G Plus Issue # 28

Preview:

Citation preview

  • 8/9/2019 G Plus Issue # 28

    1/23

    Distributed free of cost

    GLAMOR GOSSIP GRANDEUR

    FORTNIGHTLY ISSUE NO. 28 AUGUST 15, 2010 AUCKLAND

    RAJESH KUMAR- 14 years of Legal & Immigration experience- Specialise in Skilled Migrant Category & Family Residence

    - Study to work t o Residence Permit- Visitor/Work Visa/Permit to Residence Permit for spouse/partner

    - Residence Visa/Permit under Sibling/Adult Child category [last number]- Long Term Business Visa/Permit - Enterprenuer Category [Residence]- Appeal/Review/Reconsideration of declined cases.

    Ph: (09) 279 9228

    Mobile: 021 205 5507

    Fax: (09) 279 9224

    1st Floor, 150-A Great South Road, Papatoetoe, Auckland

    P.O.Box 23450, Hunters Corner, Papatoetoe, Auckland

    E-mail: raj_hannah@yahoo.co.nz

    Immigration Advisor

    Rajesh KumarMA LLB, LLM Hons (NZ)

    AJAY DEVGAN

    I dont go by theI dont go by thenum bers gamenumbers game

    Ajay Devgan is on a newhigh. The actor-produceris going through one ofthe best phases in hiscareer. To start with, heis overwhelmed with theextraordinary response forhis role in Milan LuthriasOnce Upon A Time.Also,producers and directors arequeuing up at his doorstepwith some of the most

    promising offers. He talksabout this wave of successand more.

    2 0 1 0

    ANNUAL

    BOLLYWOODHIGH SCHOOL

    DANCE

    COMPETITION

    SATU DA 2 stAUGUST201 @

    LOG N A PBELLC NT E

    DESI INTERNATIONAL SHOWBIZ PRESENTS

    Full coverage

    on page 6 & 7

  • 8/9/2019 G Plus Issue # 28

    2/23

    AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ ADVERTORIAL02

    1 & 6 - 7 - Cover story

    AJAY DEVGAN

    3 - Stars Birthdays

    4 - Previews

    WE ARE FAMILY

    HELLO DARLING

    5 - Point of view

    BIG B

    8 - 9 - Whats up

    10 - 11 Gupshup

    12 -13 - King PosterCELINA JAITLY

    16 - In the news

    18 - Event

    20 - Star Talk

    DEEPIKA PADUKONE

    22 - NZ diary

    23 - Star Classified

    PUBLICATION DETAILSPublisher: Metsons(N.Z) Ltd.

    Editor: Vinay MehtaAssociate Editor ( Mumbai): M.J. Rajendrakumar.

    Consulting Editor: R Manishaa (manishaa.gplus@gmail.com)

    Address: 17-A, Robson street, Lynfield, Auckland.

    Copyright reserved: Metsons (NZ) ltd.

    For Advertising contact: Vinay Mehta - (09) 6294849,021893424

    e mail: info@gplus.co.nz. website: www.gplus.co.nz

    Editors note,

    Kudos to Ajay Devgn and his performance in Once Upon a Time In Mumbai.

    In comparison to some of our other loud actors, who go overboard with their

    performances, Ajay has this fine art of giving a subtle performance in whatever

    role he attempts. It also reminds me that actors like Ajay are far better in comedythan Akshay Kumar and his types, who make a mockery of comedy, with their

    performances.

    Lets hope the audiences hail more such actors at the box-office.

    Vinay Mehta - Editor

    Readers feedback

    CONTENTS

    NEWZEALAND

    MIGRATION&

    INVESTMENT

    NEWZEALANDMIGRATION&INVESTMENT

    ASSOCIAT ION FORSSOCIAT ION FOR

    TM

    LICENSEDBYImmigration

    AdvisorsAuthority

    TM

    ImmigrationAdvisers

    Authority

    ImmigrationAdvisersAuthority

    newzealand.govt.nz

    JP

    DipB.S; Dip.Co-Law; Cert.BusLaw(UK); Dip.Acctg;Member -NZAMI; Member-MInstCM

    RegisteredMarriageCelebrant

    Member- CANZ

  • 8/9/2019 G Plus Issue # 28

    3/23

    AUGUST 15, 2010, AUCKLAND STAR BIRTHDAYS 03WWW. LESS4U.CO.NZ

    August 13 August 19

    SRIDEVI RANDEEP HOODA

    August 15 August 21

    KAJOL BHOOMIKA CHAWLA

    August 16 August 23

    SAIF ALI KHAN MALAIKA ARORA

    August 16August 16ManishaManishaKoiralaKoirala

    You share your birthday with

  • 8/9/2019 G Plus Issue # 28

    4/23

    AUGUST 15, 2010, AUCKLANDPREVIEWS04 WWW. LESS4U.CO.NZ

    Dharma Productions We Are Family

    is the official remake of the 1988 film,

    Step Mom. Directed by Siddhartha

    Malhotra and produced by Karan Johar,

    the film tells the touching story of a terminally

    ill divorcee who is faced with the prospect of

    accepting the new woman in her husbands lifeas the stepmother of her kids. The film portrays

    the problems that the two face even as they try

    to enter into an understanding. The film will see

    the coming together of two of Bollywoods most-

    talked actresses, Kajol and Kareena Kapoor. The

    last time they were seen together was in Kabhi

    Khushi Kabhi Gham, which was also a Dharma

    Productions movie. The music of the film has

    been composed by Shankar-Ehsaan-Loy. The film

    is scheduled to release on September 10,

    Synopsis: Maya (Kajol) is the perfect mother.

    Her life revolves around her three children, Aleya

    (Aanchal Munjal), Ankush (Nominath Ginsburg),

    and Anjali (Diya Sonecha), who think nothing

    less than the world of her. Despite being divorced

    from her husband, Aman (Arjun Rampal) Maya

    has ensured that everything runs smoothly in her

    house, under her watch, and that they continue

    to remain a happy family unit. However, when

    Aman introduces his girlfriend Shreya (Kareena

    Kapoor), a career oriented woman, who has a lot

    to learn about children, to the family, the situation

    immediately takes an unexpected turn. When an

    incident changes their lives drastically, bringing

    the two women under the same roof, they find

    themselves putting to test an unusual situation.

    Can two mothers make a home?

    Forced to make some unorthodox choices for her

    family, Maya must confront her uneasy equation

    with Shreya and find a way to bring everyone

    together, despite their differences, to make them

    a family once again. Can they make a happy home

    and proudly say... WE ARE FAMILY!

    Character Sketch:

    Kajol as Maya - Maya has never accepted

    that her marriage is over. So she pours her heartinto being the perfect mother. From finding the

    impossible birthday present. to being there for

    every single moment-no one can replace her. Maya

    is focused on bringing up the kids with traditional

    Indian values. She tries to give the children the

    very best that she can. And she makes sure that no

    one else has a say in their upbringing.

    Arjun Rampal as Aman -Aman is the man

    stuck in the middle! He is well respected as a

    professional. He adores his children and tries to be

    there for them as much as he can. Unfortunately

    his career calls him away at crucial moments. He is

    determined not to make the mistakes with Shreya

    that he made in his first relationship. It is really

    important to him that it works out, and he gives it

    his level best.

    Kareena Kapoor as Sherya - Is a young

    designer who is struggling to get her career started.

    She is madly in love with Aman - one of the top

    commercial photographers. She is impulsive,

    bright and unpredictable. Life with her is one

    adventure after the other. She is an independent

    thinker who finds the most unexpected solutions

    to situations and problems. Her bubbly exterior

    masks a tough core. Shreya is a survivor.

    Diya Sonecha as Anjali - Snow white and

    fairy tales are her reality. At six, shes the apple of

    her familys eyes. Her innocence and simplicity

    put a smile on their faces but when the evil witch

    (daayan) enters her perfect fairy tale world, itchanges her understanding to reality and makes

    her ask the question - do good witches also exist!

