 *re provisions of this will' all

rnatt$ic invotvi$ t#';;;;;f;. 1f i "* uk * te ryvernea

tv the laws of the

iurisdiction in *li*ffirililJrts p'l""p"t place of administation

11.9 Gender nnd Numbcr. |eference in this will to any gender includes

ei&er masculine or feminine' * upp'optJ"land '*fe'eoc* q-*' uuriUer iocludes bo&

singula' and p'xal *to. tte cc'tixt n-[i#I'r;;; use of descriptive titles for

articles and paragtaphs is. for 'l'-

q*=;oi to*ti*nce ontry and is not intended to

resrict the application of'those plovl$tons

IBALAI{CE LEFT INTENTIONALLY BLANKI

SEIHE Er.Is'Pjt

?3Br Ex8crnlrx cffi ffi#trffi If{561)98fS075*'&xAYMEs

t2

Florida,on kf.. Jl . .,zoooExecuted at

rhis instulrcnt was signed, sealed, published a1d declaled by the testatol as hi* Last

will and restament in our ioint presesce,.and at his rcquest-we have signed olx names a5

anesting witnesses # ffi i;;;;t'i" A;i;;#; or each other on the date tust

wittenabove.

Addrcs*.2]u).*EGclilIyECET{IR,DRIVE

SUIIB 190BCA|RAIS{,F].33+31

X35 mCHCUT IYE (mriEn rmv*8SUTT6I'OBOeAR^{r0il,FL3343t

l3.*ETEE EITI$,PA

23S5 ExEcuIrvSCgr'ltmDHvr,Sr.rttr 190

BxARAT{Er,FtsiID 33431

tSfl)gEE S07siilsrorfurluH*YA.teg

couNrYsp P.tt * F.rtsf-*

I. ALLAl'l HAYMES, declare to

iotrr*t"rq and to the subsuibing

Il/ill aad Testament.

D}H{E ITTCGU.INq

the offic$ taking my acknowledgment of this

#**t*u, [*, t si[ree-*is instumsnt as my last

we, . D4ilEMEHNF ,, -, and , , tlELl$${'DEZff9{$ 'have been sworn bv tho office* *isning *f:1,nffi ff."ffffihave bee* sworfl oy rtrs (Irrrt;sr nrB*Br' ll"'fii* l,*t WiU una Testament and signed it

m*fXmXiT** ffiT#i;- inshumenr *, **ffil *- p'*** *the testator and of ech othel

Acknovrledgcd and subscribe! b-afore Tu bY the testatorrr$"* "tlffiO#"iias identiflcation,#;ffiE'.* io-*' .:' +lt31,*31g1 DffiE I{CCLUNqfiffiffi;*o tru*iu"a bafore qu bI *" ATTy*ffiXA:,#Hi&T#is[:rr**and by

Lid;i@**FHprtt** of the testator and the

icdffiou*:^T*L and sUDscllDccl^ EY rus u

atron . DaP..ll ,2006

SEl,iE ETl$,PA2385 ExEculry€CENIE&h$8, S$ry- 190

E{t Af.Aro$i'Fl.orro 33{ll{561)}88{r',s

(Print or StamP Nrmc, ComtEissim # anri Expirdixl

H,'#t,M*-..H^YME*

14

1 862

Curtis BaggettExpert Document Examiner

908 Audelia Road, Suite 200-245, Richardson, TexasPhone; 972.M4.A285 * Fax: 972.644.5233

c$rtbaggelt@msn.gomw.wl.ExuertD.ocume$tExamine_Lg.pnl

Questioned Document Examiner Letter

May 23, 2014Subject: Lais Haymes

": ,J i%l+.r\IT\_/

I have examined seven (?) documents with the known signatures of Lois Haymes. For thepurpose of &is examination I have labeled these exhibits o'Kl'o and.oK7,'.

Today I have compared the signatures of Lois Haymes on the "K" documents to the AllanHaymes signatures on the questioned docurnents, identified herein as "Q3* and "e4" todetermine if the author of the Lois Haymes signatures on the 'oK" documenls was the sameperson who authored the name Allan Hayrnes on the questioned documents: signature pages of aLast Will and Testament dated 12-l l-06 bearing a purpo*ed signature of Allan Haymes.

An examination of hand.writing includes establishing pattems of writing habits to help identifythe author. Handwriting is formed by repeated habits of writing by the author, which are createdby neuro-pathways established in the brain. These neuro-pathways control muscular and nervemovernent for writing, whether the writing done is by the hand, foot, or mouth.

