View
219
Download
2
Category
Tags:
Preview:
Citation preview
Cloning and expression of Aspergillus niger phytase gene in yeast platform and Target gene alteration to improve enzyme characterization
Improvement of phytase Thermostability and Catalytic Efficiency by Site-Directed Mutagenesis for Industrial application
ByArdeshir HesampourIslamic Azad UniversityJuly 2015
1IntroductionPhosphatases are a diverse class of enzymes and can act on a variety of phosphate esters
Phytases ( myo -inositol hexaphosphate phosphohydrolases) are a subgroup of acid phosphatases which hydrolyze phytic acid to myo -Inositol and inorganic phosphates.
2Phytase producing organismFungi, yeasts and bacteriaFungi especially Aspergillus niger is main producer of commercial Phosphatase
Aspergillus niger phytase(histidine phosphatase, 3-phytases) has been well characterized.
Gene encoding Phytase (phyA) has been cloned and sequenced several time.
A.niger phytase, high catalytic efficiency in compare with other phytase producers. But low expression
3Expression of Phytase by YeastsAdvantages of phyA expression in Yeast hosts:
Correct Glycosylation profile of Phytase protein(10 N- glycosylation residue).Active expression of phytase in different yeast hosts are done.High phytate affinityHigh expression productionNon pyrogen and pathogenUtilize broad range of carbon sourcesCost effective bulk recombinant protein production
Saccharomyces serviciaPichia pastorisHansenula polymorphaArxula adenivora
4Phytase Industrial applicationsSoil Amendment:50% of soil appears to be in the form of phytate and its derivatives that require a especial class of phosphatase i.e. phytases for hydrolysisApplications in Feed (Feed additive) Inhibit environmental pollutionPotential in AquaculturePreparation of Myo-Inositol Phosphates
*Industrial Application criteria : High Temperature (feed pelleting) / Low pH Activity
*Protein engineering methods to adopt Phytase for Industrial applications
5GoalRecombinant expression of Aspergillus niger phytase (phyA) in methylotrophic yeast P. pastoris
Protein engineering (site directed mutagenesis) of WT recombinant phytase to improve biochemical properties
Comparison ofbiochemical propertiesof recombinant enzymes containing the mutationsandwildenzyme
Characterization of recombinant phytase
Stage IStage II6
7 Native Aspergillus niger PhyA gene (Gene Bank p34752)MGVSAVLLPLYLLSGVTSGLAVPASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA
The amino acid sequence of native protein and its N-terminal native signal peptide(Underlined)Phytase Protein sequence selection and sequence OptimizationStage IExpression of phyA in P.pastoris8pPink-HC expression vector
AOX1 Promoter-mating factor signalMultiple Cloning SiteCYC1 TerminatorADE2 GeneTRP2 Sequence
9Cloning and expression of phyA gene in Pichia PastorisDigestion of pTG19T-phyA with 5Xho I/ 3Kpn IDigestion of pPink-HC with Xho I/ Kpn I Ligation and transformation in E. coli DH5Plasmid purification
pPinkHC-phyA (Linearization) by Afl II
Transformation of pPinkHC-phyA to P.Pastoris
Screening of phyA integrant clones by specific primers
Sbu Forward 5'-CTCGAGGCTTCTAGAAACCAATCTTCTT-3'Sbu Reverse 5'-GGTACCCTACTAAGATCTAGCGAAACAT-3'
Expression and characterization of recombinant phytase
10Phytase EngineeringStage II11Phytase Engineering parameters
Thermostability
Animal feed commonly pelleted, a commercially attractive phytase should be able to withstand the temperature that are reach temporarily during the pelleting process (60-90 C).
All components of animal feed, including enzymes, are exposed to average temperature of 80 C
Kinetic efficiency12Mutant designing predictions13Candidate point selection Approaches
Comparison of the amino acid sequence of the phyA phytase with that of a thermostable and highly homologous counterpart
Amino acids accessibility and interactions investigation
Introduction of possibly stabilizing amino acids based on the 3D structure of protein
14Structural studies
PhyA structural comparison with homologue thermostable phytases
PDB files analysis by YASARA
15
Candidate points accessibility and interactions analysis
DSSP
Secondary structure assignments
Solvent exposure of proteins
Atomic coordinatesWhat IF :Work in water environmentMultiple Alignment with thermostable homologue phytases16Determination of substituted points
A.aculeatus RCEF 4894 , withstand up to 90C for 10 min
17
Amino acids substitution and modeling
Homology Modelling
The 3D structure of the native A.niger PhyA phytase (Access No. 3K4P) was used as the template.Substituted amino acids (Single and combined) were modeled by Swiss model Modeller , a protein structure homology-modelling server. (Swiss Pdb-Viewer)
18Model validation
PROCHECK/ Model Validation
DSSP / Secondary structureGeometrical featuresSolvent exposure of modeled proteins
19Structural Refinement by Molecular Dynamics (MD)MD simulations can provide great details regarding the motion of individual particles as a function of time in realistic environmentsResults can be used to study the relation between structure and function of biomacromolecules Structural refinement was performed using Gromacs 4.5.3 A pair of simulations was carried out, one in 300 K and the other in 353 K for 4ns and pressure of 1 bar was set under isotropic condition
WT and Mutants heat treatment simulation20Analysis of MD resultsTotal H bond determinationTotal salt Bridge determinationMeasure the number of strong hydrogen bonds formed between residues i and i+10 in the primary sequenceH bond energy calculation21Experimental mutant substitution22Candidate points substitution strategies
De novo design
Rational designSite Directed Mutagenesis (SDM)
Directed evolution
23Quick Change Site Directed Mutagenesis (SDM)
24Designing of substitutions primer
Sequences in italics and bold represent the designated mutant for the target amino acid residue25Single and combined substituted phytase mutants
For successful thermostability engineering, many mutations have to generated and analysed individually, followed by combination of the few stabilizing amino acid exchanges26
27
Synthetic Aspergillus niger phyA in P.pastoris, Gene Bank Accession No. JN 193562.1MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLEKRASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFARS
Amino acid sequence of phytase. The amino acid sequence of synthetic phytase protein of P.pastoris (the alpha mating factor signal peptide of S.cerevisiae is underlined).