    Nominath Ginsburg as Ankush - His

    world is full of planets, books and stars. At 10 hes

    quite mature for his age but he never quite allows

    anyone to probe into his heart. His father is his

    hero and his mother his world and somewhere

    deep down he wants his parents to get back but

    when hes thrown into this unusual situation, life

    takes another meaning for him.

    Aanchal Munjal as Aleya -At 13, staying

    in a family without the presence of her father,

    shes the protective sister of the family and her

    mother is her universe but when destiny puts her

    in an unusual situation, the question remains

    whether she will she be able to face the harsh

    realities of life.

    Synopsis:

    Hello Darling is a film about three young, beautiful,

    smart girls (Gul Panaag, Eesha Koppikhar Narang and Celina

    Jaitley) who work in a fashion design company in Mumbai.

    Each are targets of their lusty boss (Jaaved Jaffery) who

    eventually manages to trap them all a sticky situation in

    whi ch al l three are made to dance to his tun es. They mus t

    find ways to wriggle out of his control and unite to cook

    up their own scheme to be free of him and his notorious

    intentions once and for all.

    Who outsm ar ts who m is the basis of this fun fi lled

    hilarious comedy with chart-busting music by Pritam &

    lyrics by Shabbir Ahmed, Ashish Pandit & Kumar. The film

    is directed by debutant Manoj Tiwari and written by Pankaj

    and Sachin who wrote blockbuster comedies like Apna

    Sapna Money Money and Kya Kool Hain Hum.

    Produced by Ashok Ghai under Mukta Arts banner, Hello

    Darling is a rib-tickling, feel-good film all the way. The

    film also stars Chunky Pandey in a brief role. It is slated for

    a 27th August release.

    Character Sketch:

    Gul Panag as Mansi - A car eer- oriente d you ng

    corporate woman who sheds much exuberance amongst

    fellow co-workers. Despite the exploitations of her boss

    Hardik, she clings very tightly to her job as she dreams of

    one day making it big. Sh e teams up with Candy and Satavti

    to teach Hardik a lesson he is not soon to forget.

    Celina Jaitley as Candy - A very sexy- looki ng

    girl who works as a PA to Hardik, and has always beenmisunderstood by her co-workers to be Hardiks mistress.

    She is very romantic at heart and looks after her flop rock

    star boyfriend Rocky (Chunky Pandey). She later partners

    wit h Man si and Sa tvat i in a p lan to put Ha rdik in his ri ght ful

    place.

    Eesha Koppikar as Satvati - She is a middle class girl

    from Hissar, Haryana. She joins company as a fresher and

    gets along instantly with Mansi, realizing the truth behind

    Candys stories, and becoming friends with both. Her entry

    into the office is what acts as a catalyst in the three ladies

    eventually bringing Hardik down on his knees.

    Javed Jaffrey as Hardik - The 35 year old CEO of

    the R B group of industries is an over-ambitious boss who

    has manipulated his way up the ladder, leaving no stone

    unturned to lure young, good-looking girls who work under

    him to make them the prey of his lust.

    WE ARE FAMILY

  • 8/9/2019 G Plus Issue # 28

    5/23

    AUGUST 15, 2010, AUCKLAND POINT OF VIEW 05WWW. LESS4U.CO.NZ

    And I dream of the days when work was scrappy,

    And rare in our pockets the mark of the mint,

    And we were angry and poor and happy,

    And proud of seeing our names in print

    I just chanced upon this little verse and felt it so apt in most of our lives, lives that

    all of us have led and experienced and enjoyed, irrespective of what circumstances the

    words may express.

    Yes, we have all been through those days when we knew and felt

    that the work that we were doing was not what we wanted to be doing

    for the rest of our lives. We wanted work, we wanted to stand on our

    own feet, we needed that independence, we needed to walk away from

    being dependent on others, particularly family and parents. We took on

    whatever came our way. It was a start. A beginning. If we saw a future a

    continuity in it, we remained, if not, we quietly and most politely declined

    it and went our way.But those times were rare. The mark in our pockets of that mint

    lasted but for the shortest period of time. There was the regular upkeep

    and existence that challenged our earnings each month. There was the

    paucity for the luxury and the fun that we could buy. It made us angry.

    Angry because we had the desire, but not the pocket to afford it. Angry

    because we saw others in more affluent situations and lamented the fact

    of not being in their shoes.

    But we were happy. Happy to be where we were, in whatever we were and whatever

    we had. The discomfort of not being in the other league was diminished in the company

    of compatriots who were also in similar conditions. Somehow there was a brotherhood

    of those in the same boat and suddenly it all did not look so bad after all. It became

    fashionable to say we cannot afford it. We said it without any remorse, but with a

    strange sense of pride. It was acceptable that we did not have everything.

    In a sense it egged us on to struggle harder, to work towards a goal that would

    provide us, or put us in that elusive basket where all was not ready made for us.

    And then the print ! The first print mention in a sporting achievement or small

    mention of that theatre experience. An assessment a presence, a few kind words of

    description ; the very first time to confront what others thought of you, not in private,

    but in the realm of a medium that would be public ! Such a joy and feel of

    importance. The exuberance of sharing it with colleagues, friends, family

    and in private repeatedly. Its safe custody in that little drawer where

    all the personal letters were neatly kept. Its presence under the pillow

    for several nights and then finally to store it away reluctantly, to glance

    perchance within a time span !

    The quote is from C.sK. Chesterton ( 1874 - 1936 ) and it is titled the

    Song of Defeat. Six years before I was born he perished, but his thoughts

    relevant today in 2010 in a manner which he may never have everenvisaged. He calls it a Song of Defeat. To me it is a song of victory, as I

    am certain it would be for many others who found themselves perched

    on the fence, about to slide across to the other side where the grass was

    greener.

    It has allowed me to look back. To reminisce, to wonder. It may seem

    that I would have been through with it. It may still return, who knows.

    But it still remains as a symbol to me of all that has an eternal value. One that needs to

    be cherished, embellished and stored.

    Thank you Lord for giving me the opportunity to look upon it in hindsight ..

    You may very well have not !

    Love and affection in more ways than one -

    His success story, star charisma and immense talent remain unparalleled but there is yet an-other quality to Big B that makes him a cut above the rest-the fact that he values every mo-ment of his success. In this piece, he introspects about the little joys of success and how they

    are cherished forever.

    Looking Back

  • 8/9/2019 G Plus Issue # 28

    6/23

    AUGUST 15, 2010, AUCKLANDCOVER STORY06 WWW. LESS4U.CO.NZ

    Your performancein Once Upon

    A Time... has

    come for both

    commercial and critical

    acclaim. How does it feel?

    I am delighted with the

    audience response for the film.

    I always look forward to the

    feedback I get from my fans

    and audiences. Their response

    is an indicator that my hard

    work has paid off.

    Your characterization and

    look in the film has also

    come for appreciation.

    As for the characterization,

    it was entirely director Milan

    Luthrias vision. I did work on

    my look for the film, the long

    hair, the style of dressing. The

    film is based on the 70s so we

    decided that bell bottom pants

    and high heeled shoes, would

    be apt in keeping with the

    period. Also, we all researched

    on the look. Alim Hakim who

    styled my hair remembered

    what the look was in the 70s,

    when he would accompany hisfather on the sets. Designers

    Rishi and Manushi worked

    on the costumes, so it was a

    combined effort.

    How much did you know

    about Haji Mastan as a

    man before you attempted

    the role?

    I knew that he was a

    smuggler but one who was

    very good at heart. Besides, he

    only indulged in the smuggling

    of banned goods. In terms of

    the character, I felt that he

    had a very different persona in

    comparison the other dons, one

    who was mean and at the same

    time romantic. On one side he

    had a wry sense of humour,

    on the other he was very soft-

    hearted, which is why people

    took advantage of him. He has

    a wry sense of humour and at

    the same time he is a softie at

    heart and thats why people

    take advantage of him.

    How was it working with

    Milan Luthria?We are old friends. We have

    grown together over the films

    we have done over the years.