In support of my opinion, I have included an excerpt *om Handwriting ldentiJication, Facts andFandat*entais by Roy A. Huber and A.M. Headrick (CRC Press LLC, 1999, pp S0-Sl) whereinthe leading forefathers of document examination in the USA agree that one significant differencein the fundamental structure of a writing compared to another is enough to preclude commonauthorship:

fordway] Hilton stated: "It is a basic axiom of identification in documcnt problems thata limited number of basic differences, even in the face of numerous stong similarities,are controlling and accurately establish nonidentity.,,

[Wilson R.J Harrison made similar comments: "...the fundamental rule which admits ofno exception rvhen handwritings are being compared...is simple -- whatever fsatures twcspecimens of handwriting may have in cornmon, ihey cannot be considered to be ofcommon authorship if they display but a single consistent dissimilarity in any featurewhich is flrndamental to the structure of the handwriting, and whose p{eseoce is notcapable of reasonable explanation."'

1 863

[JamesV.P.]Corrwayexrlgssejthesamethemewhenhewrots:..Aseriesoffundamental agreements in idenrify*S f"[Jti;';U'i* is-requlsite^to the conclusion that

two writings.;il.uir#.i Ly it*i"ri"person'.1ut.o* u single tundamental diffcrence

in an identising individuality lrr*.*, tno ,,,iting' precludi the conclusion that they

w€re executed by ttre same pefson'o'

and finallY,

lAlberts.JOsbornandothershlveeelrgyllyagreedthatdespile!rylerou:similaritiesinrwo scts of writings, a conclnsion if ideniity carunot be made if there is one or morc

diftbrences i"iu"Oi*untal features of the writings'

Baseduponthoroughanalysiso|t|eyitemsandfromanapplicatirrnafacccptedforensicdocument examinarion tools, pri*ipr*, *i t""Liques' it ii mi fr':tcssicnal exflrt opinion that

rhe same person *rr.rr"ilirilame of .qr; H;y*;r on the queitiune'J documents'-Lois Haymes

did indeed forge the signature of Allan ,fr;;;;iit q.tttii'ttd documents' o'Q3" and "Q4"'

lamwillingtotestifytothisfactinatourtoflawandlwiltprovideexhibitstotheCourtshowing that my

"pir"#. il;;;;:

'My i;;;ffivitae is^auached and incorporated herein bv

reference.

RespectfullY submitted,

$tate of Texas

County of Dallas

$

$

$

TheaboveLstterofopinionfg**ig}oisHaymeswa$sworntoandsubseribedbeforemebyCurt Baggett this - *' day of May' 2U 14'

JISSiCA SLACXSHEA*Notory gubllc. S?otG ol T€xoa

My Cotnmitiion ExpkitAu0urt 0i, 2016

1 864

/*/'i'i*'-IIIIS EAlaffiS"Co-Tnutos o

Allrrr lTrrrrrer x};rrrrchh Trrrrr

QOE EXHIBIT

tl

1 865c1,J frer1|'rLg-'>

f -,i. Lf-a* Ia..r.lrtol

-#siry iryi . r.&r9 t$lt

olftG,tin of fis dab bolorr.JI

t'.__ ,!11.117_*,,ffi

lJatreu ltuD, :l-. - *sJ

)ts l-ttYMEs. csI*u$TEE

i5FU^n{J{-a*a1?{df,tr|ist,a{

t &"='h i i

t' ry'"< i

:n- I!i sl,r n I('o I-.r I!-a.t

tlq.lr-t: dl;51:61-,1( tt-tIlE:-l* xl-, n Ii/ ! IE t'.lr?lk-l1.

=

is<aE"E.,!

ib

EAEr

Ett

-3

*rtx"trB0E

Eg;

o!?+$4.ZnE

g

*f

*En5T6o<

r!6e9^:iiit€a 'tlddiIt'441-rt

x

*

1 866

ADE EXHIBIT

h1

l{A!,ltir.xr}a

1 867

OTHERAPPEAL RIGHTS: '

. lf you rnias ffre ciedlins for *lir6 an rrnmsdiate appeel, you rnay still be able ts file an appoat

ulfr a Ql0, hlt tB 0P ldl telc mon tlme to rnake it* dacisbn'

. conbci 1-8C$.MED'C/rRE {1400-6334ifn, or TTY 1-8774A&?:0.{8 for more iffermatton

*oout the aPPeab Ptoea8'

ADDnnilAL INF0Ri ATloN (OFTIOilAL)

Plaffi aQn nelor to indkrte that you haw mcived this mffm.