Stage I Results28Cloning and expression of synthetic phyA gene in pPink-HC
M: ladder1 : pTG19T-phyA plasmid2: Double digested pTG19T-phyADigestion of pTG19T-phyA with Xho I/ Kpn I
Digestion of pPink-HC with Xho I/ Kpn I 1: ladder2: Double digested pPink-HC 3: pPink-HC plasmidConfirmation by Colony PCRM: ladder1-4: phyA gene(1350bp)5: negative control
bp
3000
1500
12001000
500
400
300
200
10029Transformation and screening of pPinkHC-phyAPichia Pastoris transformation by Electroporation method
Screening of transformants on PAD media
30Genome extraction and Positive colony screening
1: Integrated phyA gene , PCR product with phyA specific primer2: Integrated phyA gene ,1705bp PCR product with -mating factor primer3: negative control M: ladder
1-3 : transformant P.pastorisM : ladder31Expression of phytase in P. pastorisGrowth of recombinant P.pastoris in BMGY media at 30 C
Methanol induction and expression of recombinant phytase in BMMY media at 30 C
32Phytase expression analysis Phytase activity assay SDS-PAGE AnalysisSpecific Activity (U/mg)= Enzyme Activity (U/ml) Total Protein (mg/ml)Phytase activity: 179 U/mlTotal protein: 2.71 mg/mlSpecific activity: 66.05 U/mg
Recombinant phytase50-70 kDaEnzyme + sodium phytateIncubation for 30 minStopping buffer (Sulphuric acid, Ammonium molybdate, Acetone)
Measurement of released Pi at OD380 nm33Purification of recombinant phytase
Smear of 50-65KDaFPLC Method / Size exclusion by Sephadex G100
34Purification of recombinant 2 steps
Two purification steps analysis
Purification stepTotal activity (U)Total protein (mg)Specific activity (U/mg)Recovery(%)Purification(fold)Culture supernatant1792.7166.051001Amicon ultrafiltration1681.8789.8393.851.36Sephadex G100840.69121.7346.921.84Enzyme reactions (n=3) ,Values are mean. 35Glycosylation analysis
Due to heavy yeast glycosylation, the expressed phytase revealed as a smear band on SDS-PAGE with molecular size ranging from 50 to 65 KDa.
Recombinant phytase Smear of 50-65KDa49 KDaAfter Endo H treatment
Endo H protein36Michaelis Menten Kinetics
Kinetic parameters of the purified Recombinant phytase of P.pastoris Km(M)Vmax(mol min-1mg-1)Kcat (s-1)(Kinetic efficiency) (s-1mol-1)P.Pastoris recombinant WT phytase148 1135 0.9168.75 2.11.14106Values are mean SE (n=3).
Graph pad prism 537Phytase characterization
38Phytase thermostability
39Results ofPhytase Engineering(Stage II)40Candidate points determination
S205N & S206A T314S Q315RV62NT150A 41Three-dimensional conformation model
42Quick change site directed mutagenesis(substituted PCR fragment Products)
M : ladder
1-6 and 8-9:substituted phyA gene+pTG19
7: Negative control43Confirmation of mutations
Confirmation of mutations by sequencing
Confirmation of mutations by Colony PCR
M :ladder
1-4: Positive clones with 1350 bp phyA gene
5: negative control44Cloning and expression of mutant phytases in Pichia Pastoris
Substitution of designed points in phyA gene + pTG19T vector by Quick change PCR methodDpn I digestion of PCR productsE.Coli transformation and nick repairDigestion of pTG19T-phyA with Xho I/ Kpn IDigestion of pPink-HC with Xho I/ Kpn I Ligation and transformation in E. coli DH5Plasmid purificationpPinkHC-phyA(mutant) plasmids Linearization by Afl II
Transformation of pPinkHC-phyA(mutants) to P.Pastoris
Screening of phyA integrant clones by specific primers'
Expression and analysis of mutant phytases
45Mutant phytasesThermostability analysis46
Mutant phytases(single substitutions) thermostabilityWT Vs phyA P3 and phyA P4
Among the mutants, the P3(V62N )and P4(T151A) substitutions exhibited higher residual activity at 70C with no statistical significance47Mutant phytases (Double substitutions)thermostabilityWT Vs phyA P7, phyA P8 and phyA P10
P7 (S205N S206A), P8 (T314S Q315R), and P10 (T151A V62N)
Showed improvement in residual activity with a greater thermal retention (P
Recommended