    We did Kachche Dhaage and

    Deewar together we have

    been friends since then, so the

    comfort level is much more

    now.

    You seem to be consciously

    attempting roles in various

    genres, be it drama,

    comedy or action. Are

    you happy with the

    kind of work you are

    doing?

    I do want to get into

    different genres and I

    am making efforts in that

    direction. I am the kind of

    actor who would like to go

    one step further beyond my

    limitations. For me acting is

    a process of eternal learning.

    Also, I believe that every

    person learns from his

    own mistakes.

    You are reportedly

    playing the role of

    a terrorist in your

    next film, Bullet

    Train?

    I would

    not like toc o m m e n t

    on the

    film at this

    stage since

    we have not yet

    started shooting for it.

    However, I will definitely

    be able to talk about

    Priyadarshans Aakrosh. It

    is a complete action film and

    we have just wrapped up the

    shooting for the film. .

    The news goes that

    Aakroshwill have

    you performing

    some dare-devil

    stunts on par with what

    you had done in Patthar

    Ke Phool

    Thats not entirely true. I

    dont think it will be able to

    do the kind of stunts I did in

    Patthar Ke Phoolat this stage.

    When I did the film, I was young,

    fearless and ready to take risks.

    It meant conditioning my bodyand putting in a good deal of

    hard work. Today my body

    may not be able to take that

    kind of pressure. Also my

    responsibilities in life have

    doubled up. I will think twice

    before taking such a step.

    How has Golmaal-3

    shaped up? Are you

    planning to go ahead

    with another

    sequel?

    Its been great

    doing all the

    Golmaalseries. In

    fact, the laugh

    riot seems to

    be getting

    m o r e

    h i l a r i o u s

    with every

    s e q u e l .

    We have

    not yet

    d e c i d e d

    a b o u t

    a n o t h e r

    sequel but

    we may just

    go ahead

    with one. We

    are enjoying iti m m e n s e l y

    and so are the

    audiences.

    What is

    it about

    f i l m m a k e r

    Rohit Shetty,

    that keeps you

    inspired to work

    with him again

    and again?

    I and Rohit have

    been together for the

    last 19 years. We met

    during the making of

    Phool Aur Kaante

    in 1991, my debut venture, in

    which he was working as an

    assistant director. In 2003 he

    turned a full-fledged director

    with Zameen and decided

    to cast me in the lead. Our

    friendship has grown over the

    years and we are more like

    family now. When you are

    friends you share everything.Yes, we do have our share of

    fights and arguments but then

    we dont let it come in the way

    of our friendship. We are no

    longer in the actor-director

    kind of relationship now.

    What according to you is

    the formula for success?

    I dont believe in a success

    formula, nor do I go by the

    numbers game. For me a high

    in my career is the appreciation

    I get from the audiences. On

    my part, I try and choose the

    right films. Like I said earlier,

    success for me is more about

    trying to please my fans and

    fulfilling their expectations.

    Have you ever been

    through a low phase in

    life?

    I have fortunately been lucky

    in my career and have never

    quite seen low phases. I have

    been working continuously for

    the last 20 years. I didnt have

    a hit for one or two years but

    that didnt dampen my spirits.

    Do you ever carry your

    stress back home?I never do that. For me the

    moment I pack up, I switch off.

    If you take your work home,

    your life gets disturbed. It

    can get dangerous to a point

    where people end up becoming

    a wreck. I can remember

    only one occasion when I got

    seriously intimidated by the

    character I was playing. That

    was the role of Bhagat Singh

    for which I had done immense

    research. We didnt want to

    make mistakes so I had to be

    careful but I ended up thinking

    about him day and night.

  • 8/9/2019 G Plus Issue # 28

    7/23

    AUGUST 15, 2010, AUCKLAND COVER STORY 07WWW. LESS4U.CO.NZ

    How beneficial is it when an

    actress is your wife?

    Its much easier. She understands

    my pressures. She understands when

    I cant give her time. I can discuss

    my work with her and take her

    suggestions.

    You are heading for fatherhood

    once again. How does it feel?

    I am excited and am looking forward

    to becoming a father for a second time.

    I am keeping my fingers crossed. I

    am not gender biased. I want to have

    a healthy child. In fact my daughter,

    Nysa is more excited and is looking

    forward to have a sibling. I am thinking

    of giving up smoking now.

    By Sharmishta T

    I dont think it will be able to do the kindof stunts I did in Patthar Ke Phool at this

    stage. When I did the film, I was young,fearless and ready to take risks.

    Auckland office:

    1/131 Kolmar Road, Papatoetoe, Auckland Phone 09 929 3855

    Email Bakshi.mp@parliament.govt.nz

    Postal Address P O Box 23136, Hunters Corner, Auckland 2025

    www.national.org.nz

    Were working for you

    Kanwaljit Singh Bakshi MP and Hon John Key, MP for Helensville, Prime Minister

    GET JOHN KEYS NEWSLETTER

    www.johnkey.co.nz

    Zoya Akhtars cast zooms off on long drives every dayNEWS

    Film-maker Zoya Akhtar has devised new ways to ensure

    that the actors starring in her film, Zindagi Mile Na Dobara,

    share a great comfort level and are in tune with each other.

    Since her movie is about a road trip of three best friends played

    by Hrithik Roshan, Farhan Akhtar and Abhay Deol, besides the

    lead girls Katrina Kaif and Kalki, Zoya has asked them to hang out

    together everywhere

    they go.

    She even asked

    the five actors to

    take long drives

    together so that they

    could get friendly

    with each other and

    the chemistry would

    eventually reflect onscreen. Besides, Zoya

    has set up the sets at

    a 40 to 45 minute

    drive from the hotel.

    This way the actors

    leave together for

    the shoot and return

    together. The entourage follows them later. This gives them more

    time with each other.

    Unit sources inform that the actors are having a blast on the

    sets with each other ever since. In fact, they have all become so

    comfortable that they dont go out without each other so much

    so that they even cycle and gym together these days. That sure is

    a novel way of making work an enjoyable experience. The other

    directors need to take a cue from Zoya.

  • 8/9/2019 G Plus Issue # 28

    8/23

    AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ08 WHATS UP

    Remembering Mr. Bharaton Independence Day

    Asif Bhamlas birthday bash

    Television Producer, Manish Goswami, Bhojpuri superstar Manoj

    Tiwari and music connoisseur, Anil Mishra presented Manoj Kumar,

    popularly known as Mr. Bharat, Indias national flag for his patriotic

    movies ahead of Independence Day celebrations on August 15. Needless to

    add, the veteran actor was delighted at the gesture. He was too happy to see

    the flag as he hugged it, said Mishra.

    Politician Asif Bhamlas recent

    bir thd ay bas h at Cest la via

    lounge in Bandra witnessed a

    deluge of celebrities from all walks

    of life. The day also happened to be

    the 12th anniversary of his N.G.O

    We Love India that supports

    education for the poor, the cause

    of the spastics, autism, deaf and

    dumb. A number of people from the

    film, business, political and social

    fraternity, were seen at the event.

    Among the pro min ent people

    from the film fraternity who were

    present were Vivek Oberoi, Bindu

    Dara Singh, Apoorva Lakhia,

    Shekhar Suman, and Parmeet Sethi

    wit h his wif e Arc han a Pur an Sin gh,

    Mink, producer Manish Goswami

    and Manoj Bidwai.

    The cast and crew of Ram

    Gopal Vermas latest film,

    Raktacharitra threw a party

    to celebrate the films completion.

    Randeep Hooda, Makrand

    Deshpande and Ram Gopal Verma

    were s een enjoy ing their drinks whi le

    Vive k Oberoi hit the danc e f loor a nd

    showed his moves in the midst of the

    whole crew. Vive k looked radiant in

    his new moustached avatar that he

    has donned for the film. Also present

    were Nikhil Dwiv edi and Arja n

    Bajwa.

    Entrepreneur turned actor, Boman Irani recently took on a new mission.