I ha* bcan noilfcd thet mrerqn of my *rvlc* *i{ and on thc efficiivl d* ktdicrt!.| on lhb

rldlcsardtlrdt nryryp*f-friiar*ion ryffiil{il!, nry AIO' }

rormtto,C5.,fg{2, & a4'lm-sri3lt7gt1

Arc4rdy1o F frc F*6trer* ru(Er.*irn A{E oa 1&}a rE potlsr tfo trqud & n+ofi'-?-' e*'cnfl| !t i*r'fi-,' l,r5r h drflln r tc}l flElffiffi,rnl; il vfxt ouB Erala n rlk rc. fi. ldoflr*o.r coftgio.r r r{F0{sit rrr ffi: n+r* p rop}t std il*m 6ts ctt&t h

;ilEa;'}aUF. ,,a,cagr,.r;lo.rrtonrarr,rcbl'r !plrd.r3trr,.rdtrrtsir.!..ddrrr. ilrqrb.r.c!{tl'rnb€fft ti&tafis@ot*.dn **,sifrxsr*-;ipadgrrrr'n,Crrrruara, PfiAOrruOilaqTi008ra;tEn|hnd'B*t6'*fit3s 71?4*1il4'

,iny,loil4el

? ?!?BS

IslFcap, " trr t*rcltry'F.!}fiI--Eoe riHtett

lrq

1 868

$rrrox HG'E &l$tPlrrorS, rrc.c085 BrL8or elncr,E

EOCA RhTON, FLORTDA 334'T156I - 34?-6675

rrr e c*q aa Z-s{r cq-'-*l,.ltr

c3rBgx36pn7--+.€i',A{{R SLFPSRT Ei€ riE pfiy!€NT INF0Ri!ATI[}{

-I?SC'c(L r: qtcllvh. 3f,cril[r DtlB:3-l{o-77Pqlts)*Jg *

3?tt&ddress of servlee -#iq fill€ilL A Nb:i.li:-E!!3!--lg!8J4!i;i' A A *f 3 7

vVl). P\****t-t,

rledicar c;:n*itlm t* t*x iatiiUid- g,-iy +,F ro ry s/' ne ga reA w,/,rYEb SRestrlctlons/speclal requlremnt s

Speclal,tst

i*_:gS LstN€Fmds not c-*u*tl

ryAEI5 -,rlFaaniry physlcien *) RI -4 t){; ,r' ,- -*'" }-E

tf'if -5 *?c.;,,.o.'* .Sf J -e 44d

Phme S{lrc- f

xtll be paid dlrectly tolnvoised. This ls rhot atha sbcye lnfcrnetlsr sfld

the caregiver,ccntract. Your+J.gnLfies yo{rr

Additisns.l lnstrutlmsl* iL,lL'HiladL r rz'

f# Hosortat frr-amaxl;*._-* pnon..-:j.-f$ - T!95

{# rhrrub: h*.Or,iD, GLcryq ,v - *-o**3€{::: ti&4.a

ri6ir€,i ii,'diess /Relar j r:nsl : x,; f oei53.: re$ponst 3-i* payfirrlflt i

irrle'€li_i}tryiry . .Liilrr:;rrE, s-13

top/rr^;-- LqF;;:v:; iAre, ;-f 7'#-dA-ACEr'ic'r orr,s f ll ilxe

Cgregiver fees am sny egreed expensesAoeniy and cereglver fees gre clre itlenslgnature certlfles tite correctress sfagireawtt to the terns. t'

r{arc/relati.<nship; I :re: :( -' I I ;;,i,I'si u i.elnstructlons Ek&^/' l'ffi yi

n|!!"f.vlp,frti-rt* Hala-gs*,,tr?- $j *,q€**==-,r*one. -ss-drf -ti\ t"L*# ''-- ' .i ' ---'1-tcrx*Fltsb /-)F,{L 'Y

S*r

1 86{1

Ii

MrS?s'2$09

*frnA,

ffi;J,""rysxg#rq*ffiLHffi*ffiffi:ffiffifi;utaa r)&!dt,

,f,* S{n4P4/-r;irHrm,olgirroe

\

r*Yi$,"r6ri

1 870

Lois il|. Hayrneepo bor *X114

nntr b*Itss. cr 9313'lsots90.327a

PriE Baach Couty Shsriff* OfrccAttr: Celrtrrl RocordsPO Bsr 24681WcstPalm Eeacfr, FIs. 33416

Ra: Casc# 07-155889

Fekuary 11,20$E

Dca: Sir orMeden:

As pcr a rEocot tclrplnnr sorr"GlEadoD I hsd wlrh Dctscdvc Sorvarl, ptcase turerrd to rnfaddrcss aoy docuncntr pcrtaidng to tk scw closcd invc*igion(s), (ccc numbcrrsferEncod ahovc), iovolving ny lhtbcr Allaa Helrucr. I gn thc d&$Ltcr and Porrasr ofAtbmcy for my fattrar.who wa* dsscribod as tfie yistim, Falsc rrpole rwrc filcd again$ rrcccr€rtl tisrcr cver tha la$ ycu lhrcugb thc Dcpartment of Chitdra EEd familicg AttultProlcctivc Scrrdccg in PBC (2007}. I woutd rymci*c rccciviqg all thc information that

ffftsirls to this casc fild with thG PBCSO, I hBvc Ek€ady rcceirrcd closcd c.ssc summtriEsfrom DCF APS and don't rcquirr tb:c copics. I b*c caclos€d r tepcd sclf-ad&csssdcovclope to ur in mdliagtc reports to my addrc*c. If tbcrc se any additioaal documents

that d@'t fit iE thc mclos€d Eailtr, plasc alat mr sa I rsay retriwc all dosumcatspcrtaining te thi.t s*ae in pasan"

Thanh you for yor coop rariotL

J: t "' 'v'/1 &.u iAel4'1*tO.Lors Haymts JCs: Allan l{ayncsAII:lmlt

F& tj I ji iilllll

hA'{PtlJ6.2

187 1

wc. _***?ryE{qglryg___* and ***_UEU9_st_pFIEEu1{-*_,have been sworn by the rttlicq'r signing llelor+'. anrJ dsclale to that oiEcer on o* oathstiiat the te$tator declaled ,hc instrumenr to be his Last Will anri lesrament and signcrl irin r:ut prercnu{:, &rrd that we each sigeed the instrurlrent as a witn*s.q in the presence oflhe tesutor and of each otircl

S*fu -r{ F'tnr,dscouNrYoF &j.^ i3 "eL

i, Al-l.AN llAltrEs, declare to *ie offica rakiag m1' aclrnowtedgment of thisicsttuIllent, an'J to thc sabscribirrg u.itnesses, thar I signed rhis irxuunenr as my [*riWili ad lestame'lt

ALLATT H.A?IUEH

A,ckaowledgcd and subscr ired befcuc r:lc b), th€ restatet, ALI-AN I{AYjvlES, wha ispersonally known to ine or ,who t'as produu{Sl trt- Dt- --* as identiJicationunci swotn to and .subscrihd ixlbrr mc by the witness€s. _ _

- DIANE tulGcLl=rryq_,

@ r:; '*ho lu;Ptodured as identilicatiou,rnd by I+IH.LISSA-DESEEUW -, *{sjs+er$}rsil} kr-$$n ta T'te cr who hasproduced e-r ideotificatiorl and sUbscribcd h!, m* in rtrepr.*.o** of*itestor"r urrU tlilubssihi:SJr,rirrts€,glatt on - .0€-( il----":ftO,n

L-- oterY Pubiic,rrri,,r orsl-E? Nrrr{ffi;*std Erprirs,beLuI

Iurnrs s8rn8 8{{s},1.tr3rj Exrqrr'., Cf,.fiEaDilvr, $sm f90

noc^ It^rolr, fr.oilE^ 3$31116n9|i4s?3

.'--t tt:.. BElllEd.li i

i-.tlL], .,rI,:6\hf35t)r,itDl31621t I

; ;.,1*,# .i;iiF. J,.i d rf rJtt :?il-<gI" c-; h, Er. ,;q ' r:yF ba

$Gr-r fi, Att.$r llAl unstisi Wa: *Hb

1872

Executed rtt -- , fiolida. on

rhis irrstlumc{t r&a-s signtd. sealed. pubiished. and rleciarciJ by the lestalct as his last

Will and Teslament in,i" ioi"i presence' and al his tequest we have.signcd our narnm es

au*sdng wimxses t" ffi ;;;;r. *a in the pre*nce ol each otler on {he dste first

naitt*n aboro.

AddtsEs

:3SJE(ECUTIIECEN]ENDnI}46SUfrE 190BOCA SATO}i, FL3}3r

t:r8J s[.ffU I M {jE.i&E* mi}EsulTE 190

BocrR Tclt.tL3ls3t

lT,'ffik#r,,*"'*.'srr$f Rl!t,rA'

23rJ EXeOn',MaBHlErDR vE sur E l'oBoce, e.rrn . Frorare If$ t

ir6l)er840?t

l3

aq