    Boman has chosen to become the face of the NGO Ahead which believes

    in theatre for a purpose and entertainment for a meaning. Boman revealed

    this at a press conference held at The Leelas, where he expressed his solidarity

    for the development of the disabled. He also announced a fund-raiser play titled

    The Melody of Love, starring Tom Alter, Lillette Dubey, RJ Mantra and Indias

    only National and Presidential award winner Divya Arora, who is also disabled

    and is the soul of the organization.

    Ram Gopal Varmas memorable

    Raktacharitra party

    Boman Irani becomes the Brand

    Ambassador of the NGO AHEAD

  • 8/9/2019 G Plus Issue # 28

    9/23

    AUGUST 15, 2010, AUCKLAND WWW. LESS4U.CO.NZ 09WHATS UP

    Actors who are looking at Hollywood as their final destination may

    wel l be hap py to lea rn tha t the y can get a hel pin g han d fro m Poo ja

    Batra in their Hollywood endeavours. The former model-turned-

    actress who was seen in super hit films like Virasat, Kahin Pyaar Na Ho

    Jaaye and Haseena Maan Jaayegi, and settled in Los Angeles after her

    marriage, has now started her own casting agency, Glow Bell Inc., in L.A.

    We now hea r t hat her com pany i s help ing LA cas tin g, a f ull -fl edg ed cas tin g

    agency to set shop in India.

    Pooja will be spearheading the India operations and will thereby render

    a platform to industry professionals to get one step closer to Hollywood.

    People who are looking to cast Indian models or actors in Hollywood or

    even Indian productions will now have a professional helping tool to select

    the talent from a pool, Pooja explains.

    Incidentally, Poojas company had acquired Sylvester Stallone and

    Denise Richards for Sajid Nadiadwalas Kambakkht Ishq last year. With

    such interesting work under her kitty, Pooja Batra gives the phrase Beauty

    with b rai ns an alt ogethe r n ew mea nin g.

    Pooja Batra: ConnectingHollywood & Bollywood!

    PLUSTAILORING LTD

    HOLLYWOODBOLLYWOOD

    TAILORINGALTERATIONS

    MOVIES, GAMES,

    AUDIO CD'S

    MADE TO MEASURE

    OPEN 7 DAYS Mon-Thur- 10.30am-8 pm. Fri-Sun - 10.30am-9pm

    Phone

    Mob

    Fax

    SHOP 23, 16 LAMBIE DR

    MANUKAU, AUCKLAND

    Email: dvd.pulse@ymail.com

    Saree Blouses / Salwar Kammez

    Puletasis

    Ball & Wedding Dresses

    Men's Garments

    Uniform Contractors

    Western & Island Garments

    :

    :

    :

    (09) 262 1113

    021 026 73452

    (09) 262 1103

    Ladies, Gents, Childrens Wear

  • 8/9/2019 G Plus Issue # 28

    10/23

    AUGUST 15, 2010, AUCKLANDGUPSHUP10 WWW. LESS4U.CO.NZ

    Anil Kapoors new Papa!

    Anil Kapoor has found himself a

    new Papa and before you start

    getting ideas...its none other

    than Siddhartha Kannan. Recently

    Anil went for a studio interview

    for Sids show...When Sid

    asked him the secret behindhow he was looking younger

    by the day, Anil told him

    about his five plastic

    surgeries and his nose

    rectification job.

    However, knowing

    his penchant for

    humour, Anil

    suddenly stood

    up and called

    him Papa Sid to

    which Sid promptly

    replied, I always wanted a son like you-

    Beta Anil.

    Anils daughter Rhea and music

    composer Amit Trivedi went berserk

    laughing at the Father -Son duo

    having a blast with each other.

    The icing on the cake was Anilasking Sid for his aashirwad

    which Sid was more than happy

    to oblige!

    When asked about his

    experience with Anil

    Kapoor, Sid says, His

    humility touches your

    heart and his sense of

    humour can teach a

    thing or two to the best

    of comedians.

    Actress Mugdha Godse is merely

    two films old and is eagerly looking

    forward to her first horror movie

    but the actress already has enough horror

    tales to narrate. I knew it was too early in

    my career to do such a film but then when

    I heard the script, I simply couldnt say no,

    she says.

    In the film, Mughda plays the role of

    Pia, the wife of a horror film-maker. We

    have marital problems and in the midst of

    the troubled marriage we have to rush to

    Mauritius to visit my ailing father. Thats

    where we find unusual things happening

    around us.

    The last time Mughda had a tryst with

    ghosts was during her modeling days.

    We were put up at a hotel and I was with

    another model. I thought she was talking to

    her boyfriend on the phone and asked her

    about it. However, I later learnt that she

    believed the same and we both continued to

    hear the same voice through the night. We

    changed our rooms the very next morning,

    she recalls. After all the experiences, the

    actress has now overcome her fear about

    ghosts. She even makes it a point to watch

    horror films now. I can afford to watch one

    horror film every week now. And I enjoy

    watching it in the dark, she smiles.

    After Raavan, Aishwarya is looking

    forward to working with hubby

    Abhishek Bachchan once again.

    We hear that the actress has agreed to

    do a cameo in Rohan Sippys Dum Maro

    Dum. According to sources often visited

    the sets to meet her hubby. So when

    Rohan Sippy wanted an actress for a

    cameo, hers was the first name that came

    to his mind. Ofcourse, Ash was more than

    delighted to accept the offer considering

    that she and Abhishek hardly ever got

    time together with the many solo films

    they had signed earlier. In fact, the two

    have now decided that working together

    is the best time spent with each other,

    be it films or commercial. Coming back

    to Dum Maro Dum, the action thriller

    has Abhishek playing the role of an

    undercover cop on the lines of his father

    Amitabh Bachcans role in Zanjeer

    during the 60s.

    Now that the Pataudi

    girl, Soha Ali Khan

    has openly admitted

    to being in relationship with

    actor Kunal Khemu, we hear

    more and more about this

    latest Bollywood couple.

    Sources reveal that when

    Kunal celebrated his birthdayin May, Soha had also gifted

    him a watch that cost her

    Rs 4 lakhs. Kunal has been

    happily flaunting his gift to

    his friends ever since. In fact,

    word goes that Soha has also

    met Kunals parents and often

    stays back at his home for

    dinner, whenever she visits

    them. However, though

    both Kunal and Soha have

    met each others parents,

    marriage is not quite on the

    cards for the couple yet, this

    source reveals.

    Aishwarya and Abhishek are hoping to w ork with each otherAishwarya and Abhishek are hoping to work with each other

    Bollywoods

    NewestCouple

    MughdaGodses

    horrortales

  • 8/9/2019 G Plus Issue # 28

    11/23

    AUGUST 15, 2010, AUCKLAND GUPSHUP 11WWW. LESS4U.CO.NZ

    Qudos to Dev Anand

    Ever green actor Dev Anands

    energy is commendable. The 87-

    year old actor, who refuses to get

    bogged down by his age, is now set to

    remake his memorable hit, Hare Rama

    Hare Krishna. He recently revealed

    his plans and also admitted that hewas planning to shoot the entire film

    in Nepal like the

    earlier version.

    People often

    keep asking me

    about the remake

    of Hare Rama

    Hare Krishna

    and this has been

    going on in my

    mind for some

    time. I have

    many scripts.

    I am all alone

    but not lonely.

    If people can

    remake Hindi

    movies and southmovies here in

    Hindi, why cant

    I remake my own

    film? What fun

    is it to wear anothers shirt? he asked

    enthusiastically

    When asked if he would cast Zeenat

    Aman in the lead again Dev Anand said,

    Dont be surprised. I will cast anyone

    who does justice to the role. India is a

    beautiful country and there are many

    young good-looking boys and girls on

    the streets who dream of becoming

    stars. They call me up saying that they

    want to be film stars but are not getting

    breaks.

    Hare Rama Hare Krishna was

    made keeping in mind the hippie culturethat was rampant in those times. There

    were hippies in the

    70s, now it is the

    drugs he added.

    Currently, Dev

    Anand is busy

    preparing for the

    release of his latest

    directorial venture

    Charge sheet, a

    suspense thriller

    in which he plays

    the pivotal role.

    The film also stars

    Samajwadi leader

    Amar Singh as a

    home Minister. I

    met Amar Singhat a party and he

    hailed me. I hailed

    him back. He

    asked me when I

    am going to cast him in my film. I told

    him about this role in Charge sheet and

    he agreed. We shot at his home in Delhi.

    He is very ---happy with the outcome.

    You can feel the dream in his eyes he

    concludes. Qudos to ever-green young

    hero.

    SALON

    SALON365

    For all kinds of Hair and

    Beauty Treatments

    365 Bolckhousebay Road, Auckland-1007Ph. : 09-8288925 A/H 09 829 2020

    Urmy Goradia

    Big Showroom Big Sale

    Bridal Lehngas Designer Sarees Ladies Suits2 White Swan Road, M t Roskill, Auckland

    Ph: 09 627 6404www.khoobsuratnz.co.nz Email: khoobsurat@xtra.co.nz

    Undercover Car Park

    A i s i v a r i e t y j o h p a h e l e k a b h i A u c k l a n d m e i n d e k h i n a h i

    Sale $1, $2, $3

    Shop 2 Win

    Shop at Khoobsurat and get a

    chance to win prizes

    Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale

    Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

    Sale

  • 8/9/2019 G Plus Issue # 28

    12/23

    AUGUST15

    ,2010,

    AUCKLAND

    AUGUST15,

    2010,

    AUCKLAND

    KINGP

    OSTER

    KINGP

    OSTER

    12

    13

    CnCelinascareerisonarollThehotandsexyCelinaJaitlyisbetterknownforthesocialcausessheisassociatedwith.However,thesedaysthelissomelassisinthenewsforhercareermovesandthemanyfilmsshehasbagged,allofthemwithpromisingdirectorsand

    peculiarlyEnglishtitles.WejusthopetheEnglishmantraworksforCelinaattheboxoffice.

  • 8/9/2019 G Plus Issue # 28

    13/23

    7KHWK$QQXDO%ROO\ZRRG+LJK6FKRRO'DQFH&RPSHWL

    WLRQ&RXQWGRZQ

    7KH+HDWLVRQIRUWKH)LUVW6SRW

    /RJDQ&DPSEHOO&HQWUH6DWXUGD\$XJXVWVWSPVKDUS

    7KHPXFKDQWLFLSDWHGDQGDZDLWHGWKHDQQXDODQGRULJLQDO%ROO\ZRRG+LJK6FKRRO'DQFH&RPSHWLWLRQLVKHUHDJDLQ7KHWK\HDULQWKHUXQQLQJWKLV\HDUVWKHPHLVWKHIXVLRQRI%ROO\ZRRGZLWK+ROO\ZRRGWKDWZLOOGHSLFWWKHDVVLPLODWLRQRIRXU.LZLGLYHUVLW\WKURXJKGDQFHPXVLFDQGDUWV7KH*OLW]WKH*ODPRXUWKH7DOHQWZLWKKHDUWWKUREELQJSHUIRUPHUVLVDOOVHWWRNLFNRII%HWZHHQWR+LJK6FKRROVIURPDOODURXQG1RUWK,VODQGDUHQHUYRXVEXWFRQILGHQWWRSHUIRUPDQGFRPSHWHDJDLQVWHDFKVFKRROWRZLQWKLV\HDUVFURZQ

    /DVW\HDUVZLQQHU3DSDWRHWRH+LJK6FKRROZLOOWU\WRPDNHLWWZRLQDURZZKLOHWKHILUVWUXQQHUXS.HOVWRQ%R\V+LJK6FKRRODQGWKHWKLUGSODFHJHWWHU0DQXUHZD+LJK6FKRROZLOOGRWKHLUXWPRVWEHVWWRWXUQWKHWDEOHVDQGWDNHWKHFURZQ2IFRXUVHQRWIRUJHWWLQJWKHXVXDOSURPLQHQWVFKRROVIURPLQDQGDURXQG$XFNODQG7KHVFKRROVKDYHEHHQEXV\SXWWLQJHYHU\WKLQJWRJHWKHUDQGWKHUHDSSHDUVWREHDQHOHPHQWRIH[FLWHPHQWWKULOODQGHYHQVHFUHF\DVWKH\DUHQRWZLOOLQJWRWHOORWKHUFRPSHWLWRUVZKDWWKH\KDYHXSWKHLUVOHHYHV7KH\KDYHEHHQSUHSDULQJVSHFLDOFRVWXPHV WRVXLWWKHLUUHVSHFWLYHLWHPVDQGWKHVHWXS5HKHDUVDOVKDYHEHHQKHOGFRQWLQXRXVO\WR UHDFKWKHSHDNRISHUIRUPDQFHWKDWV\QFKURQLVHVZLWKWKHPXVLFDQGPRYHPHQWV(DFK\HDUVFKRROVDUHJHWWLQJPXFKPRUHFRPSHWHQWZKLFKPDNHVLWPXFKKDUGHUIRUWKHMXGJHVDQGDXGLHQFHWRMXGJHDVWKHLUSHUIRUPDQFHJRHVXSRQHQRWFKKLJKHUDQGMXGJLQJJHWVKDUGHUDQGFRQIXVLQJ7RPDNHMXGJLQJHDVLHUVRPHFKDQJHVKDYHEHHQPDGHWKLV\HDU7KHRUJDQLVHURIWKH&RPSHWLWLRQ'HHSDH[SODLQHGWKHFKDQJHV

    ,QRUGHUWRPDNHLWPRUHFRPSHWLWLYHIRUVWXGHQWVWHDFKHUVMXGJHVDQGWKHRUJDQL]HUVWKLV\HDUZHKDYHPDGHWKHMXGJLQJFULWHULDPXFKKDUGHUDQGFKDQJHGRXUSRLQWVV\VWHP:HKDYHPDGHLWWRDSULYDWHMXGJLQJDQGSXEOLFMXGJLQJ6FKRROVDUHDOOVHWDQGH[FLWHGDERXWWKHVHFKDQJHVDQGDUHPXFKPRUHPRWLYDWHGDQGFRQILGHQWWRGHOLYHUWKHLUEHVWSHUIRUPDQFHWKLV\HDUWRWDNHWKHFURZQ6D\V'HHSD%LQHVK.XPDU 6XPHU WKHFRQYHQRURI WKHSURJUDPPH LVD IDPLO\SHUVRQ IURP D VWDEOH IDPLO\EDFNJURXQGZLWK KLVGDXJKWHUVDQGVRQVJLYLQJDKHOSLQJKDQGWRPDNHWKLVDIDPLO\DIIDLU+HDSSUHFLDWHVDQGSURPRWHVIDPLO\YDOXHV,QWKLVUHVSHFWIDPLOLHVDUHDVVXUHGRIWKHWLJKWHVWVHFXULW\DWWKHYHQXHZKLFKZLOODOVREHDVPRNHIUHHDQGDOFRKROIUHHDUHDIRUWKHIXQFWLRQ)RRGDQGQRQDOFRKROLFKRWDQGFROGEHYHUDJHVZLOOEHRQVDOHDWWKHIXQFWLRQ7KHUHIRUHPDNHWKLVDZRUWKZKLOHHYHQLQJIRUWKHZKROHIDPLO\IRUDQLJKWRXWWRDPDJQLILFHQWWKXQGHURXVDQGGD]]OLQJEDWWOHRIWKHEHVWLQWKH%ROO\ZRRG+LJK6FKRROGDQFHFRPSHWLWLRQ&RPHRQDQGZLWQHVVWKHEHVWRIEHVWLQWKLVWKDQQLYHUVDU\RIWKHRULJLQDO%ROO\ZRRG+LJK6FKRRO&RPSHWLWLRQ

    *HWUHDG\IRUWKHHYHQWRIWKHGHFDGHFRPLQJVRRRQYHU\VRRRRRQVW$XJXVW

    6((

  • 8/9/2019 G Plus Issue # 28

    14/23

    2 0 1 0

    ANNUAL

    BOLLYWOODHIGH SCHOOL

    DANCE

    COMPETITION

    UR 21s 0LOG AM .

    TICKETS AVAILABLE AT ALL MAJOR INDIAN OUTLETS & PARTICIPATING SCHOOLS

    * Conditions Apply

    A DESI INTERNATIONAL SHOWBIZ PRESENTATION

    TICKETFOR ALL

    AGES

    Alfriston College Auckland Girls Grammer Avondale College Botany Downs CollegeDe La Salle College Epsom Girls Glenfield College Hamilton Boys High

    James Cook High Kelston High Lynfield College Marist CollegeMt Albert Grammer Mt Roskill Grammer One Tree Hill College Onehunga High

    Otahuhu College Pakuranga College Papatoetoe High Rutherford CollegeSouthern Cross College Westlake Girls High Edgewater College Greenbay High School

    St Kentigern College Tangaroa College TuaKau CollegePukekohe High Strathalan College

    For Further details contact Deepa on 021 527 970 or Binesh 021 496 321, A/H 828 0150 or visit www.desiinternationalshowbiz.co.nz

    Binesh Sumer

    AUCKLAND

    INDIAN SWEETS

    MONUMENT

    VIDEO

    INDIAN SWEETS & VIDEO

    MANUREWA

    (dj nigels)'*-.$*5:K N Kitchen Joinery Ltd SN Windows & Doors Ltd Catering Masters Ltd SMOKE FREE

    Mt.Roskill

    Raj KumarBarfoot & Thompson, Manurewa

  • 8/9/2019 G Plus Issue # 28

    15/23

    AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ16 IN THE NEWS

    Mallika Sherawat now shifts her gaze to Bollywood

    Manisha Koirala signs her first film post marriage

    Mallika Sherawat is certainly

    making hay in Hollywood

    while the sun is still shining

    there. But the actress is a bit anxious

    that her Bollywood fans may soon

    forget her and consider her a non-

    entity here, which is why she has gone

    ahead and signed a Hindi film with

    director Indra Kumar. Reportedly,

    Mallika has replaced Vidya Balan in

    the much awaited sequel of Dhamaal

    titled Dhamaal-2 after the latter opted

    out of the film.

    It may be recalled that Mallika has

    not had a single Hindi release after

    Dashavatar in April last year. Her

    last two releases were both Hollywood

    ventures namely, Hisss and Love

    Barrack. We will have to wait and watch

    whether Dhamaal indeed proves to be

    a fun-ride for her after her tryst with

    Hollywood.

    Actress Manisha Koirala, who

    quit the industry midway, is

    looking at a second innings

    in the industry post-marriage.

    film Jai Bhim, in which she

    will play the role of a hard-core

    politician- a Dalit leader.

    It may be recalled that

    Manishas last movie was Partho

    Ghoshs Ek Second Jo Zindagi

    Badal De, after which she decided

    to switch over to filmmaking. Later

    she even trained in filmmaking

    at New York and announced her

    decision to direct a film. However,

    the actress seems to have

    postponed the project for now.

    I dont know when I will start

    directing it. First, I have to get myacting career back on track. Thats

    why I am giving a lot of thought

    to the movies I sign, she revealed

    when asked about it.

    Jai Bhim is being made under

    the banner of Yograj Cinevista,

    with the producer and director

    both hailing from Dehradun. So

    far only cinematographer Ashok

    Mehta has been signed for the

    movie.

    The producers are now

    planning to promote local

    talent through the film and will

    be shooting the entire film in

    Dehradun to promote the place

    through their film.

    Salman Khan is no doubt known

    for his obstinate nature and his

    whimsical ways but the superstar

    has always come for praise for his one

    quality- his extensive charitable work.In fact, Salman does not spare a single

    moment when it comes to espousing a

    charitable cause. Recently, when he was

    shooting for a film in Sri Lanka, Salman

    chose the opportunity to continue with

    his charitable work under the aegis of

    Being Human foundation. The actor

    provided a bright future for the poor in

    Jaffna and Vavuniya, by organizing 500

    cataract operations in both the cities in

    a span of 10 days. He also flew down

    four doctors especially from Mumbai to

    perform the operations.

    We are not surprised why Salman

    Khans fan-following only seems to be on

    the rise as the years pass by. Accordingto Deepak Anand, who worked on the

    production team of Salmans last film

    Veer and has just started an acting

    academy in Bengaluru, students who

    have started enrolling are keen to

    know whether their favourite Salman

    Khan will be part of the faculty. Anand

    constantly jokes that he would need

    military security if Salman Khan visits

    the academy. The excitement and craze

    for Salman is so huge he says.

    Theres bad news for

    those who were looking

    forward to play the

    role of Buddha in Ashutosh

    Gowarikers next magnum

    opus. Reports suggest that the

    Rs 600 crores film which was

    announced with much fan fare

    has been shelved as of now.

    Sources inform that

    the producers had initially

    announced the film on a grand

    scale. However, as the days

    passed by, they cut down their

    budget drastically from Rs 600

    crores to Rs 60 crores, which

    Ashutosh did not accept kindly.

    The subsequent changes in the

    script also put the director offand he decided to wash his

    hands off the project.

    According to a source

    associated with the movie, the

    producers have now shut down

    the pre-production unit of the

    movie. They had started a unit

    at J.W. Marriot which was going through the photographs and video of aspiring

    actors for the role of Buddha. Bu the unit was shut down recently.

    It may be recalled that Gowariker had even finalised an international crew

    with big names like Karl Walter Lindenlaub (cinematography), Jarrod Linton

    (pre-visualisation), David Ward (script-screenplay), David Russell (storyboard

    artist), Glenn Boswell (action), April Ferry (costumes), Dileep Singh Rathore (co-

    producer and line producer) and Nitin Desai (art) for Buddha. The movie, which

    focuses on the life of Prince Siddhartha and his journey to enlightenment, was

    scheduled to start by the year end.

    Salmans

    charitableintentions

    Buddha shelved.

  • 8/9/2019 G Plus Issue # 28

    16/23

    RAKSHABA

    NDHANSPE

    CIALSALE

    RAKS

    HABA

    NDHA

    NSPE

    CIAL

    SALE

  • 8/9/2019 G Plus Issue # 28

    17/23

    AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ EVENTS18

    Salman Khan to host Bigg Boss 4 on COLORS

    Kangana Ranaut is

    on cloud nine

    Le a d i n g

    e n t e r t a i n m e n t

    channel, COLORS

    recently announced

    the most Wanted superstarSalman Khan as the seasons

    host for its electrifying

    reality TV show, Bigg Boss

    4, expected to go on air later

    this year.

    Salman is expected to

    take the excitement higher,

    even as he goes about with

    his spontaneous best, read

    bru tal ly hon est and blu nt

    manner with the inmates

    of the Bigg Boss house!

    Housemates, who used to

    eagerly await their face timewith the hos t, wil l now pra y

    to avoid their face-off time

    with h im.

    Wit h Sal man s ent ry, the

    host will undergo a total

    change in his attitude towards

    the inmates. In the earlier

    seasons of Bigg Boss, the

    host acted as the housemates

    friend, philosopher and guide

    - but now with Salman the

    host will become HOSTyle.

    Whi le Salman wi ll be a fr ien d

    for those who play it clean...he will be seen showing his

    hostility towards those who

    indulge in manipulation,

    back-b iti ng and pol iti cs.

    Talking of his association

    with Big g Bos s, Sal man

    Khan, commented, From

    all the reality television

    shows I have seen, Bigg Boss

    has always intrigued me

    the most. It is amazing to

    see how people react under

    unique circumstances. I am

    clear as the shows host that

    I will not take any hypocrisy

    and politics lightly. For those

    who pla y cle an, the y wil l

    always find their best friendin me those who dont, be

    ready to expect the worst.

    Salmans inimitable

    style, candid persona and

    exceptional sense of humour

    are sure to make Bigg Boss

    Season-4 memorable.

    said, Ashvini Yardi, Head

    Programming, COLORS.

    K

    angana Ranaut

    certainly seems to be

    going places. After

    the success of Once Upon

    A Tim e, she is bei ng

    flooded with offers, one

    of them being Sanjay

    Dutts first home

    production Rascals.

    Reportedly, Sanjay

    Dutt and David

    Dhawan, who

    had seen Once

    Upon a Time..

    felt that she

    would be jus t

    apt for the role

    in the film

    they were

    p l a n n i n g .

    M o r er e c e n t l y ,

    David Dhawan

    happened to

    spot Kangna at

    an awards night

    and immediately

    expressed a keen

    desire to work with

    her. Kangna is of

    course enjoying this

    new high in her career

    and is busy giving her nod

    to the best of films. Rascals

    wil l be Kanga nas seco nd fi lm

    wit h A jay aft er Once Upon A

    Time in Mumbaai

  • 8/9/2019 G Plus Issue # 28

    18/23

    1st PRIZE

    Sponsored by

    G:6A>INIKH=DL

    AUCKLAND,WELLINGTON,HAM

    ILTON,

    CHRISTCHURCH,TAU

    RANGA,

    NEWPLYMOUTH,ROT

    ORUA

    TAUPO,DUNEDIN....

    TheCCC

    In Association With

    NOTE: SEMI FINAL Contestant names are

    Model may vary

    Media SupportSupported by

    PAKURANGA

    Event Managed by

    PlymouthInternational

    Hotel &Conference

    Centre

    N E W Z E A L A N D

    LIVE GRAND FINALE ON SAT 25TH SEPTEMBER AT DOROTHY WINSTONE THEATRE

    Major Sponsors

    KELSTON

    THIS AUGUST WATCH

    STAR OF NEW ZEALAND ON

    EVERY SATURDAY

    10.30 AM

  • 8/9/2019 G Plus Issue # 28

    19/23

    AUGUST 15, 2010, AUCKLANDSTAR TALK20 WWW. LESS4U.CO.NZ

    You seem to be on a career

    high with four significant

    releases this year. Which

    one of them are you

    particularly looking forward to?

    I would say that the year started on

    a very promising note with the success

    of Housefull. I now have Yash Raj

    Films Lafangey Parindey up for release,

    besides Break Ke Baad opposite Imran

    Khan and Khelein Hum Jee Jaan Se

    opposite Abhishek Bachchan. The

    interestingly feature of all these films are

    that they all belong to different genres

    and each of them has unique role for me.

    I am glad that I am being offered different

    roles and getting an opportunity to work

    with the best of directors.

    Tell us about your role in Lafangey

    Parindey.I play a blind girl by the name of

    Pinky Palkar who is confident, ambitious

    and a fighter to the core. She knows what

    she wants and where she is heading for

    despite her handicap. I could well relate

    to the character because thats the way I

    am made. Like Pinky, I dont give up on

    things easily and pursue my goals to the

    very end.

    Reportedly the role was a tough

    challenge and you had extensive

    workshops before you started

    shooting for the film.

    It is true that the role of Pinky Palkar

    was not particularly easy. I play a blind

    girl and doing all the stunts being blind

    was not easy. I would often close my eyes,

    practice them and later try them once

    again with my eyes open. Nevertheless,

    the fact that I came from a sports

    background made things fairly easier for

    me. My demeanor can be lady-like but

    the moment I put on my track pants and

    T shirt, I can be as good as the boys

    on the field with a ball. My knowledge

    of skating and Bharat Natyam, came

    in handy, in the way I could pick up

    the nuances of the character. Also, the

    entire group of five boys and girls had to

    be alert about the fact that I was playing

    a blind girl. One wrong move could mar

    the movie. So we had intense work shops

    with blind people before we took on the

    movie.

    You have attempted stunts in your

    last film too. How different was

    this experience?

    Earlier in Chandni Chowk To China,

    I trained in martial arts for the role. I

    did enjoy the stunts at that time too. But

    somewhere there is a child in everybody.

    There are days when you want to go one

    step beyond your perceive limit and take

    up the challenge, which is what I did in

    Lafangey Parindey.

    You have also been training inscuba diving and paragliding. Is it

    for the same movie?

    No it was merely to get out of the

    phobia of creepy crawly creatures that I

    decided to train in scuba diving. Now that

    I am a certified diver, I have overcome all

    such fears. Likewise, I had fear of heights

    so I decided to take up paragliding. It

    was a wonderful experience.

    How was the bonding with co- star

    Neil Nitin Mukesh?

    I think I have discovered a friend for

    life in Neil. He is a wonderful human

    being and the bonding we share has come

    across wonderfully on screen. We got

    along really well during the shoot. There

    was an accident scene, where I neededa different kind of make-up and Neil

    was trained in it so he told the director,

    Pradeep Sarkar that he would do my

    make-up, which he did. On another day

    when I was doing an action sequence

    which needed a lot of cable work, he

    choreographed the entire act. So I think

    he was there for me all the time.

    Do you find it easier to bond with

    co-stars with whom you share a

    certain relationship?

    I dont know about that but I try and

    concentrate on my work irrespective of

    how far I am close to my co-star. At the

    end of the day, we are professionals and

    have to do our work.

    It is rumoured that Salman Khan

    and John Abraham are keen on

    working with you.

    I dont know why people assume

    things and draw conclusions prematurely.

    At times we actors do listen to scripts

    which dont necessarily work out all the

    time. I am indeed doing a film with John

    Abraham which will be directed by Rohit

    Dhawan but yes, I am dying to work with

    Salman.

    Do you go by your gut instinct when

    it comes to choosing roles?

    Not really. I am an actor and I need

    to be convinced about the character I am

    playing. It is important for me that I enjoythe process and also be part of projects

    with the best of directors. Tomorrow I

    should not have doubts whether I have

    chosen the right film. Fortunately, most

    of my films except Chandni Chow To

    China have done well. This is my eighth

    film and I would not know whether it will

    be a box-office success. But I do want

    people to stand up and acknowledge my

    talent. I think the process has already

    started after Love Aaj Kal. That is what

    Adi (Chopra) said when he offered me

    this role. I feel that if I am indeed getting

    great opportunities, it means that I am

    doing good work.

    By Sharmishta T

    u seem to be on a career was not easy. I would often close my eyes, the nuances of the character. Also, the

    wa

    w

    P

    m

    w

    w

    c

    h

    D

    c

    c

    c

    h

    DEEPIKA PADUKONE

    I have discovered a friend for life in NeilI have discovered a friend for life in NeilHer Bollywood debut, Om Shanti Om, proved to be a smashing success and madeDeepika Padukone an overnight box-office sensation. Her subsequent string of successesfurther consolidated her position but none of them matched up to the success of herfirst film. The ambitious model-turned-actress has a line-up of promising releases this

    year starting with Lafangey Parindey. She talks about this and more.

  • 8/9/2019 G Plus Issue # 28

    20/23

    Genre: Musical Comedy

    ProductionHouse: Purple Post LimitedRun Length: 120 mins

    Language: Fiji Hindi (English Sub titles)

    Locations: Auckland, Napier, Fiji Islands.

    Cast: TBA

    Crew: New Zealand /Fiji

    Story and Script Development: Jan - March 2009

    Script treatment March 09

    Location Scouting March 09

    Shooting Schedule: April /May 09

    (tentative) 15 days in Auckland, 5 Days in

    Fiji

    Release Date: AUg/Sept 2009

    Script/Screenplay Monti Issar

    Producer: Monti Issar, Sridhar Kallidai,

    RonellDirector: Nirang Desai/ Monti Issar

    Production Controller: Bali Virk

    Sound Andy Schurr

    Continuity Mac

    DOP/ Camera: A. N. Baig

    Associate Producers: Binesh

    Music: TBD

    Lyrics: TBD

    Choreographer: TBD

    Dialog Translation: Thakur Ranjit Singh

    Production: New Zealand

    Post: Purple Post

    Lights/ Gaffers TBA

    Cranes/ Dolly The Dolly Shop, Auckland

    Tag Line : They came, they saw, they freaked out!!

    FIRST Feature Film in FIJI HINDI Language

    For the first time ever, a theatrical feature film tobe shot and produced in New Zealand and Fiji

    From the industry professionals of Bollywood and NewZealand comes a landmark film

    to be shot in picturesque locations in Auckland, Napierand Fiji.

    is a remarkable and original storyof four talented musicians from a poor village in Fiji.From rustic ragas to modern sagas, their transitionevolves from their determination to participate in aninternational event of music and dance in New Zealand.

    Emotional roller-coaster rides of trend setting music,comical interludes, emotional breakdowns and desperatesituations - a performance of a lifetime that will winfriends and foes.

    We intend to make a quality, commercially successfulfeature film thats entertaining, emotional and funny- something we can all be proud of.

    We have a great team and hope to involve more talentedpeople in the project.

  • 8/9/2019 G Plus Issue # 28

    21/23

    AUGUST 15, 2010, AUCKLANDWWW. LESS4U.CO.NZ

    Roopa aur Aap, an organization that has

    been supporting community events and

    festivals since the past six years, is all set

    to present a programme Jodi Number One, whichfocuses on the importance of relationships. Jodi

    number One will not only have Jodis of h usbands

    and wives and boy friends and girl friends, but

    wil l also include brothers and sisters, friends

    and/or partners. The highlight of the programme

    wil l however be a section tit led, how well you

    know your Jodi, which will have a sequence of

    questions and answers for either partners.

    The programme commences on Thursday, 5th

    August 2010 on Triangle TV at 8 p.m. and the

    number one Jodi will receive a surprise gift from

    the sponsors. Jodi Number One is launching on

    Thursday 5th August, 2010 on Triangle TV at 8pm.

    The series will feature 13 episodes of entertainmentand those who are keen on participating in the

    programme can contact Roopa.

    Roopa aur Aap would like to take this

    opportunity to thank its sponsors Car Clearance

    Centre, Moshim Discount House, Kaysons

    Fashion, Global Visa and others, for their

    support.

    In addition, Roopa aur Aap has also introduced

    a new service that offers video shooting of

    weddi ngs or any auspicious occas ion s. Ple ase

    contact Roopa for further queries on 021-665609

    or email roopa@roopatv.com

    New Zealand Red Cross today announced that it would support an internationalemergency appeal to help people living in miserable conditions after theextensive flash floods in Pakistan.

    Calling for donations, New Zealand Red Cross International Operations Manager

    Andrew McKie said, The funds will help Pakistan Red Crescent Society branchesand volunteers to deliver food, health services, tents, tarpaulins, and water andrelief items including hygiene kits and cooking equipment.

    New Zealand Red Cross is making a contribution of $13,000 to the operation,which wil l help 25,000 families for nine months. Many families have been forcedfrom their homes and have been left with no means of support. They are living inmiserable conditions. This appeal will help the Red Cross deliver more food, waterand shelter materials, said Mr. McKie.

    One hundred percent of funds donated to the Pakistan floods through NewZealand Red Cross will go to the international emergency appeal. New Zealand RedCross urges supporters to donate cash, not goods, so that the right relief items canbe sent to people in need as quickly as possible.

    For more information, you can log on to:http://www.redcross.org.nz/cms_display.php?st=1&sn=43&pg=513Donations can be made online at www.redcross.org.nz or by phoning 0800 RED

    CROSS (0800 733 276).For inquiries contact New Zealand Red Cross communications advisor Rosemarie

    North on (04) 495 0137 or 027 296 9687.

    New community FM radio is all set for a promising launch in MountRoskill area. The radio will basically cater to audiences of various Indiancommunities, mainly the Gujarati audiences. Those interested in presenting

    radio programmes in their own language are requested to send a mail to radiosur88@gmail.com. Religious organisations are also welcome with their programmes.

    Ace Talent is organising a Bollywood dance

    competition for intermediate schools in

    Auc kla nd on 16t h Oct obe r at Doroth y

    Winst on The atre at 7 p.m . The nam e of the

    show is DESI INTERMEDIA- DA Dance OFF.This is the first ever dance competition for kids.

    It is the brainchild of Azhar Adam a dancer,

    choreographer, model, and now an actor with

    Pump up-The Mandali, who felt that there was

    a genuine need for a platform to showcase young

    talent in New Zealand.

    The major prizes for the winners are $1,000

    for the first prize, $500 for the second and $250

    for the third winner, besides 10 other prizes. If

    you r school wishes to enrol l any of its talented

    kids in the competition, please feel free to contact

    Ada m Ali on 027 4414488,09256 1964 or e-mai l

    famida@xtra.co.nz

    New local television is ready for a launch in the Indian market onInternet TV platform. To catch up watch TELSTRACLEAR free onbro adband on www .zi ln.co.nz. You can als o g et more informatio n on

    this on the above mentioned web-site.

    Labour Associate Ethnic Affairs spokesperson, Dr Ashraf Choudhary says theGovernment must take into account the financial struggle migrant and refugeefamilies will face if it introduces changes in the interest-free student loan

    scheme.Labour introduced interest-free loans in 2005 to give more Kiwis the opportunity

    for higher learning. After promising to keep the scheme in place, Prime MinisterJohn Key is now hinting at a back-track, Ashraf Choudhary said.

    Many skills and qualifications gained in migrant countries of origin are nottransferable in New Zealand, and therefore it is vital new migrants undertake studyhere to achieve qualifications that are recognized, he added.

    Earlier this week John Key spoke to students at Victoria University aboutstudent loan debt, and suggested that the interest-free student loan scheme doesnteconomically stack up, Dr Choudhary said. If National is toying with the idea ofbringing back interest it must seriously look at the deterrent impact that will have onmigrant and refugees gaining an education which is beneficial to their family, futuresecurity and to New Zealand, he revealed..

    According to Dr Choudhary, student loans already create long-term impacts onthe financial security of families, such as buying a home and saving for retirement.Women also take twice as long on average to repay their loans, particularly whenthey take time out of the paid workforce to have children, he said.

    Contact: Ashraf Choudhary 021 799 573.

    JODI NO 1INTERNATIONAL RED CROSS LAUNCHESAPPEAL FOR PAKISTAN FLOODS

    NEW COMMUNITY RADIO TO BELAUNCHED IN MOUNT ROSKILL AREA.

    INTERMEDIATE

    DANCE

    COMPETITION

    NEW LOCAL TELEVISION TO BE LAUNCHED SHORTLY

    Migrants loan needs must be considered

    NEW ZEALAND DIARY22

  • 8/9/2019 G Plus Issue # 28

    22/23

    AUGUST 15, 2010, AUCKLAND STAR CLASSIFIED 23WWW. LESS4U.CO.NZ

    learnculinarysecretsfromtheprofessionals...

    Level4, 75KarangahapeRoadPhone:006493750050Fax:006493750035

    info@nzstt.com www.nzstt.ac.nzTollFree: 0800843697

    83HendersonValley Road,Henderson,AucklandEmail: info@ast.ac.nzwww.ast.ac.nz

    TollFree: 0800843697

    Live n

    NewZ

    ela

    i

    andSt

    dy...

    u

    Work

    ...

    NationalDiploma in TourismManagement-Level 5NationalDiplomainBusiness-Level5DiplomainTravel,Tourism& Business-Level5

    NationalCertificate in Hospitality(ProfessionalCookery) Level4

    TheNewZealand Schoolof Travel,TourismandBusiness(NZSTT)

    TheAucklandSchoolofTechnology(AST)

    (Spousecangetwork visaaspercurrentNZISPolicy)

    NZQAAccredited Courses

    Are You ThinkingAbout Career In New Zealand?

  • 8/9/2019 G Plus Issue # 28

    23/23